Open Collections

UBC Theses and Dissertations

UBC Theses Logo

UBC Theses and Dissertations

Structural studies of wild-type and variant yeast iso-1-cytochromes c Louie, Gordon, V. 1991

Your browser doesn't seem to have a PDF viewer, please download the PDF to view this item.

Item Metadata


831-UBC_1991_A1 L68.pdf [ 16.26MB ]
JSON: 831-1.0100473.json
JSON-LD: 831-1.0100473-ld.json
RDF/XML (Pretty): 831-1.0100473-rdf.xml
RDF/JSON: 831-1.0100473-rdf.json
Turtle: 831-1.0100473-turtle.txt
N-Triples: 831-1.0100473-rdf-ntriples.txt
Original Record: 831-1.0100473-source.json
Full Text

Full Text

STRUCTURAL STUDIES OF WILD-TYPE AND VARIANT YEAST ISO 1-CYTOCHROMES by Gordon V. Louie B.Sc, The University of British Columbia, 1984 A THESIS SUBMITTED IN PARTIAL FULFILLMENT OF THE REQUIREMENTS FOR THE DEGREE OF DOCTOR OF PHILOSOPHY in THE FACULTY OF GRADUATE STUDIES THE DEPARTMENT OF BIOCHEMISTRY We accept this thesis as conforming to the required standard THE UNIVERSITY OF BRITISH COLUMBIA November 1990 ® Gordon Victor Louie, 1990 In presenting this thesis in partial fulfilment of the requirements for an advanced degree at the University of British Columbia, I agree that the Library shall make it freely available for reference and study. I further agree that permission for extensive copying of this thesis for scholarly purposes may be granted by the head of my department or by his or her representatives. It is understood that copying or publication of this thesis for financial gain shall not be allowed without my written permission. Department of BfOcheiTvis The University of British Columbia Vancouver, Canada Date A/ove/nher- 13. J99Q DE-6 (2/88) ABSTRACT The crystal structure of yeast (Saccharomyces cerevisiae) iso-1- cytochrome c has been determined through molecular replacement techniques, and refined against X-ray diffraction data in the resolution range 6.0-1.23 X to a crystallographic R-factor of 0.192. The yeast iso-1-cytochrome c molecule has the typical cytochrome c fold, with the polypeptide chain organized into five a-helices and a series of loops which serve to enclose almost completely the heme prosthetic group within a hydrophobic pocket Comparison of the structures of yeast iso-1-, tuna and rice cytochromes c shows that the polypeptide backbone fold, intramolecular hydrogen bonding, conformation of side chains and particularly packing within the heme crevice of protein groups against the heme moiety are very similar in the three proteins. Significant structural differences among the three cytochromes c can be explained by differences in amino acid sequence. X-ray crystallographic techniques have also been used to study the effect of single-site amino acid substitutions at Phe82 and at Arg38 in iso-1-cytochrome c. The structures of the various variant iso-1-cytochromes c have been determined at nominal resolutions in the range 2.8 to 1.76 A. Conspicuous structural perturbations in the neighborhood of the substituted side chain are evident in all of the variant proteins. In wild-type iso-1-cytochrome c, the phenyl ring of Phe82 is positioned adjacent and approximately parallel to the heme group, and occupies a non-polar cavity within the heme crevice. In the Ser82 variant, a channel extending from the surface of the molecule down into the heme crevice is created. In the Gly82 variant, the polypeptide backbone has refolded into the space formerly occupied by the phenyl ring of Phe82. Steric conflicts prevent both the phenolic ring of Tyr82 and the side chain of Ile82 from being completely accommodated within the pocket normally occupied by a phenyl ring. Substitution of alanine at position 38 causes a slight reorganization of the hydrogen bonding network in which Arg38 normally participates, and also exposes to external solvent a normally buried propionic acid group of the heme. The altered functional properties of the position 82 variant proteins have been interpreted with respect to the observed structural perturbations. The drop in reduction potential, most notably Ul for the Ser82 and Gly82 variants, can be explained by the elevated heme environment polarity arising from the increased access of solvent or polar protein groups to the heme pocket The reduced stability of the heme crevice, as indicated by lowered pKa's for alkaline isomerization, is likely due to the disruption of stabilizing packing forces formed by the Phe82 phenyl ring within its hydrophobic cavity. The lowered activity, in comparison to the wild-type protein and the Tyr82 variant, for electron transfer with Zn+-cytochrome c peroxidase is attributed to the loss of an aromatic group positioned adjacent to the heme group. The altered surface topography of the variant proteins (particularly the Gly82, Tyr82 and Ile82 variants) may further hinder productive complex formation between cytochrome c and its redox partners. These results suggest that the invariant Phe82 contributes in at least three ways to the proper functioning of cytochrome c. It has an important structural role in maintaining the integrity of the heme crevice and in establishing the appropriate heme environment The phenyl ring of Phe82 may also be required for efficient movement of an electron to and from the heme of cytochrome c. Finally, Phe82 may have a role in forming intermolecular interactions with enzymic redox partners of cytochrome c. iv TABLE OF CONTENTS ABSTRACT . . ii TABLE OF CONTENTS iv LIST OF TABLES xii LIST OF FIGURES . xv ABBREVIATIONS AND SYMBOLS USED xix ACKNOWLEDGMENTS xxi L INTRODUCTION . 1 A. The cytochromes c 1 1. General biochemical properties of eukaryotic cytochrome c 2 2. General structural properties of cytochrome c 3 a. Structural description 3 b. Alkaline isomerization . . 7 B. Aspects related to the electron transfer role of cytochrome c . . . . . 8 1. Electron transfer reactivity of cytochrome c 8 2. Factors which influence heme reduction potential . 9 3. Proposed mechanisms of electron transfer . 12 4. Redox-state dependent conformational changes 13 5. Modelling of intermodular complexes between cytochrome c and its physiological redox partners 15 C. Amino acid conservation in the cytochromes c 17 D. Structure-function studies of cytochrome c . . . . . ' 19 1. Chemical modification 21 a. Heme prosthetic group 21 V b. Histidine and methionine 22 c. Tryptophan and tyrosine 23 d. Lysine and arginine 23 2. Naturally-occurring variants from different species of organisms 25 3. In vivo- generated mutants 26 4. Semi-synthesis 30 5. Site-directed mutagenesis 38 E. Yeast iso-1-cytochrome c . 42 F. Site-directed mutagenesis of Phe82 in yeast iso-1-cytochrome c . . . . . . . . . . 43 G. Site-directed mutagenesis of Arg38 in yeast iso-1-cytochrome c . 48 H. Site-directed mutagenesis of Cysl02 in yeast iso-1-cytochrome c . . . . . . . . . . 49 I. Objectives of the present research 50 Appendix: Basic primer on structure determination using X-ray crystallography . . . . . . 50 1. Crystalline structure 50 2. Diffraction theory 51 3. Basic X-ray crystallographic theory 51 4. Patterson synthesis and molecular replacement methods . 5 3 5. Refinement . 55 H. EXPERIMENTAL PROCEDURES USED IN STRUCTURAL ANALYSES 58 A. Source of protein for crystallization experiments 58 B. Growth of crystals 58 C. Characterization of the crystals 60 1. Oxidation state of crystalline iso-1-cytochrome c 60 2. Treatment of crystals prior to X-ray analysis . . 61 3. Space group and external morphology of the crystals 62 D. Collection of X-ray diffraction data . . 64 E. Data processing 65 vi F. Structure solution of iso-1- cytochrome c using molecular replacement methods . . . . . 66 1. Construction of a search model for yeast iso-1-cytochrome c . . 66 2. Rotation function search 67 3. Searches for the translational positioning of the model for yeast iso-1-cytochrome c 67 a. Translation function search 67 b. Packing analysis 68 c. Correlation coefficient searches 68 4. Rigid body refinement of orientational and translational positioning 69 G. Structure refinement procedures . . 70 H. Electron density maps 71 1. Map inspection . 71 2. Modelling of solvent structure 72 3. Preliminary difference maps in the analysis of variant yeast iso-1-cytochromes c . . . . . . .' . . . 72 I. Inclusion of hydrogen atoms 73 J. Comparison of cytochrome c structures 74 DI. THE STRUCTURE OF WILD-TYPE YEAST ISO-1-CYTOCHROME c . . . . . . 76 A. Details of the structure solution . 76 1. X-ray diffraction data 76 2. Structure solution using molecular replacement 78 a. Rotation function 78 b. Translational searches 79 c. Rigid body refinement 81 3. Structure refinement 81 4. Quality of the final structural model . . . . . . . 85 5. Effect of the inclusion of hydrogen atoms 87 B. Description of the conformation of the iso-1-cytochrome c molecule . . . . . . . . 89 vii 1. Overall conformation 89 2. Main chain torsion angles . 90 3. Secondary structure in yeast iso-1- cytochrome c . . . . . . . . . . . . . . 91 4. Conformation of side chains . . 95 5. Side chains with multiple conformations 97 6. Poorly ordered regions of the iso-1-cytochrome c molecule . . 97 7. Heme conformation, and interactions 98 C. Hydrogen bonding 101 D. Solvent structure . . . . . . . . . . . . .105 1. The complement of solvent molecules associated with iso-1-cytochrome c . . . . 105 2. Hydrogen bonding interactions . . . . . . . . . . . . . .107 3. Internal water molecules I l l 4. Anion binding site . 112 E. Polypeptide chain mobility and internal cavities 114 F. Crystal packing . 117 G. Distinctive features of the yeast iso-1-cytochrome c molecule 120 1. N-terminus . . . . . . . . . . . . . . . . . . . 120 2. Arginine 13 . 121 3. e-N-Trimethyl lysine 72 122 4. Cysteine 102 124 H. Amino acid residues at which site-specific replacements have been made . . . . . . . 126 1. Phenylalanine. 82 . 126 2. Arginine 38 127 IV. STRUCTURAL COMPARISON OF YEAST ISO-1-, TUNA AND RICE CYTOCHROMES c . 129 A. Overall structural conservation 131 1. Polypeptide backbone conformation . . . . . . . . . . 131 viii 2. Side chain conformations . . . . . . . . . . . . . . . . . . . . . . . 133 3. Intramolecular hydrogen bonding 136 B. Large conformational differences between yeast iso-1-, tuna and rice cytochromes c . . 138 1. Polypeptide chain backbone . . . . . . . . . . . . . . . . . . . . . . 138 2. Conserved amino acid side chains with variant conformations . . . . . . . . . 142 C. Oxidation-state dependent conformational differences 145 D. Crystal packing . . . . . . . .. . . . . . . . . . . .147 E. Internal mobility . . 148 F. Internal packing efficiency 150 G. Solvent structure 151 1. Bound water molecules . 151 2. Anion binding site 153 V. SERINE 82 VARIANT OF YEAST ISO-1-CYTOCHROME c 154 A. Details of the structure determination . . . . . . . 154 1. X-ray diffraction data . 154 2. Difference map 154 3. Refinement of the structure of the Ser82 variant . . . . . . 155 B. Description of structural changes . . . . ". . . . . 156 1. Vicinity of the substitution site . . 156 2. Solvent accessibility to the heme crevice 159 3. Remote from the substitution site 160 C. Correlation of structural changes with differences in functional properties . . . . . . . 162 1. Solvent accessibility to the heme pocket and polarity of the heme environment . . 162 a. Reduction potential 162 b. Reactivity of iso-1-cytochrome c with small molecule electron transfer reagents 163 2. Stability of the heme crevice 163 ix 3. Electron transfer activity 164 D. Possible explanations for remote conformational changes ; . . . . . . 165 VI. GLYCINE 82 VARIANT OF YEAST ISO-1-CYTOCHROME c . . . . . . 168 A. Details of the structure determination .168 1. X-ray diffraction data 168 a. Gly82(Cysl02) variant . . . . . . . . . . . . 168 b. Gly82(Thrl02) variant 168 2. Difference maps 169 a. Gly82(Cysl02) variant . . 170 b. Gly82(Thrl02) variant 170 3. Refinement of the structures of the Gly82 variants . . . . 171 a. Gly82(Cysl02) variant 171 b. Gly82(Thrl02) variant . . . . 7 . . 172 B. Description of structural changes . 173 1. Polypeptide chain refolding in the vicinity of Gly82 . . . 176 a. Gly82(Cysl02) variant 176 b. Gly82(Thrl02) variant 178 2. Solvent structure in the vicinity of the substitution site . . . . . . . . . . . 179 a. Gly82(Cysl02) variant . . . . . . . . . . . . . . . . . . . . . 179 b. Gly82(Thrl02) variant . 179 3. Other structural differences . . . . . 180 a. Gly82(Cysl02) variant 180 b. Gly82(Thrl02) variant 181 i. Vicinity of the substitution site 182 ii. Oxidation-state dependent structural changes 182 iii. Threonine 102 7 . . . . • 183 X 4. Comparison of the refolded conformations in the Gly82(Cysl02) and Gly82(Thrl02) variants 184 C. Correlation of structural changes with differences in functional properties . 185 1. Accessibility of the heme pocket to solvent . . . . . . . . . . . . . . . . 185 2. Reduction potential and the polarity of the heme environment . . . . . . . . 186 3. Stability of the heme crevice . 189 4. Electron transfer activity 189 D. Discussion of the polypeptide chain refolding . . . . . .' . .. . . 191 VH. TYROSINE 82 VARIANT OF YEAST ISO-1-CYTOCHROME c . . . . . . . . . 195 A. Details of the structure determination 195 1. X-ray diffraction data .195 2. Difference maps 195 3. Refinement of the structure of the Tyr82 variant 196 B. Structural differences between the Tyr82 variant and wild-type iso-1-cytochrome c molecules . 197 C. Correlation of structural changes with differences in functional properties . 201 1. Accessibility to the heme crevice and polarity of the heme environment . . . . 201 2. Stability of the heme crevice 202 3. Electron transfer activity . 203 VIE. ISOLEUCINE 82 VARIANT OF YEAST ISO-1-CYTOCHROME c 205 A. Details of the structure determination 205 1. X-ray diffraction data 205 2. Difference maps 205 3. Refinement of the structure of the Ile82 variant . . . . . . . . . . . . . . 206 B. Structural comparison of the Ile82 variant and wild-type iso-1-cytochromes c . . . . . 207 C. Correlation of structural changes with differences in functional properties . . . . . . . 210 1. Accessibility to the heme crevice and polarity of the heme environment . . . . 210 xi 2. Stability of the heme crevice . . • • • • • • • • • • 212 3. Electron transfer activity 213 L \ . ARGININE 38 VARIANT OF YEAST I S O - 1 - C Y T O C H R O M E c . . 214 A. Details of the structure determination 214 1. X-ray diffraction data . . 2 1 4 2. Difference map 214 3. Refinement of the structure of the Ala38 variant . . . . . . . . . .' . . . 215 B. Structural comparison of the Ala38 variant and wild-type iso-1-cytochromes c 216 1. Polypeptide chain conformation 216 2. Propionic acid group of the heme pyrrole ring A 219 3. Solvent structure in the vicinity of the substitution site 220 C. Influence of Arg38 on reduction potential 221 X. S U M M A R Y 223 XI. REFERENCES 227 xii LIST OF TABLES I: INTRODUCTION 1. Roles inferred from structural considerations for the invariant residues of eukaryotic cytochromes c • • • • • • • 20 2. Summary of site-specific modifications of cytochrome c generated using semi-synthesis 31 3. Properties of position 82 variants of iso-1-cytochrome c . . . . . . . . . . . . . 44 II. EXPERIMENTAL PROCEDURES USED IN STRUCTURAL ANALYSES 1. Growth conditions, sizes and unit cell dimensions of crystals of wild-type and variant iso-1-cytochromes c 61 2. Typical weighting on stereochemical ideality used in restrained least-squares refinement of iso-1-cytochrome c structures . 71 3. Rotation matrices and translation vectors applied for structural superposition of tuna and rice cytochromes c onto yeast iso-1-cytochrome c 75 III. THE WILD-TYPE STRUCTURE OF YEAST ISO-1-CYTOCHROME c 1. Crystals of wild-type iso-1-cytochrome c used in data collection to 1.23 X 76 2. Summary of merging of data sets for wild-type iso-1-cytochrome c . . . . . . . . . 77 3. Summary of results of the rotation function searches for yeast iso-1-cytochrome c 78 4. Agreement with ideal stereochemistry in the final refined model of wild-type yeast iso-1-cytochrome c at 1.23 X resolution 86 5. Effect of inclusion of hydrogen atoms on refined atomic temperature factors . . . . . . 88 6. Secondary structural elements present in yeast iso-1-cytochrome c 92 7. Side chains with multiple conformations in yeast iso-1-cytochrome c 98 8. Disordered regions of the yeast iso-1-cytochrome c structure 99 9. Heme conformation, interactions and ligand geometry in wild-type yeast iso-1-cytochrome c 100 10. Intramolecular hydrogens bonds occurring in wild-type yeast iso-1-cytochrome c . . . . . . . . . . . . 103 11. Summary of hydrogen bonds made by water molecules in the structure of wild-type iso-1-cytochrome c 107 12. Organization of solvent into networks associated with yeast iso-1-cytochrome c . . . . 109 xiii 13. Temperature factors of water molecules bound to yeast iso-1-cytochrome c as a function of the number of hydrogen bonds made . . . . 110 14. Intermolecular packing contacts occurring in crystals of yeast iso-1-cytochrome c 119 IV. STRUCTURAL COMPARISON OF YEAST ISO-1-, TUNA AND RICE CYTOCHROMES c 1. Details of the structure determinations of the various cytochromes c . . 129 2. Matrix of structural equivalence and amino acid sequence identity for yeast iso-1-, tuna and rice cytochromes c 130 3. Comparison of side chain torsion angles in yeast iso-1-cytochrome c with those found in the tuna and rice proteins 134 4. Differences between yeast iso-1-, tuna and rice cytochromes c in main chain hydrogen bonding 137 5. Conserved hydrogen bonds involving side chains in yeast iso-1-, tuna and rice cytochromes c 138 6. Differences in mobility between the polypeptide backbones of yeast iso-1-, tuna and rice cytochromes c 150 7. Conserved water molecules in the structures of yeast iso-1-, tuna and rice cytochrome c . . . . . . . . . . . . . . . . . . .152 V. SERINE 82 VARIANT OF YEAST ISO-1-CYTOCHROME c 1. Agreement with ideal stereochemistry in the final refined model of the Ser82 variant of yeast iso-1-cytochrome c at 2.8 X resolution 155 VI. GLYCINE 82 VARIANT OF YEAST ISO-1- CYTOCHROME c 1. Agreement with ideal stereochemistry in the final refined models of the Gly82 variants of yeast iso-1-cytochrome c . . . . . 172 2. Course of refinement of the structure of the Gly82(Thrl02) variant of yeast iso-1-cytochrome c . . 173 3. Comparison of main chain torsion angles in the vicinity of residue 82 in wild-type and Gly82 variant iso-1-cytochromes c 177 VII. TYROSINE 82 VARIANT OF YEAST ISO-1-CYTOCHROME c 1. Agreement with ideal stereochemistry in the final refined model of the Tyr82 variant of yeast iso-1-cytochrome c at 1.97 X . 197 VIII. ISOLEUCINE 82 VARIANT OF YEAST ISO-1-CYTOCHROME c 1. Agreement with ideal stereochemistry in the final refined model of the Ile82 variant of yeast iso-1-cytochrome c at 2.3 A . . . . . . . . . . . . . . . . . 207 IX. ALANINE 38 VARIANT OF YEAST ISO-1-CYTOCHROME c 1. Agreement with ideal stereochemistry in the final refined model of the Ala38 variant of yeast iso-1-cytochrome c at 2.0 A XV LIST OF FIGURES I. INTRODUCTION 1. Schematic representation of the protoheme IX group of cytochrome c . . 2 2. Schematic representation of the structure of eukaryotic cytochrome c . . . 5 3. Degree of amino acid variability along the polypeptide chain of eukaryotic cytochromes c 18 II. EXPERIMENTAL PROCEDURES USED IN STRUCTURAL ANALYSES 1. Precession photographs from crystals of wild-type yeast iso-1-cytochrome c . . . . . . 63 2. Photomicrograph of a crystal of wild-type yeast iso-1-cytochrome c 64 III. THE STRUCTURE OF WILD- TYPE YEAST ISO-1- CYTOCHROME c 1. Course of structural refinement of wild-type yeast iso-1-cytochrome c to 2.8 A resolution 82 2. Course of structural refinement of wild-type yeast iso-1-cytochrome c at high resolution 83 3. Dependence on resolution of the R-factor and the percentage of available data used for the final refined structure of yeast iso-1-cytochrome c . . . 84 4. Stereo diagrams of portions of the electron density map calculated for the final model of yeast iso-1-cytochrome c 87 5. Stereo diagram of the polypeptide chain backbone and heme group of yeast iso-1-cytochrome c 89 6. Ramachandran plot for wild-type yeast iso-1-cytochrome c 90 7. Stereo diagram of the distorted 7-turn at residues 27 to 29 in yeast iso-1-cytochrome c 91 8. Stereo diagram of the short segment of antiparallel /3-sheet in yeast iso-1-cytochrome c . . 94 9. Stereo diagram illustrating the positioning of side chains in yeast iso-1- cytochrome c 95 10. Distribution of side chain dihedral torsion angles in yeast iso-1-cytochrome c . . . . . 96 11. Interactions formed by the heme propionic acid groups in wild-type yeast iso-1-cytochrome c 102 12. Stereo diagram of the solvent molecules associated with a single molecule of wild-type iso-1-cytochrome c . . . . . . . . . . . 106 xvi 13. Stereo diagrams of the local environments of the two water molecules forming four hydrogen bonds to main chain atoms of iso-1-cytochrome c I l l 14. Stereo diagram of the electron density and hydrogen bonding interactions of the sulfate ion bound to iso-1-cytochrome c 113 15. Average temperature factors of the main chain and side chain atoms of each amino acid residue in wild-type yeast iso-1-cytochrome c 114 16. Stereo drawing of the packing of molecules in crystals of yeast iso-1-cytochrome c 117 17. Stereo diagram of the local environment of Tml72 in yeast iso-1-cytochrome c . . . . 123 18. Stereo diagram of the local environment of Cysl02 in yeast iso-1-cytochrome c . . . 125 19. Stereo diagram of the local environment of Phe82 in yeast iso-1-cytochrome c . . . . 126 20. Stereo diagram of the local environment of Arg38 in yeast iso-1-cytochrome c . . . . 128 IV. STRUCTURAL COMPARISON OF YEAST ISO-1-, TUNA AND RICE CYTOCHROMES c 1. Primary sequence alignment of yeast iso-1-, tuna and rice cytochromes c . . . . . . . 130 2. Comparison of the polypeptide backbone conformations of yeast iso-1-, tuna and rice cytochromes c • • • 131 3. Stereo drawing showing the sites of variability in amino acid identity between yeast iso-1-, tuna and rice cytochromes c 132 4. Conformations of the heme groups and of the side chains of conserved residues in the heme pockets of yeast iso-1-, tuna and rice cytochromes c . . . . . . . . 136 5. Differences in conformation between yeast iso-1- and rice cytochromes c at residues 20 to 25 • • • • • 139 6. Differences in conformation between yeast iso-1- and tuna cytochromes c at residues 55 to 57 140 7. Comparison of the conformations of the Arg38 side chain in yeast iso-1-, tuna and rice cytochromes c 143 8. Comparison of the conformations of the Arg91 side chain in yeast iso-1-, tuna and rice cytochromes c • • • • • • • • • • • • • • • • • • • • 144 9. Oxidation-state dependent structural differences in cytochrome c 146 10. Comparison of the polypeptide backbone flexibilities of yeast iso-1-, tuna and rice cytochromes c . . . . . 149 • xvii V. SERINE 82 VARIANT OF YEAST ISO-1-CYTOCHROME c 1. Stereo drawing of the F0(wild-type) - F0(Ser82) difference map in the vicinity of residue 82 . . . 154 2. Comparison of the polypeptide backbone conformations of the Ser82 variant and wild-type iso-1-cytochromes e . . . . . . . . . . . . . . . . . . . . . . 157 3. Stereo drawing of the region around residue 82 in the Ser82 variant and wild-type iso-1-cytochromes c 158 4. Comparison of the molecular surface in the region of residue 82 in wild-type and Ser82 variant iso-1-cytochromes c . . . . 160 5. Stereo drawing showing structural differences between the Ser82 variant and wild-type iso-1-cytochromes c in the region around the heme propionic acid group of pyrrole ring A . 162 VI. GLYCINE 82 OF YEAST ISO-1-CYTOCHROME c 1. Stereo drawings of the F0(wild-type) - FQ(Gly82) difference maps in the vicinity of residue 82 for the Gly82(Cysl02) and Gly82(Thrl02) variants of iso-1-cytochrome c . . 169 2. Comparison of the polypeptide backbone conformations of the Gly82 variant and wild-type iso-1-cytochromes c 174 3. Stereo drawing of the region around residue 82 in the Gly82(Cysl02) variant and wild-type iso-1-cytochromes c . . . 176 4. Stereo drawing of the region around residue 82 in the Gly82(Thrl02) variant and wild-type iso-1-cytochromes c 178 5. Stereo drawing showing structural differences between the Gly82(Cysl02) variant and wild-type iso-1-cytochromes c in the region around the internal water molecule Watl66 181 6. Oxidation-state dependent structural differences between the oxidized Gly82(Thrl02) and reduced wild-type iso-1-cytochromes c 183 1. Comparison of the conformations of the polypeptide chain around residue 82 in the Gly82(Cysl02) and Gly82(Thrl02) variant iso-1-cytochromes c . . . . . . . . 184 8. Molecular surface in the region of residue 82 in the Gly82(Cysl02) and Gly82(Thrl02) variant iso-1-cytochromes e . . . . . . . . . . . . . . . . . 187 VII. TYROSINE 82 VARIANT OF YEAST ISO-1-CYTOCHROME c 1. Stereo drawing of the FQ(Tyr82) - FQ(wild-type) difference map in the vicinity of residue 82 195 2. Comparison of the polypeptide backbone conformations of the Tyr82 variant and wild-type iso-1-cytochromes c . . . . . . . . . . . . . . . . . . . . 198 xviii 3. Stereo drawing of the region around residue 82 in the Tyr82 variant and wild-type iso-1-cytochromes c 199 4. Molecular surface in the region of residue 82 in the Tyr82 variant iso-1-cytochrome c . 202 VIII. ISOLEUCINE 82 VARIANT OF YEAST ISO-1-CYTOCHROME c 1. Stereo drawing of the FQ(wild—type) - F0(Ile82) difference map in the vicinity of residue 82 . . . . . . . . . . . 205 2. Comparison of the polypeptide backbone conformations of the Ile82 variant and wild-type iso-1-cytochromes c . . . . . . . . . . 208 3. Stereo drawing of the region around residue 82 in the Ile82 variant and wild-type iso-1-cytochromes c . . . 209 4. Molecular surface in the region of residue 82 in the Ile82 variant iso-1-cytochrome c 211 IX. ALANINE 38 VARIANT OF YEAST ISO-1-CYTOCHROME c 1. Stereo drawing of the FQ( wild-type) - F0(Ala38) difference map in the vicinity of residue 38 . . . . 214 2. Comparison of the polypeptide backbone conformations of the Ala38 variant and wild-type iso-1- cytochromes c . . 217 3. Stereo drawing of the region around residue 38 in the Ala38 variant and wild-type iso-1-cytochromes c . . . . . . . . . 218 4. Molecular surface in the region of residue 38 in the Ala38 variant iso-1-cytochrome c 220 A B B R E V I A T I O N S A N D S Y M B O L S U S E D Crystallographic unit cell axes, or axis lengths Axes of the crystallographic reciprocal lattice Euler angles specifying orientation of molecule Phase associated with a structure factor magnitude (sometimes written with a subscript 'c' to emphasize that the phase is calculated) Adenosine 5'-triphosphate Yeast cytochrome c peroxidase Circular dichroism Dithiothreitol Midpoint reduction potential (usually at pH 7) Ethylene diamine tetraacetic acid Structure factor magnitude (FQ: observed; F c : calculated; F c ' : calculated without the contribution of a fragment of the atomic model) Miller indices specifying indices of a X-ray reflection Observed diffraction intensity Nuclear magnetic resonance Nuclear Overhauser effect Optical rotatory dispersion Root mean squared Estimated standard deviation in the magnitude of an observed structure factor Sodium dodecyl sulfate e-N-trimethylated lysine N,N,N',N'-tetramethyl-p-phenylenediamine XX UV Ultraviolet u v w Fractional coordinates specifying position in Patterson space x Fractional coordinates specifying position in the crystallographic unit cell y z The conventions of the IUPAC-IUB Combined Commission on Biochemical Nomenclature are followed for both three-letter and one-letter abbreviations for amino acids [/. Biol. Chem. 241, 527-533 (1966); /. Bid. Chem. 243, 3557-3559 (1968)]; for designating atoms of the polypeptide chain [/. Bid. Chem. 245, 6489-6497 (1970)]; and for describing the conformational torsion angles of main chain and side chain groups of the polypeptide chain [/. Bid. Chem. 245, 6489-6497 (1970)]. Designations for the atoms of the protoheme DC group are according to the Brookhaven National Laboratory Protein Data Bank (Bernstein et al., 1977; see Figure 1.1). Throughout this thesis, amino acid residue numbers in cytochrome c are designated according to the numbering system for vertebrate cytochromes c. In particular, with respect to higher eukaryotic cytochromes c, the yeast iso-1-protein has a 5-residue long extension at its amino-terminus, and the residues in this extension have sequence numbers -5 to -1. xxi ACKNOWLEDGMENTS I would like to offer thanks to the numerous people who have made contributions to the work described in this thesis. Chris Sherwood initially established conditions suitable for growth of yeast iso-1-cytochrome c crystals. Connie Leung kindly provided many of the crystals used in structural determinations. Gary Pielak, Rob Cutler, Alf Gartner, Linda Pearce, Jeanette Johnson, and others have supplied protein samples for crystallization. Past and present members of the laboratories of Gary Brayer, Grant Mauk and Michael Smith have been the source of numerous stimulating and enlightening discussions. I am particularly indebted to Stephen Evans for writing many invaluable and clever programs used in structural analyses. I sincerely acknowledge my research supervisor, Gary Brayer, for the insights, guidance, and encouragement he has provided during my stay in his lab. I am also grateful to my other two supervisory committee members, Grant Mauk and Ross MacGillivray, for their careful reading of this thesis and for considerate advice and suggestions. Also, the Medical Research Council of Canada is acknowledged for provision of a Studentship. Finally, I must extend my deepest appreciation to my family for their patient support over these past years. 1 I. INTRODUCTION A. The cytochromes c Cytochrome c is an electron transfer protein that occurs in the energy-transducing electron transport chains of many organisms. Because of its ubiquity, small size, solubility, and ease of extraction and purification, and the great importance of electron transfer reactions such as those carried out by this protein, cytochrome c has been extensively studied (for review articles, see Margoliash and Schejter, 1966; Harbury and Marks, 1973; Dickerson and Timkovich, 1975; Salemme, 1977; Ferguson-Miller et al., 1979; Timkovich, 1979; Meyer and Kamen, 1982; Mathews, 1985; Williams et al., 1985b; Pettigrew and Moore, 1987; Pielak et al., 1987a; Dixon, 1988). The cytochromes c are proteins which contain a heme prosthetic group, derived from the protoporphyrin IX skeleton. The heme is attached covalently to the polypeptide chain by thioether bonds formed through the addition of a cysteinyl sulfhydryl group to each of the two heme vinyls. The two cysteine residues involved occur in the sequence Cys-X-Y-Cys-His, with the histidine residue contributing one of the axial ligands to the heme iron. The various classes of cytochrome c differ in the location along the polypeptide chain of the heme attachment site, the number of heme groups per polypeptide chain, the identity of the sixth axial ligand, and the occurrence of additional prosthetic groups (e.g. flavins). The best characterized class is mitochondrial cytochrome c. Cytochromes c of this type have a single heme bound near the N-terminal end of the polypeptide chain; have as the sixth axial ligand a methionine side chain, provided by a residue occurring near the C-terminus; and have a relatively positive reduction potential. The mitochondrial cytochromes c, which include proteins of both eukaryotic and prokaryotic origin, have been further subgrouped according to the length of the polypeptide chain (Dickerson, 1980). Members of the small subclass have 79-99 amino acid residues, the medium subclass 100-112, and the large subclass 113-134. Eukaryotic cytochromes c belong to the medium subclass, and have highly conservative amino acid sequences. In contrast, among prokaryotic cytochromes c of the mitochondrial type, there is considerable diversity in both size (members of 2 all three subclasses occur) and amino acid sequence. Discussion herein will be almost completely restricted to mitochondrial eukaryotic cytochrome c. 1. General biochemical properties of eukaryotic cytochrome c In mitochondria, cytochrome c is a peripheral membrane protein, and occurs in the intermembrane space. It serves to carry an electron from cytochrome c reductase (coenzyme Q-cytochrome c oxidoreductase, complex LU) to cytochrome c oxidase (complex IV), two membrane-bound complexes of the respiratory chain. That cytochrome c is the penultimate carrier in this electron transport chain is consistent with its relatively high reduction potential (-260 mV). Cytochrome c is characterized by its covalently bound protoheme IX prosthetic group (Figure 1.1). The heme group is attached to the polypeptide chain through thioether linkages between its two vinyl groups and two cysteinyl side chains (Cysl4 and Cysl7) from the protein molecule. [Three exceptions are observed; in the cytochromes c of Euglena gracilis, Crithidia Figure LI. Schematic representation of the protoheme IX group of cytochrome c. The heme atoms and pyrrole rings are labelled according the convention (Bernstein et al., 1977) used throughout this thesis. 3 oncopelti and Crithidia fascicidata, Cysl4 is replaced by alanine and only a single thioether linkage occurs (Pettigrew et al., 1975; Hill and Pettigrew, 1975).] The UV-visible spectra of metalloporphyrins are characterized by the presence of three bands, whose positions are influenced by the nature of the side chain substituents on the heme chromophore. For cytochrome c, the a, /3 and 7 (Soret) bands occur at 550-558 nm, 521-527 nm and 415-423 nm, respectively. The heme iron atom of cytochrome c is relatively inert; at physiological temperature and pH, cytochrome c is not readily auto-oxidizable and is resistant to binding of exogenous ligands (such as cyanide and carbon monoxide). In addition to forming coordinate bonds with the four pyrrole nitrogens, the central iron atom of the heme is liganded by histidine (Hisl8) and methionine (Met80) side chains from the protein. Cytochrome c carries electrons via a reversible cycling between the +2 and +3 oxidation states of the active-site heme iron. It should be noted that because coordination of the iron ion to the heme requires the dissociation of two pyrrole hydrogens, the porphyrin portion of the heme carries a -2 charge. Thus cycling between the +2 and +3 oxidation states of the heme iron actually involves a change between 0 and +1 in the net charge of the heme. Coordination of the sulfur atom of Met80 to the heme iron is associated, when the iron is the oxidized state, with an absorbance at 695 nm arising from a charge-transfer transition (Adar, 1979). The 695 nm band is frequently used as an indicator of structural integrity. Eukaryotic cytochromes c are typically 103-113 amino acid residues in length. One of the most notable features of the amino acid sequence is the high content of basic residues. Cytochrome c is thus a very basic protein, with a pi of-10. 2. General structural properties of cytochrome c a. Structural description The tertiary structures of several mitochondrial-type cytochromes c have previously been determined. These include members from several eukaryotes and also from a diverse group of prokaryotes. Cytochromes c in the oxidized form have been studied from horse (2.8 X; Dickerson et al., 1971) and rice (1.5 X; Ochi et al., 1983). The structures of both reduced and oxidized 4 cytochrome c of bonito (2.3 X and 2.8 X, respectively; Tanaka et al., 1975; Matsuura et al., 1979), and tuna (1.5 X and 1.8 X, respectively; Takano and Dickerson, 1981a, b) are known. The structures of two members of the large class of prokaryotic mitochondrial cytochrome c have been determined: oxidized cytochrome c2 from the purple non-sulfur bacterium Rhodospirillum rubrum (1.7 X; Salemme et al., 1973; Bhatia, 1981), and oxidized cytochrome c55o from the facultative nitrate-reducing bacterium Paracoccus denitrificans (2.45 X; Timkovich and Dickerson, 1976). In addition, the structures of several prokaryotic cytochromes c of the small class are known: both oxidized and reduced cytochrome c 5 5 1 of another denitrifying bacterium, Pseudomonas aeruginosa (1.6 X; Matsuura et al., 1982); oxidized cytochrome Cm from the green sulfur bacterium Chlorobium thiosulfatophilum (2.7 X; Korszun and Salemme, 1977); and cytochrome c5 5 4 from the cyanobacterium Anacystis nidulans (3.0 X; Ludwig et al., 1982). Comparison of the structures of these cytochromes c shows that they share the same basic cytochrome c fold. It has thus been proposed that all mitochondrial-type cytochromes c have descended from a common evolutionary ancestor (Dickerson et al., 1976). The cytochrome c fold resembles a clamshell of protein enclosing the heme group within a hydrophobic core (Timkovich, 1979). The general fold of mitochondrial eukaryotic cytochrome c can be described as follows (see Figure 1.2). The amino-terminal portion of the polypeptide chain (residues 1 to 12) forms an a-helix along the top of the molecule. Cysteines 14 and 17 form the thioether linkages to the heme group, and histidine 18 ligands the heme iron. Residues 19 through 46 form a series of loops which envelop the right face of the heme group. Residues 40 through 49 constitute the floor of the cytochrome c molecule. A short a-helix at the lower left formed by residues 50 to 55 is followed by an extended segment of polypeptide chain composed of residues 55 to 60, which makes up the lower part of the rear wall. Two consecutive a-helices formed by residues 61 to 69 and 70 to 74 constitute the left side of the molecule. Residues 76 through 87 form a segment of extended polypeptide chain which sweeps across the upper left face of the heme group, and which provides the methionine 80 ligand. Finally, residues from 88 to the C-terminus form an a-helix which runs diagonally across the back of the molecule. The regions of the cytochrome c 5 Figure 1.2. Schematic representation of the structure of eukaryotic cytochrome c Regions of the polypeptide chain having an a-helical conformation have been represented as solid cylinders, and regions forming loop structures as ribbons. Also shown are the heme group; the side chains of Cysl4 and Cysl7, which form thioether bonds to the heme; and the side chains of Hisl8 and Met80, which form coordinate bonds to the heme iron. The N- and C - termini have been labelled, and the terminal residues of the helices have been numbered. The front of the molecule has been shaded darkly, while the rear of the molecule is unshaded. Note that the cytochrome c molecule is shown here in a standard orientation for viewing (Dickerson and Timkovich, 1975). Future uses of the designations front, left, right, bottom, rear, etc will refer to this orientation. (The exposed edge of the heme group, at the front of the molecule, directly faces the viewer. The left and right sides of the molecule contain the Met80 and Hisl8 ligands, respectively; the bottom of the molecule lies just below the heme propionic acid groups; and the rear of the molecule contains the C - terminal a-helix.) molecule lacking extensive regular secondary structure have been categorized by Leszczynski and Rose (1986) as fl-loops (continuous segments of polypeptide chain whose initiation and termination points lie adjacent in space). These loops span residues 18 to 32, 34 to 43, 40 to 54, and 70 to 84. 6 The polypeptide chains of prokaryotic cytochromes c, in comparison to that of eukaryotic cytochrome c, typically possess a number of deletions and/or insertions which occur at the external periphery of the molecule, and often at a point of chain reversal at surface loops (Timkovich, 1979). Upon comparing the structures of tuna cytochrome c, Rhadospirillum rubrum cytochrome c2, Paracoccus denitrificans cytochrome C 5 5 0 , and Pseudomonas aeruginosa cytochrome ciiU Chothia and Lesk (1985) have determined that six regions of these cytochrome c molecules have a common folding pattern. These six segments of polypeptide chain represent the core structure of the cytochrome c molecule, and all are found to constitute part of the heme pocket The three segments encompassing residues 5-12, 60-71, and 90-101 are a-helical and form the top, lower-left and upper-rear walls, respectively, of the heme pocket The remaining segments line the heme crevice: residues 14-20 contribute the histidine ligand and the two cysteine side chains involved in the thioether linkages; residues 24 to 33 pack directly against the right face of the heme group; and residues 79-81 pack against the left face of the heme and contribute the methionine ligand. Several conserved structural features of the mitochondrial cytochrome c molecule are notable. The N-terminal and C-terminal a-helices are in contact, with the axes of the two helices being roughly perpendicular. Only a small portion of the surface of the heme group, at the front face of the cytochrome c molecule, is exposed to the external solvent medium. The heme group is encased by a hydrophobic core; the side chains which pack against the tetrapyrrole portion of the heme group in the interior of the cytochrome c molecule are almost exclusively hydrophobic or aromatic in character. The propionic acid side groups are buried in the interior of the molecule, where they form polar interactions with internal protein groups. The molecular surface of the highly basic eukaryotic cytochromes c is characterized by a conserved distribution of lysyl side chains, which encircle the exposed edge of the heme group. Occurring on the opposite (i.e. rearward) face of the molecule is a clustering of a small number of acidic side chains. This separation of positive and negative surface charges has been proposed to establish a dipole moment which serves to optimally orient the cytochrome c molecule for interaction with its redox partners 7 (Koppenol and Margoliash, 1982; Margoliash and Bosshard, 1983). b. Alkaline isomerization Theorell and Akesson (1941) identified spectroscopically five forms of ferricytochrome c occurring over the pH range 0 to 13. Form III, which is stable between pH 4 and 8, is the biologically functional form. The alkaline isomerization, or the conversion of form III to form IV (the alkaline form), occurs at pH -9, and involves the deprotonation of one (or more) group(s), followed by the displacement of the Met80 heme ligand by some other strong-field ligand (Davis et al., 1974). The form IV of ferricytochrome c cannot be reduced by cytochrome c reductase. Because it occurs under physiological conditions, and also inactivates the cytochrome c molecule, the alkaline isomerization has been suggested to have a role in regulating the activity of the electron transport chain (Gadsby et al., 1987). . The identity of the sixth ligand to the heme iron in alkaline ferricytochrome c has not been established (Gadsby et al., 1987). Possible candidates are the e-amino group of a nearby . lysine residue (Lys72, 73 or 79), the hydroxyl group of Tyr67, or a free hydroxide ion. The ligand exchange which occurs during the alkaline isomerization process has several other consequences. There is a slight conformational rearrangement of the cytochrome c molecule, and also a loosening of the left side of the heme crevice (Davis et al., 1974; Wooten et al., 1981). The reduction potential of the alkaline cytochrome c is decreased to -120 mV (Davis et al., 1974; Rodkey and Ball, 1950), which likely explains the impaired reducibility of the protein. In addition, the loss of Met80 ligation means that the alkaline isomerization can be conveniently monitored by measurement of the decrease in absorbance at 695 nm. The degree of susceptibility of various forms of cytochrome c to alkaline isomerization, or indeed to other denaturing agents (such as heat, urea, guanidine hydrochloride, alcohols, etc.), is frequently used as a measure of the strength of the intrinsic binding forces maintaining the native structure of the heme crevice (Osheroff et al., 1980). 8 B. Aspects related to the electron-transfer role of cytochrome c 1. Electron transfer reactivity of cytochrome c Cytochrome c carries out electron transfer reactions with a limited number of proteinaceous redox partners: within the electron transport chain, cytochrome c reductase and cytochrome c oxidase; and within the mitochondrial intermembrane space, cytochrome bs and sulfite oxidase (animals), and fiavocytochrome b2 and cytochrome c peroxidase (yeast). Cytochrome c forms fairly tight complexes (having dissociation constants in the range 1-5 X 10"7 M) with its redox partners. The rates of the electron transfer reactions can be assessed in terms of (apparent) second-order rate constants (measured experimentally under reaction conditions yielding pseudo first-order kinetics). The value of this rate constant is dependent on both the association constant for intermolecular complexation, and the first order rate constant for electron transfer within this precursor complex. Reported second order rate constants for electron transfer reactions between cytochrome c and its physiological redox partners are: 1.0 X 107 M^s - 1 for cytochrome c oxidase, 1.7 X 107 M ' V 1 for cytochrome c reductase, -4.0 X 107 M _ 1 s _ 1 for cytochrome bs, and -2.0 X 1010 M^s"1 for cytochrome b2 (Pettigrew amd Moore, 1987). The kinetic measurements show that these cytochrome c- mediated electron transfer reactions occur at rates close to the diffusion limit (Margoliash and Bosshard, 1983: Pettigrew and Moore, 1987). In contrast to the high degree of selectivity it displays in reactions with its protein redox partners, cytochrome c transfers electrons fairly indiscriminately with numerous inorganic redox reagents. The second-order rate constants for the reduction of cytochrome c by various iron and ruthenium coordination complexes, as well as by dithionite, are all in the range 2-6 X 10" M" ls_ 1 (Ferguson-Miller et al., 1979). That all of the inorganic redox reagents react at similar rates with cytochrome c suggests that a common reaction mechanism is used. The kinetics of electron transfer are most consistent with an outer-sphere reaction, likely via the exposed edge of the heme group (Timkovich, 1979). It is notable that in comparison to its reactions with small molecule reagents, cytochrome c reacts with enzymic partners with a much higher degree of specificity, and at rates greater by two 9 to five orders of magnitude. These observations likely indicate that the polypeptide chain of cytochrome c provides specific interaction sites for both the recognition of the appropriate macromolecular redox partner, and the optimization of the electron transfer process itself (Dickerson and Timkovich, 1975). 2. Factors which influence heme reduction potential The reduction potential of the heme iron of cytochrome c is of great importance, as it affects the ability of the protein to react with both the preceding and succeeding carrier in the electron transport chain, and in addition may determine the rate of the electron exchanges carried out by this protein. The majority of eukaryotic cytochromes c have a reduction potential ( E m ) in the range 240-280 mV. This relatively positive reduction potential means that the neutral state of the heme (containing ferrous Fe2+) is stabilized relative to the positively charged state (containing ferric Fe3+). Three independent structural factors which additively influence the reduction potential of a heme group are the chemical nature of (i) the peripheral side chains of the heme pyrrole rings, (ii) the axial ligands to the heme iron, and (iii) the local environment of the heme moiety (reviewed in Mathews, 1985; Marchon et al., 1982). This section discusses these factors with respect to their determining the reduction potential of cytochrome c. A fourth factor of possible importance is a conformational change, accompanying a change in oxidation state of the heme iron, in the surrounding polypeptide matrix. By strongly favoring one of the reduced or oxidized conformational forms, the polypeptide chain can potentially influence the relative stabilities of the alternative oxidation states of the heme iron. The effect of the heme side chain substituents is inductive; electron-withdrawing groups destabilize a positive charge at the heme iron, and thus cause a more positive potential. The reduction potential of the heme iron of Fe-protoporphyrin is -40 mV higher than that of Fe-mesoporphyrin, in which the vinyl groups are replaced by ethyl groups (Cowgill and Clark, 1952). Thus, saturation of the vinyl groups of protoheme in cytochrome c occurring upon formation of the thioether linkages would be expected to lower the reduction potential. However, the Euglena and Crithidia cytochromes c, in which only one of the vinyl groups forms a thioether 10 bond to the polypeptide chain, have reduction potentials not significantly different from those of more typical cytochromes c (Moore and Williams, 1977). In addition, the inductive effect of the cysteinyl sulfurs themselves on the heme reduction potential has not been thoroughly investigated. The influence of the heme ligands on reduction potential is related to the electron-donating power of the ligating group. More strongly donating groups stabilize a more positive heme iron, and thus give rise to a lower reduction potential (Falk, 1964). Comparison of the reduction potentials of pairs of heme complexes which have imidazole at the fifth coordination site, but which differ in whether a histidine or methionine analogue forms the sixth ligand, has shown that ligation of the more weakly-donating methionine effects a -160 mV increase in reduction potential (Mathews, 1985). As discussed earlier, the alkaline form of ferricytochrome c has a reduction potential -140 mV lower than that of native cytochrome c, although the drop in reduction potential is likely not due entirely to the loss of Met80 ligation. In addition, replacement of Met80 with a His residue lowers the reduction potential of horse cytochrome c by -220 mV (Raphael and Gray, 1989). Therefore, that cytochrome c uses as axial ligands a methionine in addition to a histidine side chain undoubtedly contributes to the its fairly high reduction potential. Three aspects of the local environment of the heme have been shown to influence the reduction potential of the heme iron: the polarity of the heme microenvironment, the degree of solvent accessibility to the heme, and electrostatic interactions between the heme iron and neighboring charged groups. Kassner (1972) has compared the reduction potential of the bipyridine coordination complex of mesoheme methyl ester dissolved in benzene, with that of the corresponding complex of mesoheme (free acid) in aqueous solution. The heme complex in the non-polar solvent has a -300 mV more positive reduction potential, which has been attributed to the greater electrostatic free energy required to separate, within a medium of low dielectric constant, a monocationic ferric iron centre from its countercharge(s) (Kassner, 1972, 1973; Churg and Warshel, 1986). This proposal undoubtedly accounts at least partially for the high reduction potential of cytochrome c, as the heme group of this protein is tightly enveloped within a crevice 11 lined primarily with non-polar amino acid side chains. Stellwagen (1978) has noted that within a series of heme proteins of known structure, the fraction of the total surface area of the heme excluded from external solvent correlates positively with a high reduction potential. He has therefore suggested that the exposure of the heme to the external medium is a major determinant of the stability of the reduced state of the heme iron, as it reflects the accessibility of the heme to exogenous oxidants. Stellwagen's results can also be interpreted in terms of Kassner's proposed model (Kassner, 1973), since an increase in solvent accessibility to the heme would likely effect a corresponding increase in the polarity of the heme environment (Schlauder and Kassner, 1979). Schlauder and Kassner (1979) have used solvent perturbation absorption difference spectroscopy to measure the extent of solvent accessibility to the heme group of both horse cytochrome c and R. rubrum cytochrome c2. Their results suggest that the 60 mV lower reduction potential of the former protein is due in part to the greater extent of heme exposure in this protein. The third environmental factor which influences the reduction potential of cytochrome c is electrostatic interactions between the heme iron and neighboring ionizable groups (George et al., 1966). The preponderence of basic side chains, on the surface of the cytochrome c molecule, and in particular around the exposed edge of the heme group, may act to destabilize a positive charge on the heme iron. A number of experiments have indicated that changes in the charges on protein side chain groups can affect the reduction potential of the heme. Derivitization of single lysine residues with trifluoromethylphenyl isocyanate causes a drop of-15 mV in the reduction potential of horse cytochrome c (H.T. Smith et al., 1977), which Rees (1980) attributes to the effect of neutralization of the positive charge on the e-amino groups. Moore et al. (1984) have suggested that in yeast cytochrome c deprotonation of His39, which occurs with pK a of 6.9 and 7.3 in the oxidized and reduced forms of the protein respectively, causes the reduction potential to drop by -25 mV. Moore (1983) has also proposed that the rear propionic acid group's ionization state, which may in turn be controlled by a salt bridge interaction with the side chain of Arg38, directly influences the reduction potential of the heme iron. The relative importance of the non-polarity of the heme environment, inaccessibility of the heme to solvent, and electrostatic interactions between the heme 12 iron and neighboring charged groups has been a subject of considerable debate (Stellwagen, 1978; Mathews, 1985; Moore et al., 1986;). However, it is likely that collectively these factors, in controlling the nature of the microenvironment of the heme group buried within the polypeptide matrix of the cytochrome c molecule, are the major determinants of the fairly high reduction potential of this protein. It should also be noted that within the cytochromes c, the nature of the heme side chains and ligands does not vary (with the exception of the protozoan cytochromes noted above). Thus differences in the reduction potential between variants of cytochrome c must be caused by differences in the local environment of the respective heme groups. 3. Proposed mechanisms of electron transfer Electron transfer reactions involving coordination complexes occur through either an inner-sphere or outer-sphere mechanism. The heme iron of cytochrome c is sequestered within the protein matrix, and is fairly inert to ligand exchange. Thus, the majority of electron transfers carried out by cytochrome c are via an outer-sphere mechanism. Inner-sphere reactions occur only with some small, highly reactive inorganic redox agents (dithionite, Cr 3 + ion) and likely require opening of the heme crevice and displacement of the Met80 ligand. Many outer-sphere mechanisms for the passage of electrons to and from the heme prosthetic group of cytochrome c have been suggested (see Harbury and Marks, 1973). The proposed pathways include: (i) via overlap of 7r-orbitals of the heme group with those of the redox partner, (ii) via the axial ligands, (iii) via the thioether groups linking the polypeptide chain to the porphyrin ring, (iv) via one or more aromatic side chains whose ^-orbitals overlap with those of the heme group, (v) via segments of the polypeptide chain, (vi) via bound solvent or small solute molecules, (vii) via quantum-mechanical tunnelling, and (viii) via various combinations of the above. A number of detailed pathways for cytochrome c, mainly of the type (ii) and (iv), have been proposed based on the inspection of the tertiary structure of this protein [see reviews by Salemme (1977) and Dickerson and Timkovich (1975)]. These mechanisms involve conduction of an electron between the heme iron and the surface of the molecule either via a series of 13 intervening aromatic side chains, or directly through the exposed heme edge. As general mechanisms for the electron-transfer function of cytochrome c, these early proposals have been largely discounted by the discovery of naturally-occurring variants of cytochrome c bearing incompatible amino acid substitutions at key residues, and by chemical modification studies (see Section I.D.1 below). 4. Redox-state dependent conformational changes An abundance of experimental evidence indicates that structural differences exist between the oxidized and reduced forms of cytochrome c (see reviews by Margoliash and Schecter, 1966; Salemme, 1977). The conformational differences affect a number of surface properties: the two redox forms have differing chromatographic behavior on ion exchange resins, antigenic reactivity, binding affinities for ions, and rates of hydrogen-deuterium exchange. Structural differences between the two redox states are also manifest in differing chemical reactivity (Pande and Myer, 1980) and pK.a's (Robinson et al., 1983) of certain side chain groups, and in differing binding affinities for both enzymic redox partners and phospholipid membranes. A large body of data indicates that the reduced form has a more compact and more stable structure. Ferrocytochrome c has a greater resistance to unfolding induced both by chemical denaturants (acid, base, methanol, urea, guanidine hydrochloride) and by heat, to ligand displacement by exogenous substituents, and to proteolytic digestion; and has a lower viscosity in solution (Fisher et al., 1973), a lower compressibility (Eden et al., 1982), and a smaller radius of gyration (by ~1 A) in low ionic strength solution (as indicated by small-angle X-ray scattering) (Trewhella et al., 1988). The increased stability of reduced cytochrome c is likely due in part to the 1000-fold increase in strength of the Met80-heme iron coordinate bond in this form of the protein, although differences between the two redox forms in the interaction between the delocalized 7r-electrons of the heme molecular orbitals and surrounding side chains within the heme pocket have also been suggested to have a role (Timkovich, 1979). The techniques of CD and ORD spectroscopy, NMR spectroscopy and X-ray crystallography have been used to evaluate directly the redox-state dependent structural differences. 14 These differences have been studied in the hope that they will shed light on the mechanism of the electron transfer process. CD and ORD spectroscopy indicate that the oxidation state of the heme iron does not significantly affect the polypeptide conformation of cytochrome c, although the environments of one or more aromatic side chains may be perturbed (Myer, 1968). The regions of the polypeptide chain indicated by NMR spectroscopy to differ structurally between the two redox forms of horse cytochrome c include residues 39 to 43 and 50 to 60, and also groups in the vicinity of the side chains of Hisl8, Trp59 and Tyr67 (Feng et al., 1990). The redox-state sensitive regions of the cytochrome c molecule indicated by NMR spectroscopy and by X-ray crystallography (see below) are in good agreement Takano and Dickerson (1980, 1981a,b) have compared the crystal structures of oxidized and reduced tuna cytochrome c. Their studies show that the most striking differences between the two redox forms occur in the vicinity of a water molecule buried at the lower left of the heme crevice. Upon oxidation of cytochrome c this water molecule, which forms hydrogen bonds to Asn52 ND2, Tyr67 OH and Thr78 OG1, shifts -1 A in a direction toward the heme iron. This movement is accompanied by a shift of the tyrosyl ring of Tyr67 toward the rear of the molecule, and an upward rotation of the side chain of Asn52. This set of structural changes is postulated to be triggered by either the attraction of the water molecule to the increased positive charge on the ferric heme iron, or the weakened ability of the Met80 SD atom to donate an electron pair in the hydrogen bond to Tyr67 OH. In addition, there is a small shift of the heme group within its crevice, in a direction toward the surface of the molecule. This shift may also effect movements of adjacent protein groups, including Cysl7, Hisl8, Trp59, Phe82 and Ala83. Smaller movements are observed in the regions of polypeptide chain spanning residues 38 to 43 and 47 to 57. Overall, the shifts occurring upon oxidation of cytochrome c, in particular the closer approach of the buried water molecule to the heme iron and the more solvent-accessible positioning of the heme group, are consistent with a more polar heme environment required to stabilize the positive charge at the heme centre. There is also the possibility that through interactions with its reductase or oxidase, cytochrome c is induced to undergo shifts corresponding to the structural differences 15 between its two redox forms, thus facilitating either the acceptance or donation of an electron. The magnitude of these oxidation-state dependent conformational changes, as indicated by the above methods, appears to be too small to account for the observed differences in the solution properties between the two redox forms of cytochrome c. The interpretation of many workers (Salemme, 1977; Timkovich, 1979; Moore and Williams, 1980a; Eden et al., 1982; Feng et al., 1989) is that differences in the chemical and physical properties of the two redox states arise from differences in dynamic behavior (the frequency and/or amplitudes of vibrational fluctuations in the structure of the molecule). The larger crystallographic temperature factors of ferricytochrome c do indicate that this structure has greater overall flexibility. 5. Modelling of intermolecular complexes between cytochrome c and its physiological redox partners Structural models have been proposed for the bimolecular complexes of cytochrome c with cytochrome bs and with cytochrome c peroxidase (reviewed by Pettigrew and Moore, 1987; Mathews, 1985; Poulos and Finzel, 1984). These models have been constructed by manual adjustment of the relative orientations of the crystallographically determined structures of the individual proteins. The rationale behind this modelling is to optimize both the occurrence of favorable ionic interactions between positively charged groups on cytochrome c and negatively charged groups on the redox partner, and the steric fit between the complementary molecular surfaces. In the optimal complex modelled for cytochrome c and cytochrome b5 (Salemme, 1976), lysines 13, 27, 72 and 79 of the former protein form salt bridges with Glu48, Glu44, Asp60 and an exposed heme propionate, respectively, of the latter protein. The iso-1-cytochrome c-cytochrome c peroxidase complex (Lum et al., 1987; and also Poulos and Kraut, 1980) contains the following hydrogen bond and salt bridge interactions: Lys5-Asp33, Thrl2-Asn87, Argl3-Asp37, Glnl6-Gln86, Lys(Tml)72-Asp217, Lys86-Asp37, Lys87-Asp34 and Gly83-Hisl81. In addition, there is a hydrophobic interaction between Ala81 and Leul82, as well as the antiparallel juxtaposition of the N-terminal a-helix of cytochrome c with a helical segment of cytochrome c 16 peroxidase. In both these complexes, there is a high degree of complementarity in the surface topographies of the partner protein molecules, which suggests that solvent is excluded from the intermolecular interface. Notably, the heme group of cytochrome c is parallel to the hemes of cytochrome bs and cytochrome c peroxidase in the respective complexes. In the cytochrome c-cytochrome bs complex, the closest approach of the heme groups of the two proteins is ~8 X, and the iron-iron interatomic distance is -16 X; the corresponding values for the cytochrome c-cytochrome c peroxidase complex are -16 X and -25 X, respectively. Several inferences can be drawn regarding intermolecular electron transfer within the modelled complexes. First, within the interfacial region, the proposed exclusion of solvent and the neutralization of complementary charges would tend to lower the dielectric constant of the medium separating the two redox centres, thereby facilitating the electron transfer process (Salemme, 1977; Poulos and Kraut, 1980). Second, the parallel orientations of the heme groups of the two proteins may serve to enhance interaction between the delocalized TT-electron systems of these two groups. This interaction may be of particular mechanistic importance for the cytochrome c-cytochrome b5 complex, in which the distance between heme edges is fairly short (Salemme, 1977). Third, in the cytochrome c-cytochrome c peroxidase complex, an extended series of planar, conjugated and aromatic groups occur in a parallel arrangement. These groups, which include the hemes of both molecules, Phe82 of cytochrome c, and the spatially adjacent Hisl81 side chain of cytochrome c peroxidase, is postulated to form an intermolecular electron conduit composed of overlapping 7r-orbitals (Poulos and Kraut, 1980). In general, the main features of the proposed complexes are corroborated by experimental evidence from many sources, including chemical modification of lysine side chains of cytochrome c (Margoliash and Bosshard, 1983) and of acidic groups on cytochrome bs (Mauk et al., 1986) and cytochrome c peroxidase (Waldemeyer et al., 1982); differential protection of protein groups upon complexation (Bechtold and Bosshard, 1985); covalent crosslinking of the partner proteins (Waldemeyer and Bosshard, 1985); identification by NMR spectroscopy of the protein groups .occurring at the intermolecular interface (Eley and Moore, 1983; Satterlee et al., 1987; Moench et 17 al., 1987); and comparison of the kinetics of reduction by free flavin semiquinones of the free and complexed protein components (Hazzard et al., 1987). However, representation of the interacting protein molecules as forming a static, rigid complex is likely not completely accurate. A number of recent studies suggest that an important requirement for productive interaction between cytochrome c and its redox partner is the ability of the two proteins to undergo dynamic movement relative to one another. For example, examination of the electrostatic potential surfaces of cytochrome bs and cytochrome c suggests that these two proteins can interact in a number of different relative orientations to form electrostatically stabilized complexes (Mauk et al., 1986). Molecular dynamics simulations indicate that within this complex cytochrome bs migrates along the surface of cytochrome c, and also that the complex transiently contracts, bringing the two heme irons closer together (Wendoloski et al., 1987). Brownian dynamics simulations have yielded similar results for the cytochrome c- cytochrome c peroxidase complex (Northrup et al., 1988). In crystallographic studies of a 1:1 complex between cytochrome c and cytochrome c peroxidase, well-defined electron density for the former is not visible, suggesting that cytochrome c is positionally disordered with respect to cytochrome c peroxidase (Poulos et al., 1987b). In addition, the finding that the maximal rate of electron transfer between ferrocytochrome c and ferrylcytochrome c peroxidase occurs not at low ionic strength, but an ionic strength (M=260 mM) at which electrostatic interactions would be considerably masked, also suggests that flexibility in the complexation interactions is necessary (Hazzard et al., 1988b). Collectively, these studies indicate that conformational flexibility in the intermolecular interactions between the electron transfer partners is required for productive complexation, likely by allowing the two proteins to adopt relative orientations that promote electron transfer, or by decreasing the distance separating the redox centres. The complexes proposed from modelling studies may represent the precursor in which electron transfer geometry is optimal. C. Amino acid conservation in the cytochromes c Because cytochrome c is a protein ubiquitous to all eukaryotes, and can be readily isolated, primary sequences have been determined for a large number (92) of eukaryotic species. The 18 degree of sequence divergence between the various species of cytochrome c has been used to trace the phylogeny of the eukaryotes. A comparison of the available primary structures indicates that cytochrome c is a highly conservative protein. The cytochromes c from two species whose evolutionary divergence occurred as long ago as one billion years have amino acid sequences that typically differ at no more than 50 of the -104 positions. In the sequences of eukaryotic cytochromes c, there are 21 residues which are absolutely invariant, and an additional 11 which are I I I I I I I I I I I I I I I I I I I I 1 I I I I I I I I I I I I I I I I I I I I I' I I I I I I I < I I I I I I I I I I I I I I 1 I I I 1 1 I I I I i I I I I I I H I I I I I I I I I I I I I I I I 1 t I I I t I I 1 n I I M 11 f i T n T i T i r n T i T | Y i Y i V i T i Y | T n 11 Ti T r |T 11 T 11 Tr i T111 1 j i T r i T i T r i y i 1 1 ' I' 1 1 1 m 1 ' r u T i T i n 1 1 f m i | m i | i - 1 0 - 5 1 5 1 0 1 5 2 0 2 5 3 0 3 5 A ) 4 5 5 0 5 5 6 0 5 5 7 0 7 5 8 0 8 5 9 0 9 5 Residue number 1 0 0 1 0 5 Figure L3. Degree of amino acid variability along the polypeptide chain of eukaryotic cytochromes c. At each position, the variability (Wu and Kabat, 1970) is calculated as the number of different amino acids observed to occur at this position, divided by the frequency of occurrence of the most common amino acid (whose identity is given at the very bottom of the histogram). Other amino acids which occur at each position have also been listed. Note that a lower case 'd' indicates that the designated residue is deleted in some species. The sequences of 92 eukaryotic cytochromes c (Hampsey et al., 1986) have been included in this analysis. 19 always one of two amino acids (see Figure 1.3). Only 14 positions, having a variability index (Wu and Kabat, 1970) greater than 15, are highly variable. The conservative residues in cytochrome c very likely have an important role in the function of the molecule. On the other hand, residues which show considerable variability in amino acid identity are not as likely to be critical to the proper functioning of cytochrome c. Consideration of the reactions which the cytochrome c molecule undergoes during its biosynthetic processing and its functioning in electron transfer suggests several roles that a conserved residue may play. These roles, which may be highly interdependent, include: (i) serving as a site for post-translational modification of the polypeptide chain, and in particular for covalent coupling of the heme prosthetic group, (ii) recognition of the receptor responsible for translocation of cytochrome c across the outer mitochondrial membrane, (iii) directing the proper folding of the polypeptide chain, or stabilizing the native, folded state of the cytochrome c molecule, (iv) directly participating in the electron transfer reaction, (v) creating the appropriate heme environment, and in particular controlling the reduction potential of the heme iron, (vi) binding of.a small molecule effector (e.g. ions, ATP), and (vii) forming complexation interactions with redox partners of cytochrome c. A role for a conserved residue may be inferred from inspection of the structural environment of that residue within the cytochrome c molecule. The results of several such analyses Of the invariant residues of cytochrome c are summarized in Table 1.1. It must be emphasized, however, that functional roles for residues proposed on the basis of amino acid conservatism and structural considerations are tentative unless supported by additional, independent experimental evidence. D. Structure-function studies in cytochrome c The objective of the study of the relationship between a protein's structure and function is to elucidate the molecular basis of the protein's activity. A powerful approach in the investigation 20 Table LI. Roles inferred from structural considerations for the invariant residues in eukaryotic cytochromes c Res- Structural environment Inferred role(s)a idue Glyl Occurs at rear surface of molecule. Forms no strong intramolecular interactions. Gly6 Close contact with 97 CA, at interface between N - and C-terminal a-helices PhelO Packed in upper rear of heme pocket Cysl7 Front exposed thioether bond to heme group Hisl8 Ligand to heme iron Pro30 Forms bend in polypeptide chain adjacent to heme group. C=0 group hydrogen bonds Hisl8 imidazole. Leu32 Packed in right rear of heme pocket Gly34 Part of surface /3-turn Arg38 Electrostatic interaction with rear heme propionic acid group Gly41 Part of surface /3-turn Tyr48 Hydrogen bonds rear heme propionic acid Trp59 Hydrogen bonds rear heme propionic acid Leu68 Packed at left rear of heme pocket Pro71 Junction between 60's and 70's a-helices Lys73 Directed into solvent at left front side of molecule Pro76 Part of surface /3-turn Lys79 Forms hydrogen bond to 47 C=0 on opposite side of heme crevice Met80 Ligand to heme iron Phe82 At surface of molecule adjacent to heme group Gly84 Packed against side chains of Phe82 and Leu85 Arg91 At left surface of molecule. Forms hydrogen bond(s) to carbonyl groups from 80's loop Unknown. Site of acetylation for some mammalian cyt c's Small volume allows close packing of helices Contributes to hydrophobic heme pocket Covalent heme attachment Heme ligand Generates turn conformation. Stabilizes conformation of Hisl8 imidazole. Contributes to hydrophobic heme pocket Contributes to hydrophobic heme pocket Protein folding: allows type II tight-turn Stabilizes buried heme propionic acid group. Controls redox potential of heme iron. Protein folding: allows type II tight-turn Stabilizes buried heme propionic acid group Stabilizes buried heme propionic acid group Contributes to hydrophobic heme pocket Protein folding: directs folding of helices Intermolecular interactions Protein folding: generates turn conformation Stabilizes protein conformation Heme ligand Electron transfer. Maintenance of heme environment Protein folding: allows otherwise inaccessible conformation of polypeptide chain Stabilize conformation of 80's loop. aUnless otherwise noted, the inferred roles are according to Dickerson and Timkovich, 1975; Timkovich, 1979; Takano and Dickerson, 1981; and Hampsey et al., 1988, 1986. bMoore et al., 1984. of structure-function relationships has traditionally been the analysis of variants. Thus the role carried out by a particular amino acid residue in a protein can potentially be established from a characterization of the structural and functional properties of variant proteins in which that residue 21 has been specifically modified. In particular, a role for a residue proposed on the basis of the inspection of protein structure, or amino acid sequence conservation, can be directly tested. For a protein system to be amenable to this method of analysis, there are two prerequisites: an accurately known three-dimensional structure for the protein, and means to generate variants of the protein. As discussed above, a fairly extensive data base of cytochrome c structures has been available for some time. In the past two decades, a number of methods have been used to generate modified forms of cytochrome c. The information that these methods have yielded on the functional roles of specific residues of cytochrome c provide the foundation for further studies of structure-function relationships in this protein. Thus, previous work will be thoroughly reviewed in the following sections. It must be emphasized, however, that in none of the studies described has the structure of the variant cytochrome c been determined. Thus an assignment of a role to a residue based on the observed altered functional properties of the variant protein in which that residue has been modified must be regarded with some caution, as the modification may have unexpectedly perturbed the conformation of the protein molecule. 1. Chemical modification a. Heme prosthetic group Chemical modification involving the heme group has been of three types: complete removal of the heme moiety to yield apocytochrome c, removal of the heme iron to yield porphyrin-cytochrome c (Fisher et cd., 1973), and replacement of the iron by another metal centre. The heme thioether bonds can be cleaved by treatment with silver or mercury salts. Spectroscopic and physicochemical measurements indicate that the resultant polypeptide chain of apocytochrome c has a random, unfolded conformation. Removal of the heme iron can be effected by protonating the heme pyrrole nitrogens using anhydrous hydrogen fluoride. The porphyrin-cytochrome c appears to retain a native conformation. These results suggest that (i) packing of hydrophobic groups against the faces of the heme group, and possibly the interaction of polar groups with the heme propionic acid groups, are important in determining the overall folding of the polypeptide chain (Dickerson and Timkovich, 1975), and (ii) the coordinate bonds formed to the Hisl8 and Met80 22 side chains are not critical determinants of the protein fold. Metallocytochromes c, in which the heme iron is replaced by another metal ion (Cu, Zn, Mn, Ni, Co, or Sn), can be prepared from porphyrin-cytochrome c, but have not been extensively characterized (Erecinska and Vanderkooi, 1978; Meade al., 1989). b. Histidine and methionine Early experiments in which methionine and histidine side chains were modified were directed at identifying the heme ligands (Ferguson-Miller et al., 1979). Methionine can be carboxymethylated by treatment with a haloacetic acid. Derivatization of Metl2, 33 or 65 had no substantial effects; however, derivatization of Met80 greatly perturbed the cytochrome c protein, thus suggesting that Met80 is a heme ligand. Similarly, modification of histidine residues using diazonium-lH-tetrazole had identified Hisl8 as a heme ligand. The altered cytochrome c in which ligation of Met80 to the heme is disrupted by either side chain carboxymethylation or oxidation (to the sulfoxide) is auto-oxidizable, can be bound by exogenous heme ligands, and fails to react with both cytochrome c oxidase and reductase (Myer et al., 1980). More recently, cytochrome c carboxymethylated at Met65 and Met80 has been shown by CD spectroscopy to have no alterations in overall conformation, but is more susceptible to denaturation by urea and has a greatly decreased reduction potential (-215 mV) (Santucci et al., 1987). Collectively, these results indicate that coordination of Met80 to the heme iron is required for maintenance of both the structural integrity of the heme pocket, and a high reduction potential. Note that the inhibited activity of the carboxymethylated cytochrome c with oxidase and reductase does not establish that the side chain of Met80 plays a direct role in electron transfer, as the inhibition may be the result of either a disrupted polypeptide chain conformation, or the perturbed reduction potential. In recent experiments, the side chains of histidine residues have been modified by coordination of a redox centre, such as ruthenium pentaammine. These studies are aimed at determining the influence of the intervening protein medium on electron transfer between the ruthenium and heme iron redox centres. They appear to indicate that electron transfer that does not occur via the exposed heme edge is relatively slow, and that the protein envelope imparts a 23 preferred directionality to electron transfer between the Ru and Fe sites (Nocera et al., 1984; Bechtold et al., 1986). c. Tryptophan and tyrosine Cytochrome c possesses an invariant tryptophan and several conservative tyrosine residues. Because these aromatic side chains appear to form conduits from the heme group to the surface of the molecule, chemical modification has been used to probe their participation in electron transfer. Proteins specifically modified at Trp59, Tyr67 and Tyr74 have been generated (reviewed by Ferguson-Miller, 1979; Myer et al., 1980). The indole ring of Trp59 has been modified through formylation of the amide function by formic acid, and through oxidation by N-bromosuccinimide. The phenolic ring of Tyr67 can be nitrated by tetranitromethane, or iodinated using I 2/KI 3. The modification of these two internal residues was found not only to impair activity with oxidase and reductase, and reducibility by ascorbate, but also to cause the loss of Met80 ligation to the heme, a significant lowering in reduction potential, and an opening of the heme crevice as indicated by susceptibility of the heme iron to autooxidation and binding by CO. Therefore, these derivatives do not confirm the direct participation; of Trp59 and Tyr67 in the electron transfer reaction, but do implicate these residues in maintaining the native conformation of the cytochrome c molecule. In particular, owing to its participation in a hydrogen bond to the Met80 side chain, the side chain of Tyr67 has been proposed to function in stabilizing the Met80 coordinate bond to the heme iron. The side chain of the surface residue Tyr74 can be preferentially iodinated by the enzyme lactoperoxidase. Normal reactivity of this derivative with both oxidase and reductase has shown that Tyr74 is not required for the electron transfer activity of cytochrome c. d. Lysine and arginine The interaction of cytochrome c with its redox partners is known to be electrostatic, as it is inhibited by high ionic strength and by the presence of polylysine. Intermolecular complexation is thought to be mediated by complementary ionic interactions between lysine side chains on cytochrome c, and negatively charged acidic groups on the other protein or on the phospholipid 24 membrane. Early experiments (reviewed by Dickerson and Timkovich, 1975) in which lysine residues were non-selectively acetylated, succinylated, trifluoroacetylated, or trinitrobenzylated confirmed the importance of lysines in the interaction of cytochrome c with its redox partners: the elimination of only two to six positively-charged e-amino groups was sufficient to completely inhibit activity with cytochrome c oxidase. In contrast, modifications which preserve the positive charge on the lysine side chains, such as guanidination by O-methylisourea or acetimidylation by methyl acetimidate of e-amino groups (Wallace and Harris, 1984), have little effect. More recent studies have employed derivatives of cytochrome c singly modified at various lysine residues by trifluoroacetylation, ttifluoromethylphenylcarbamolyation, or 4-carboxy-2,6-dinitrophenylation (Margoliash and Bosshard, 1983). These studies have shown that the lysines of greatest importance in the binding of horse cytochrome c to all redox partners tested (including cytochrome c oxidase, cytochrome c reductase, purified cytochrome cu yeast cytochrome c peroxidase, sulfite oxidase, cytochrome b5 and yeast cytochrome fc2) occur at positions 8, 13, 27, 72, 86 and 87. A derivative of yeast (Candida krusei) cytochrome c in which the side chain of Argl3 is converted to a bisphenylglyoxal guanidinium compound also has reduced activity with reductase and oxidase (Margoliash et al., 1973). These critical basic residues encircle the exposed edge of the heme group, and outline a region on the surface of the cytochrome c molecule which likely serves as the common enzymic interaction domain. The centre of the proposed interaction domain comprises several hydrophobic groups from residues 81 and 82, and also the positive end of the, calculated dipole of the molecule. The derivatives of cytochrome c modified at single lysine residues have also been used to map the preferred sites of reaction between cytochrome c and a number of small-molecule redox agents, including [Fe(CN)6]3-, [Co(phen)3]3+ (phen=1,10-phenanthroline), [Fe(EDTA)]2 , and [Co(sep)]2+ (sep=sepulchrate, 1,3,6,8,10,13,19-octa-azabicyclo[6.6.6] icosane) (Butler et al., 1983; Armstrong et al., 1986). These studies also identify the solvent-accessible edge of the heme as the site of electron exchange between cytochrome c and non-protein coordination complexes. The experiments in which lysine residues of cytochrome c have been chemically modified thus clearly 25 demonstrate that the exposed edge of the heme group serves as the most favorable pathway for electron movement to and from the heme iron. 2. Naturally occurring variants from different species of organisms The cytochromes c from different species of organisms constitute a set of naturally-occurring variants of this protein. Historically, an amino acid substitution observed in a newly-sequenced species of cytochrome c has been useful in disproving a proposed mechanism of electron transfer involving amino acid residues previously thought to be invariant (Dickerson and Timkovich, 1975). More recently, amino acid differences that occur between homologous cytochromes c have been utilized in the assignment of resonances in NMR spectra to specific amino acid side groups (Williams et al., 1985a). The various cytochromes c available have commonly been used in assessing the degree of cross-reactivity between the cytochrome c of one species, and the cytochrome c reductase or oxidase of another (Timkovich, 1979). Protein partners from species as diverse as horse and the bacteria R. rubrum and P. denitrificans have been found to react with each other. This cross-reactivity indicates that the cytochromes c from these species possess similar domains for interaction with redox partners, and comparison of their structures implicates the conserved collar of positively charged side chains around the exposed heme edge (Salemme, 1977). Attempts have been made in attributing differences in binding affinity to the presence or absence of specific lysine residues (Ferguson-Miller et al., 1976; Errede and Kamen, 1978). Amino acid compositions have also been correlated to the overall structural stability and resistance to denaturation of eukaryotic cytochromes c (Nail and Landers, 1981; Zuniga and Nail, 1983). However, these latter analyses are inconclusive due to the large number of amino acid differences between the proteins considered. In general, the use of naturally occurring variants in the study of structure-function relationships in cytochrome c has been hampered because there are few pairs of proteins which differ by only a single amino acid substitution. 26 3. In vivo- generated mutants Because yeast is a unicellular microorganism, and is thus easy to' manipulate both biochemically and genetically, it has historically served as the eukaryotic subject of experiments in classical molecular genetics. Sherman and his coworkers have generated numerous single-site amino acid replacements in yeast iso-1-cytochrome c (reviewed in Hampsey el al., 1988, 1986). The earliest variants were isolated by direct screening of mutagenized yeast for strains deficient in heme proteins. Assays for heme proteins used were in vivo spectroscopy (see below), or benzidine staining as a means for detecting heme-catalyzed peroxidase activity. Later, selection methods were used which were more expedient, and which also allowed strains that contained functionally defective cytochromes c to be isolated. The selection involved culturing of the yeast in the presence of chlorolactate, which inhibits the growth of cells, such as those containing functional cytochrome c, capable of metabolizing lactate. Functional variants of iso-1-cytochrome c were then obtained by selection for growth on lactate of revertants of the various mutants. The majority of the variants obtained have not been extensively characterized. Typically, the yeast strains containing the variant cytochromes c were analyzed in two ways: (i) by in vivo spectroscopy of the Ca absorption band, which gives an indication of both proper covalent attachment of the heme, and the level of cytochrome c protein, and (ii) by growth on lactate medium, which gives an assessment of functionality of the variant protein. In total, 177 different single-site amino acid replacements at 60 distinct positions along the polypeptide chain of iso-1-cytochrome c have been generated (Hampsey et al., 1988). (It should be noted, however, that 69 of these are of limited interest for structure-function studies, as they occur in the highly variant N-terminal nine residues.) In addition, numerous truncations and deletions at the N-terminus, an internal deletion of residues 40 through 53, and multiple-site mutants have also been obtained. Of the single amino acid replacements observed, 30 occurring at 16 sites have been found to severely disable iso-1-cytochrome c activity. Hampsey et al. (1988, 1986) have suggested roles for the residues occurring at these sites in the wild-type protein. The only replacements found to cause a complete absence of iso-1-cytochrome c protein occurred at 27 Cysl4, Cysl7 and Hisl8. Thus these residues, which form covalent bonds to the heme group, are inferred to have an essential role in attachment of heme to the apoprotein, or in import of cytochrome c into the mitochondrion. The remaining amino acid replacements yielding non-functional iso-1-cytochromes c resulted in subnormal, but detectable, intracellular levels of the protein. These replacements occur at residues which are inferred to have a role in either forming the hydrophobic heme pocket (Leu32, Trp59, Tyr67, Leu94 and Leu98), or directing the folding of the polypeptide chain (Gly6, Gly29, Pro30 and Pro71). Interestingly, the collection of variant iso-1-cytochromes c includes several functional proteins that bear amino acid substitutions at evolutionarily invariant residues. The nature of the amino acids which can functionally replace Pro71 and Trp59 provides clues as to the role of these two residues in the wild-type protein. Pro71 occurs at the junction between two contiguous a-helices in the iso-1-cytochrome c molecule. Ernst et al. (1985) have shown that the Leu71 variant is non-functional, and that the absence of revertants containing Tyr, Glu, Gin, Lys, Phe and Arg at this site suggests that these position-71 variants are also non-functional. In contrast, revertant iso-1-cytochromes c containing Val71, Thr71, Ser71 or Ile71 are functional (but have moderately reduced activities). Based on a theoretical analysis, Ernst et al. have determined that whereas the permissible residues have both an appropriate steric size and a propensity to adopt the backbone conformation observed for Pro71 in wild-type iso-1-cytochrome c, the non-permissible residues do not meet these criteria. Therefore, they conclude that the role of Pro71 is to direct the folding of the polypeptide chain. Trp59 occupies the lower rear of the hydrophobic heme pocket, and forms a hydrogen bond to the rear propionic acid group of the heme. Schweingruber et al. (1979) have found that variants with Gly, Ser or Cys at position 59 are non-functional, and from the absence of corresponding functional revertants, infer that variants with Gin, Ala, Thr, Pro and Val at this position are as well. However, revertants with Phe, Tyr and Leu59 are completely to partially functional, although less stable structurally. These results suggest that the primary role of Trp59 is to provide a large hydrophobic group for lining the heme pocket, and that the hydrogen bond between the heme propionic acid and the Trp59 side chain is not absolutely 28 required. This interpretation is supported by the complete to partial functionality of second-site revertants in which Gly, Ser or Cys are retained at position 59, but are accompanied by a phenylalanine at the spatially adjacent position 40. The other substitutions observed at evolutionarily invariant residues include Tyr48 to Lys, Lys73 to Glu, Pro76 to Leu, and Arg91 to Gly or Leu. The degrees of stability and functionality of the variant proteins have not been reported, nor has the spectrum of amino acid residues permissible at these positions been determined. Thus these mutations do not provide definitive information on the roles of these invariant residues. However, that certain amino acid substitutions are tolerated at evolutionarily invariant residues indicates that functional requirements at these residues may be less strict than commonly assumed, and that evolutionary invariance does not necessarily imply functional invariance (Hampsey et al., 1986, 1988). Notably, with the exception of two replacements by proline residues, all amino acid substitutions that substantially impair function occur at residues that are evolutionarily invariant, or highly conserved. In contrast, at non-conservative positions in the amino acid sequence, a large number of replacements having minimal effects on the function of iso-1-cytochrome c can be accommodated. At a given position along the polypeptide chain, tolerance of single-site amino acid substitutions in iso-1-cytochrome c agrees well with variability in amino acid identity between different species of cytochrome- c. Thus, together the two methods of analysis firmly establish that the invariant residues are critical to the proper functioning of cytochrome c, whereas other regions of the polypeptide chain have less important roles. Several single-site amino acid substitutions have been useful in the analysis of intermolecular complexation reactions and structural stability in cytochrome c. These are described in the remainder bf this section. Hazzard et al. (1988a) have studied substitutions at Argl3, Glnl6 and Lys27. Their results support the proposed involvement of these three residues in forming complexation interactions with cytochrome c peroxidase (Poulos and Kraut, 1980). In comparison to the wild-type protein, there is an increase for the Ilel3 and Gln27 variants, and a decrease for the Lysl6 variant, in the 29 accessibility of the cytochrome c heme to reduction by flavin within the bimolecular complex between cytochrome c and cytochrome c peroxidase. The reduction of the ferryl radical form of cytochrome c peroxidase by iso-1-cytochrome c was also affected, with the Ilel3 substitution increasing the reaction rate, and the Lysl6 arid Gln27 substitutions decreasing the rate. A Serl6 substitution appears to have little effect on either complexation or electron transfer, suggesting that the hydrogen bonding interactions formed normally by Glnl6 can be duplicated by a serine at position 16. More extensive studies of amino acid substitutions at the highly conserved Lys27 have examined the importance of this residue to iso-1-cytochrome c stability and reactivity with redox partners. Variant iso-1-cytochromes c bearing Leu27, Gln27, Trp27 or Tyr27 substitutions were found to support the growth of yeast in lactate medium at 85% of normal for the former two, and at 65% of normal for the latter two. The Leu27 and Gln27 variants appear to be slightly, and the Tyr27 and Trp27 variants substantially more susceptible to denaturation both by guanidine hydrochloride and by heat (Hickey et al., 1988). These results suggest that Lys27 has a role in conferring stability to the iso-1-cytochrome c protein. The Leu27 and Gln27 variants and the wild-type protein all react at very similar rates in single-turnover assays with cytochrome bs and cytochrome c peroxidase, and in steady state assays with cytochrome b2, cytochrome c peroxidase and cytochrome c oxidase (Das et al., 1988). The Gln27 variant was actually shown to bind cytochrome c peroxidase with 10 times the normal affinity. The finding that replacements of Lys27 with uncharged side chains has little effect on reactivity of iso-1-cytochrome c with its physiological redox partners is contrary to expectations based upon evidence from chemical modification and modelling studies. The interpretation proposed by Das et al. is that although interactions formed by Lys27 do not significantly contribute to the binding energy within the complex between cytochrome c with its redox partner, Lys27 does have a role in accelerating electrostatically intermolecular complexation. Further studies on the series of functional variants at position 71 (Ramdas et al., 1986; Ramdas and Nail, 1986) suggest a role for Pro71 in conferring stability to the cytochrome c 30 protein. The visible absorption spectra of the Thr71 and Ile71 variants have a reduced intensity of the 695nm band and small shifts in the Soret band, indicating that these variants have a weaker Met80-heme iron coordinate bond. Characterization of behavior of the iso-1-cytochromes c upon treatment with guanidine hydrochloride shows that the Val71, Thr71 and Ile71 variants have an increased susceptibility to denaturation and less cooperative unfolding transitions. The three variants also show enhanced rates for the fast phase of unfolding, a result consistent with the interpretation of Ernst et al. (1985) (see above) that Pro71 has a role in influencing polypeptide chain folding. 4. Semi-synthesis The technique of semi-synthesis (Offord, 1981, 1987), in which a naturally occurring protein is partially fragmented, the polypeptide fragment containing the residue of interest is specifically modified, and then the complement of fragments is reconstituted, has been used to generate numerous variant cytochromes c. Horse cytochrome c has been most frequently used as the source of starting materials for cytochrome c semi-synthesis. The most commonly employed fragments of this protein are: the cyanogen bromide cleavage products (1-65)H, (66-104), (66-80), and (81-104); and the peptides resulting from limited tryptic digestion, (1-38)H and (39-104), as well as (1-25)H and (28-38), and (1-53)H and (54-104) (where H denotes the fragment containing the covalently bound heme group). Prior to its use in reconstitution, a fragment may be modified by chemical derivitization, or by stepwise truncation and resynthesis at its termini to produce small-scale amino acid deletions, substitutions, or insertions. Alternatively, a fragment can be replaced by one from a homologous protein, or can be completely synthesized to create any sequence desired. The reassembly of the set of polypeptide fragments may or may not involve reformation of the original peptide bonds. Certain fragments of the polypeptide chain of cytochrome c will spontaneously form a non-covalent complex which has conformational and functional properties very similar to those of the native protein molecule. This property is shared by several other small, robust proteins, and in the case of cytochrome c, is attributed to the dominant role of the heme group in nucleating the folding of the polypeptide chain (Harbury, 31 Table 1.2. Summary of site-specific modifications of cytochrome c generated using semi-synthesis Modifications Reconstit- Characterization madea ution Comments / Interpretations of properties1-Ref.( Pro30 Substitution by Gly Leu32 Substitution by Val, Phe, He or Nva Gly34 Substitution by Ala or Ser Leu35 Substitution by He, Lys or Thr Non-covalent complex of (1-25JH-(28-38)*-(39-104) Arg38 Guanidinium group modi-fied using pentane-2,4-dione; cyclohexane-1,2-dione; or camphor-quinone-10-sulfonic acid. Covalent coupling of (1-65)H and (66-104) All of the substitutions at residues 30, 32 (except Nva), and 34 decrease both the binding affinity of the fragment (28-38) to the (l-25)H-(39-104) complex, and the stability of Met80 coordination to the heme iron. The Gly30 variant shows increased autooxidizability, and inhibited activity with lactate dehydrogenase. In the Nva32 variant, the ligation of Met80 to the heme iron is weakened, and reactivity with cytochrome b2 is decreased. The Ile35 substitution has only slight effects. E_-170mV. Loss of 695nm band. Very low biological activity. Both Leu32 and Leu35 line the 1, 2 hydrophobic heme crevice. Leu32 is shown to be particularly sensitive to replacements (by other non-polar side chains) and is proposed to form specific intramolecular interactions required to stabilize the folded state of the protein molecule (in particular the Met80-Fe coordinate bond). In this regard, Pro30 and Gly34 are also important, but Leu35 less so. In comparison to the other complexes, for the Gly30 and Nva32 variants, binding of the (28-38) fragment is less markedly increased in the reduced relative to the oxidized protein. Leu32 and Pro30 are thus implicated in providing the cytochrome c molecule rigidity in the reduced state, and may influence the reduction potential of the protein by stabilizing this conformational state. Arg38 forms a number of hydrogen 3 bonds which link the floor (residues 36 to 59) and the main body of the molecule, and also interacts with the buried rear propionic acid group of the heme. The addition of bulky substituents would disrupt these interactions. Thus Arg38 is inferred to have a structural role in stabilizing the molecular conformation. 32 Deletion, substitution by Gly. Restoration of Arg. Substitution by Lys and Gin Lys39 Deletion or substitution by Orn Substitution by Glu Substitution by Thr or Tyr Deletion, or substitution by Ala, Gly, Phe or trifluoro-acetylated-Lys Non-covalent Complexes possess 695nm complex of band. For Arg38, (1-37)H- Ejn-220mV and 70% (39-104) or biological activity. For (1-37)H- Gly38 substitution and (38-104) the deletion, Em<150mV and -15% biological activity. The Arg38 complex has a greater resistance to further digestion by trypsin. Non-covalent Reduction potential and complex (1-37)H-(38-104) Non-covalent complex (1-38)H-(40-104), or (1-38)H-(39-104) Non-covalent complex (1-37)H-(38-104) Non-covalent complex of (1-39)H*-(40-104) Covalent religation of (1-39)H and (41-104), or (1-39)H and (40-104) biological activities, of Lys38: 166mV and 26%; of Gln38: 148mV and 19%; and of Arg38: 215mV and 55%. Biological activity of both variant complexes is not significantly altered from that of the (1-38)H-(39-104) complex having Lys at position 39. Biological activity and reduction potential decreased to 34% and 190mV, respectively, from 55% and 215mV in the (l-37)H-(38-104) complex having Lys39. Biological activity decreased, from 25% in the [Lys39](l-39)H-(40-104) complex, to -19% in both variant complexes. All variants have reduced stability (pK for alkaline isomerization lowered from 9.7 to -8.2), decreased reduction potentials (~190mV), and impaired biological activity (20-30%). As above, the inferred role of Arg38 is to provide binding energy for the bottom loop of the molecule. Loosening of this loop results in a greater exposure of the heme, and thus a lowered reduction potential. This interpretation is supported by the properties of the complex (1-38)H-(39-104) (En)=150mV and -25% biological activity). In this complex, the break in the polypeptide chain is such that Arg38 is retained in the main body of the molecule, where it cannot act in attaching the floor to the main body of the molecule. Lys can provide a counter-charge for the heme propionate, but does not fully restore a normal reduction potential or electron transfer activity. The results therefore suggest that the extensive hydrogen-bonding capacity of the' Arg side chain is specifically required at position 38. Residue 39 is fairly strongly conserved, with Lys39 occurring in all animal species. The studies on these non-covalent complexes are taken to support a role of Lys39 in stabilizing the conformation of the bottom O-loop of the protein molecule. The Glu39 substitution, which occurs within in the stable complex having Arg38 within the O-loop (see above), has the greatest effect on the functional properties. The other substitutions, which occur within a complex already destabilized by the absence df Arg38 within this O-loop, have lesser effects. The results are again interpreted in terms of the inability of the substituted amino acids to form an interaction which stabilizes the conformation of the bottom O-loop. It is proposed that the structural destabilization results in the lowered reduction potentials, which in turn cause the decrease in biological activity. 4. Also 5. 33 Thr40 Substitution by Lys, Val and Phe Covalent religation of (1-40)H and (41-104) Asn54 and Lys55 Substitution Covalent by Ala54 and Lys55 deletion religation of (1-54)H and (56-104) Met65 Substitution by Hse Glu66 Substitution by Gin, Lys and Nva Tyr67 Substitution by Phe and FPhe Substitution by FPhe Covalent coupling of (1-65)H and (66-104) Covalent coupling of (1-65)H and (66-104) Covalent religation of (1-65)H, (66-79)* and (80-104) All variants have a decreased reduction potential (~190mV) and impaired biological activity (-25%). Val40 and Phe40 variants have pK's for alkaline isomerization of 8.0 and 8.3, respectively. Biological activities for these variants, and also for an Ala insertion following Lys55, are decreased to -20%. Normal electron transfer activity, reduction potential and spectral properties. NMR studies reveal no significant structural perturbations. Nva66: no 695nm band; only 20% biological activity. Gln66 and Lys66: slightly elevated reduction potential; decrease of 0.7 in pK for alkaline isomerization; >90% biological activity. Lys66: decreased ability to bind ATP. Phe67 variant retains 56% of normal activity in succinate oxidase system; but FPhe67 is completely inactive. Covalent religation of (1-65)H, (66-79)* and (80-104) Em=199mV. Rate of electron transfer in ascorbate-cytochrome c oxidase system increased. In eukaryotic cytochromes c, residue 7 40 is most frequently threonine or serine. This pattern of conservation and the experimental results suggest that the side chain of residue 40 forms a hydrogen bond which is important in stabilizing the conformation of the bottom fl-loop of the protein molecule. Residues 54 through 56 are highly 7 variable in identity. The loss of function is interpreted in terms of structural perturbation of the bottom O-loop of the protein molecule. Homoserine at position 65 does not 8,9 alter the structural or functional properties of cytochrome c. These results are consistent with the high variability of residue 65. (Serine occurs here in several species.) Glu66 is a fairly conservative acidic 10 residue occurring in the amphipathic 60's helix. The Nva66 variant demonstrates that hydrophobicity cannot be tolerated at position 66. Inferred roles of Glu66: inducing a-helical conformation; providing a salt bridge to stabilize protein against denaturation; ATP binding. Highly conserved Tyr67, together with 11 Thr78, Asn52 and an internal water molecule, form a network of hydrogen bonds at the lower left of the heme crevice, with Tyr67 directly hydrogen bonding the Met80 ligand. Tyr67 is also part of the left aromatic channel. The results show that Tyr67 is not essential for electron transfer activity. An electronegative fluorine substituent may perturb the electronic environment of the heme. The electron transfer activity 12 determined for the FPhe67 variant is in disagreement with results from ref. 11. The significance was not discussed. 34 Substitution by Phe Thr78 Substitution by Val Substitution by Asn and Aba Covalent religation of (1-65)H and (66-104)* Em=199mV. 50% decrease in biological activity. Shift in position of a- and /3-bands in absorption spectrum. Increased resistance to . denaturation by alkaline pH (pK 10.7 vs. 9.3) and temperature ( T m = 1 0 7 ° C vs. 64° C). Protein is oxidized rapidly by molecular oxygen. Lys72, Lys73 Substituted individually (and also in groups) by acetylated-Lys Tyr74 Substitution by Leu and Lys79 Covalent religation of (1-65)H, (66-79)* and (80-104) Covalent religation (1-65)H, (66-79)* (80-104) of and All variants possess the 695nm band. Modifica-tions of Lys72 and Lys73 cause a 2.5-fold increase in K _ for activity with cytochrome c oxidase. Modification of Lys79 has only a minor effect Activity slightly lowered in both succinate oxidase (by -40%) and ascorbate-cytochrome c oxidase systems. Greater thermolability, as the 695nm band is lost at a lower temperature. That the Phe67 variant has an 13 increased resistance to denaturation shows that the major role of Tyr67 is not in structural stabilization. The altered spectral properties suggest that Tyr67 has a direct influence on the TT-electron system of the heme, which is inferred to affect the reduction potential. Tyr67 may. also have a role in preventing the access of oxygen to the heme iron, and in establishing the reduction potential of the protein. The lowered electron transfer activity is attributed to the decreased reduction potential. The results are consistent with 14 chemical modification studies on the intact protein. Lys72 and Lys73 are confirmed to be part of the binding domain on cytochrome c for cytochrome c oxidase. Covalent religation of (1-65)H, (66-79)* and (80-104) Covalent coupling of (1-65)H and (66-104)* E =170mV. 695nm band. Loss of Electron transfer activity in ascorbate-cytochrome c oxidase assay is decreased. Asn78 has a slight, and Aba78 a large decrease in intensity of the 695nm band. E^(Aba78) = 251mV; Tm(Asn78) = 266mV. Both variants, but Aba78 in particular, show a large decrease both in stability against alkaline and thermal denaturation, and in biological activity. The highly conserved Tyr74, Trp59 11, and Tyr67 form an aromatic cluster at 14 the left side of the molecule. The results show that Tyr74 is not essential for electron transfer activity, but suggest that it may have a role in stabilizing the conformation of the left side of the molecule. Thr78 is a member of the hydrogen 12 bonding network at the lower left of the heme crevice. The significant perturbation of functional properties in the Val78 variant suggests that Thr78 has a role in structural stabilization. These results also implicate Thr78 in 13 stabilization of the heme crevice. Note that Asn78 does occur in one eukaryotic cytochrome c (from Chlamydomonas). 35 Met80 Substitution by His Ile81 Substitution by Ala, Leu and Val Phe82 Substitution by Leu Ala83 Substitution by Pro Covalent religation of (1-65)H and (66-104)* Covalent religation of (1-65)H, (66-79) and (80-104)* Covalent religation of (1-65)H, (66-79) and (80-104)* Covalent coupling of (1-65)H and (66-104)* Arg91 Guanidinium group modi-fied using pentane-2,4-dione; cyclohexane-1,2-dione; or camphor-quinone-10-sulfonic acid. Guanidinium group modi-fied using pentane-2,4-dione Covalent coupling of (1-65)H and (66-104) As above Met80 has a role in establishing the fairly high reduction potential of the heme iron. The absorption spectrum of this variant is fairly similar to that of the native protein. The reduction potential, is lowered to 40mV. The reduction potentials of these variants are not significantly perturbed. Although the activity of the variants in mediating electron transfer from ascorbate to cytochrome c oxidase is not greatly altered, some differences in KJJJ are apparent Em=265mV. Activity in Phe82 has been proposed to parti-mediating electron transfer cipate directly in the electron transfer from ascorbate to reaction. However, these results show cytochrome c oxidase is that it is not absolutely required. The 15 Replacement of Ile81 with other aliphatic side chains does not affect the reduction potential. Slight differences in activity with cytochrome c oxidase suggest that residue 81 has a role in interaction with oxidase. 16 not greatly affected. Slightly decreased suscep-tibility to denatuation by alkaline pH (pK 9.0 vs. 9.3) and temperature ( T m 53 vs. 65° C). Slightly increased reduction potential (266mV), but decreased biological activity (-80%). No effect on reduction potential, 695nm band, or biological activity. role of the side chain at this position may be to provide hydrophobicity. Ala83 and Pro83 are highly conserved in animals and plants respectively. The Ala to Pro substitution has minor effects. The decrease in electron transfer activity suggests that residue 83 has a role in interaction with cytochrome c reductase. Decreased ability to bind ATP. Addition of bulky substituents would disrupt the hydrogen bonds between Arg91 and the 80's region of polypeptide chain. Thus, the results do not support the proposed role of Arg91 in stabilizing the conformation of the 80's loop. Arg91 is implicated as a component of an ATP binding site on the surface of the cytochrome c molecule. 12 13 17 36 Tyr97 Substitution by Leu Covalent coupling of (1-65)H, (66-79) and (80-104)* E m = 319mV. Slightly Highly conserved Tyr97 and PhelO reduced activity in form an aromatic channel at the right mediating electron transfer side of the molecule. The results from ascorbate to cytochrome c oxidase. Residues 40 to 55 Deletion Covalent religation from (1-39)H and (56-104) Variant protein possesses 695nm band; is highly unstable (pK for alkaline isomerization 7.4); has a decrease in reduction potential by 130mV; and has only 15% biological activity. Residues 60 to 103 or 104 Chimera of Covalent different show that Tyr97 is not essential for electron transfer activity. The interaction of these aromatic side chains may be an important structural element, as the reformation of the 65-66 peptide bond is inhibited in this complex. Residues 40 to 55 form the bottom fl-loop of the cytochrome c molecule. It is proposed that the role of this loop is to shield the bottom edge of the heme from solvent and thereby control the reduction potential of the protein. The deletion of the sequence 40 to 55 generates a protein which is an analog of the small bacterial cytochromes c. All chimeric proteins have Between yeast, cow and horse species of cytochrome coupling of (1-65)H of horse, with (65-104) of cow, or (65-103) of yeast cytochrome c full biological activity. The measured reduction potentials are: horse, 255; cow, 257; horse-yeast, 263; cow-yeast, 268; and yeast, 270mV. cytochromes c, 10 amino acid differences occur in the (66-103) fragment The variant residues are inferred to have a role in controlling the reduction potential of the protein. 12 18 19 aThe normally-occurring amino acid residues, given in bold face, are those in horse cytochrome c. All modifications described have been carried out using this protein. Abbreviations used: Aba = L-a-aminobutyric acid, FPhe=L-fluorophenylalanine, Hse=L-homoserine, Nva= L-norvaline, Orn = L-ornithine. ^Fragments labelled with a '*' have been constructed de novo, by either stepwise synthesis, or condensation of partial fragments. Note that some of the variants are non-covalent complexes of protein fragments. Variants derived from the covalent coupling of fragments (1-65)H and (66-104) also contain a Met to Hse substitution at position 65. cThe properties of the intact native protein include: E m = 260mV; pK for alkaline transition -9.3; and the presence of a 695nm absorption band. Biological activity is typically assayed from the polarographic measurement of the ability of the variant protein to restore succinate oxidation by a preparation of cytochrome c- depleted mito-chondria (from rat liver). Less frequently used as a substrate in these assays is ascorbate-TMPD. References: (1) Poerio et al., 1986. (2) Juillerat and Tanuichi, 1986. (3) Wallace and Rose, 1983. (4) Proudfoot et al., 1986. (5) Harris and Offord, 1977. (6) Proudfoot and Wallace, 1987. (7) Proudfoot et al., 1989. (8) Corradin and Harbury, 1974. (9) Boswell et al., 1981. (10) Wallace and Corthesy, 1986. (11) Koul et al., 1979. (12) ten Kortenaar et al., 1985. (13) Wallace et al., 1989. (14) Boon et al., 1979. (15) Raphael and Gray, 1989. (16) Boots and Tesser, 1987. (17) Corthesy and Wallace, 1986. (18) Wallace, 1987. (19) Wallace et al., 1986. 37 1977; Wallace and Proudfoot, 1987). This property is also exploited in the final covalent coupling of semi-synthetic fragments through conformationally- directed religation: within certain non-covalent complexes, the close proximity of the a-carboxyl and a-amirio groups of contiguous peptide fragments promotes the spontaneous formation of a peptide bond. Generally, for the peptide bond to form the carboxyl group must be activated, and this has most commonly involved the homoserine lactone present at the C-terminus of the cyanogen bromide cleavage peptide (1-65)H. Coupling to this fragment of the (66-104) fragment generates the intact cytochrome c molecule bearing a methionine to homoserine substitution at the position 65 religation site. [This substitution does not significantly affect the structural or functional properties of the product cytochrome c (Boswell et al., 1981; Corradin and Harbury, 1974).] More recently, proteases used under conditions which favor bond synthesis have been used to attach activating groups [in the form of an esterifed (dichlorophenyl) amino acid, another C - terminal activated peptide fragment, or an activating group itself (Boc-hydrazide, methanol)] to the C-terminus of a peptide (Wallace et al., 1989). In one report, the reverse proteolytic action of the enzyme clostripain, in the presence of 90% glycerol, was used to catalyze the direct recoupling of fragments (1-38)H and (38-104) (Juillerat and Homandberg, 1981). Because they require that reactive amino acid side groups be protected, standard procedures for activating and coupling peptide fragments are employed only during intermediary manipulations of isolated fragments [e.g. in the coupling of the fragments (66-79) and (80-104)]. Through the use of semi-synthetic methods, more than 50 single-site amino acid modifica-tions have been made at 23 different positions along the polypeptide chain of cytochrome c. The results of these studies are summarized in Table 1.2. It should be noted that for investigating the roles of specific amino acid residues, non-covalent complexes are less informative, as the occurrence of internal polypeptide chain termini introduces a pair of charged groups (the a-amino and a-carboxylate groups) and in addition may substantially alter the local conformation of the protein molecule. Although such complexes may be largely functional, they are usually described as having a looser conformation than the native molecule (Wallace and Proudfoot, 1987). 38 5. Site-directed mutagenesis Difficulties with either the interpretation of the experimental results obtained, or the specific targeting of the site of modification have hampered the preceding methods for generating variant proteins in providing a thorough characterization of structure-function relationships in cytochrome c. With chemical modification, problems in attaining product homogeneity complicate the assignment of the cause of altered functional properties to a specific residue: side reactions can modify other protein groups, and the protein species derivatized at the desired site must be separated from species derivatized at other sites. In addition, the choice of target residue is restricted, as not all residues are susceptible to chemical modificiation (e.g. aliphatics and phenylalanine). Also, because derivitization of a side chain usually causes an increase in steric bulk, the method is not useful for modification of internal residues as it would result in gross conformational rearrangements. Naturally occurring variants from different species of organisms also cannot provide a definitive assignment of a role to a particular residue, because they almost always contain amino acid substitutions at multiple sites (Dickerson and Timkovich, 1975). In addition, by definition they do not supply variants at conservative positions in the amino acid sequence. Variants obtainable from in vivo mutagenesis are usually confined to those arising from single-nucleotide substitutions, and may also be restricted by the method of selection employed. Direct chemical synthesis and site-directed mutagenesis are two methods which in principle permit a variant protein to be designed specifically. The direct synthesis approach may be handicapped if the protein contains certain post-translational modifications (such as covalent heme attachment), although this problem may be overcome to some extent using semi-synthesis. The utility of semi-synthesis is, however, limited by the requirement for a polypeptide chain cleavage site near the residue of interest In the cytochrome c system, it is clear that site-directed mutagenesis emerges as the most general and effective method. The modifications which can potentially be generated are diverse, including amino acid substitutions, deletions, and insertions. The only shortcoming of the method is that changes are restricted to the 20 naturally occurring amino acids. Because of its power and convenience, site-directed mutagenesis is currently being 39 widely used to generate an ever-expanding collection of variant cytochromes c. The variants which have been fairly extensively characterized and thus provided useful information on structure-function relationships in cytochrome c are reviewed here. A summary of studies on the Phe82 and Arg38 variants of yeast iso-1-cytochrome c, which are major subjects of the work done in this thesis, is deferred to Sections I.E and I.F. Asn52 and TyT67, which together with Thr78 participate in hydrogen bonding a buried water molecule positioned below Met80 in the heme crevice, have both been replaced with non-hydrogen bonding side chains. The Phe67 variant of rat cytochrome c (Luntz et al., 1989) has a slightly perturbed absorption spectrum, a 35 mV decrease in reduction potential (to 224 mV), and normal reactivity in transferring electrons from ascorbate-TMPD to cytochrome c oxidase. Most notable, however, is a significant increase in the stability of the structure of this variant, as indicated by the greater resistance to denaturation by both alkaline and acid pH and by heat or urea. The Ile52 substitution in yeast iso-1-cytochrome c (Das et al., 1989) was first identified as a global second-site suppressor of mutations giving rise to unstable proteins. The Ile52 variant is more resistant to thermal denaturation than the Asn52 wild-type protein ( T m = 6 4 ° C , vs. 47° C). The increased stability of both the Phe67 and Ile52 variants is suggested to be due to several factors: the increased hydrophobicity introduced at internal sites of the protein molecule, the increased helix-forming propensity of the substituted amino acids (both Tyr67 and Asn52 occur within a-helical segments of polypeptide chain), and the inferred loss of the buried water molecule. These results indicate that neither the interaction between Tyr67 OH and the Met80 ligand sulfur, nor the internal hydrogen bonding network have major roles in stabilizing the protein structure. In addition, this network, whose water molecule is positionally sensitive to the redox state of the heme iron,. appears not to be critical to the electron transfer function of the cytochrome c molecule. The roles of Tyr67 and Asn52 are inferred to be in stabilizing the buried water molecule, which may in turn have a role in conferring conformational flexibility to the adjacent polypeptide chain, a region of the cytochrome c molecule known to form interactions with redox partners. It should be noted that these studies predict that amino acid substitutions at the 40 third residue in the network, Thr78, would also give rise to a more stable protein (Luntz et al., 1989), but semi-synthesis has shown this not to be the case (see Table 1.2). The trimethyllysine at residue 72 in yeast iso-1-cytochrome c has been replaced with an arginine (Holzschu et al., 1987). Lys72 is strongly conserved in eukaryotic cytochromes c, and has been implicated by chemical modification studies (see Section I.D.I) to be involved in the binding of cytochrome c to redox partners. In yeasts and plants, Lys72 is specifically methylated by an S-adenosylmethionine protein-lysine N-methyl transferase (DiMaria et al., 1979). The Arg72 variant iso-1-cytochrome c supports normal growth of yeast cells on lactate medium, but has a slightly lowered stability, and moderately altered reaction kinetics with cytochrome b2. These results suggest that Tml72 may have a role in conferring structural stability to the iso-1-cytochrome c protein, or in recognition of redox partners. Replacement of Tml72 with an Asp has also been shown to affect both binding and electron transfer between iso-1-cytochrome c and cytochrome c peroxidase (Hazzard et al., 1988a). The three invariant proline residues have been the target of mutagenesis, with a focus on their role in stabilizing the native conformation of the cytochrome c molecule. The replacement of Pro30 with a threonine substantially decreases protein stability: the Thr30 variant of yeast iso-2-cytochrome c supports only poor growth of the yeast cells on non-fermentable media, and occurs at lowered levels in vivo (Wood et al., 1988a). At Pro76, substitution by Gly lowered the pK a for alkaline transition from ~8.4 to -6.6, increased the susceptibility to denaturation by guanidine hydrochloride, and increased the solvent accessibility of tyrosine side chains (Wood et al., 1988a,b; Nail et al., 1989). For this Gly76 variant, the fast phase of unfolding induced by guanidine hydrochloride appears to occur at -3 times the normal rate (Wood et al., 1988b). Pro76 in cytochrome c is thus indicated to function in stabilizing the native versus the unfolded conformation of the polypeptide chain. In addition, the abnormal refolding of the denatured Gly76 protein, as monitored spectroscopically, implicates Pro76 in having a role, through cis-trans isomerization of its imide peptide bond, in the slow phase of polypeptide chain folding of cytochrome c. Amino acid replacements at Pro71 in yeast iso-1-cytochrome c obtained in vivo 41 (see above) have been supplemented by a Thr71 variant of iso-2-cytochrome c generated using site-directed mutagenesis (White et al., 1987). The two studies agree in the importance of Pro71 in stabilizing the structure of cytochrome c. The Thr71 variant of iso-2-cytochrome c has a lowered pKa for alkaline isomerization (to 6.6 from 8.5) and a decreased resistance to denaturation by guanidine hydrochloride. Sorrell et al. (1989) used mixed-oligonucleotides to mutate the heme ligand Hisl8 of yeast iso-2-cytochrome c. Of several amino acid replacements generated (including Tyr, Thr, Cys, Gin, Ser and Leu) only Arg resulted in a variant iso-2-cytochrome c which supported yeast growth (at a subnormal rate) on glycerol. The Argl8 variant protein possessed the 695nm absorbance band, was not auto-oxidizable, and did not bind carbon monoxide, thus indicating the heme iron had a complete coordination sphere. The variant protein had anomalous electrochemical behavior, although it appeared to have a normal reduction potential (~270mV). Fetrow et al. (1989) have investigated the role of the four fl-loops of yeast iso-1-cytochrome c (see Section I.A.2.a) as independent functional units. Yeast strains bearing mutations in which residues 22 to 28, or 74 to 78 of iso-1-cytochrome c are deleted are devoid of cytochrome c protein and do not grow on glycerol or lactate media. However, replacement of the loop consisting of residues 19 to 28 with the corresponding segments from other cytochromes c (tuna, R. rubrum c2, P. denitrificans c35o or P. aeruginosa c 5 5i) yielded partially to completely functional proteins. These results suggest that the presence of this loop is required for cytochrome c biosynthesis and activity, but that substantial sequence variability within the loop can be accommodated. Iso-1-cytochrome c with a deletion of residues 37 to 40 or 43 to 50 was present at about 50% the normal intracellular level and retained 10-20% activity, thus indicating that the residues within these two loops are not absolutely required for cytochrome c heme attachment, mitochondrial import, or enzymic interactions. It should be noted that most of the deletions and replacements generated are fairly severe, and the resultant proteins have not been extensively characterized, thus rendering the conclusions less than definitive. 42 E. Yeast iso-1-cytochrome c In baker's yeast (Saccharomyces cerevisiae) two isozymes of cytochrome c occur, iso-1-and iso-2-cytochromes c. Iso-1-cytochrome c, the subject of the present studies, is the more abundant form, typically representing 95% of the total. The amino acid sequence of yeast iso-1-cytochrome c was determined chemically by Narita et al. (1969) and Lederer et al. (1972). Although a component of the mitochondrion, yeast iso-1-cytochrome c is encoded by a nuclear gene. Cloning and sequencing of this gene (Smith et al., 1979) confirmed the amino acid sequence determined from the protein. The biosynthesis of iso-1-cytochrome c involves the following steps: translation of apo-iso-1-cytochrome c on cytosolic ribosomes; removal of the amino-terminal methionine residue of the polypeptide chain through the action of an aminopeptidase (Tsunasawa et al., 1985); trimethylation of the e-nitrogen of Lys72 (DiMaria et al., 1979); and covalent attachment of protoheme IX to two cysteinyl residues of apo-iso-1-cytochrome c through the action of a specific heme lyase (Dumont et al., 1988). This final step has been shown to be concomitant with translocation of the holo-iso-1-cytochrome c molecule across the outer mitochondrial membrane. The fully processed protein contains 108 amino acid residues, and has a calculated molecular weight of 12720. In comparison to vertebrate cytochromes c, which are typically 103 or 104 amino acid residues in length, yeast iso-1-cytochrome c has a 5 residue-long extension at its amino terminus. In addition to acting as an electron carrier in the electron transfer chain, yeast cytochrome c reacts with two other redox partners occurring within the intermembrane space of mitochondria, cytochrome i 2 (yeast lactate dehydrogenase) and cytochrome c peroxidase. Cytochrome b2 contains both a heme and a flavin prosthetic group, and mediates electron transfer from L-lactate into the electron transport chain. Cytochrome c peroxidase catalyzes the reduction of hydrogen peroxide to water and acquires reducing equivalents specifically from ferrocytochrome c. Yeast iso-1-cytochrome c clearly represents an ideal system for investigation of structure-function relationships in cytochrome c. Its amino acid sequence can be manipulated using both 43 site-directed and classical (in vivo) mutagenesis. Expression in yeast cells allows for a useful assay of the in vivo functionality of variant cytochromes c, and the protein can be readily prepared and purified in sufficient quantity for in vitro characterizations. The study of many aspects of the yeast cytochromes c, such as their high resolution NMR spectroscopy (Pielak et al., 1988a) and their protein folding properties (Nail and Landers, 1983), is well developed. In addition, two well-studied soluble proteins, cytochrome c peroxidase and cytochrome b2, provide convenient systems for the analysis of the interaction of cytochrome c with its physiological redox partners. F. Site-directed mutagenesis of Phe82 in yeast iso-1-cytochrome c Phenylalanine 82 was chosen as a target for mutagenesis for several reasons (Pielak et al., 1985): its phylogenetic invariance suggested an important role; its side chain, positioned at the surface of the molecule and parallel to the heme group, has an interesting structural environment; and the phenyl group is not amenable to chemical modification. Various functions have been proposed for Phe82. Phe82 may have a structural role in establishing the appropriate heme environment In addition, modelling studies indicate that the phenyl ring of Phe82 is positioned such that it could form part of the route for electron transfer between the heme groups of cytochrome c and cytochrome c peroxidase (see Section I.B.5). Molecular dynamics simulations of the modelled electron transfer complex between cytochrome c and cytochrome bs also suggest that the side chain of Phe82 may transiently adopt a conformation such that it can bridge the heme groups of the two molecules, thereby facilitating electron transfer between these groups (Wendoloski et al., 1987). Phe82 of yeast iso-1-cytochrome c has been replaced by tyrosine, serine, glycine, isoleucine, leucine, and alanine. The experimentally determined properties of these position 82 variants are summarized in Table 1.3. In comparison to the wild-type protein, all of the variants have a lowered reduction potential, with the greatest decrease observed for the Gly82 and Ser82 variants (~50mV). These results suggest that the heme environments of the variant iso-1-cytochromes c are perturbed. The variants display a range of values for reactivity with Fe(EDTA)2", which provides a measure of the exposure of the cytochrome c heme group to the 44 Table 1.3. Properties of position 82 variants of iso-1-cytochrome c Variant Em pKa for Reactivity Relative Reactivity with Zn-CCPd (mV)a alkaline with steady state -transition0 Fe(EDTA)2-3 reactivity 'Ms-1).- kb(s-) (104 M-'S"1) with CCPC Phe 290 8.5 7.2 100% 166 1.9 x 104 Ser 255 7.7 14.8 70% 151 2.3 Gly 247 7.7 13.7 20% 13 1.4 Tyr 280 8.4 6.2 30% 173 1.5 x 104 He . 273 7.2 9.4 n.d.e 56 3.0 Leu 286 7.2 8.8 n.d. 93 2.0 Ala 260 n.d. 9.9 n.d. n.d. n.d. References: aRafferty et al., 1990. bPearce et al., 1989. cPielak et al., 1985. dLiang et al., 1987, 1988. e n.d.: not determined external medium. The apparent pKa for the alkaline isomerization of all of the variants is lower than that of the wild-type protein (Pearce et al., 1989), indicating that the heme crevice in the variant proteins has a lower stability. This apparent pKa is determined by two factors, (i) the dissociation constant, K^, of the ionizable group which is deprotonated during the alkaline isomerization process, and (ii) the equilibrium constant, K Q for conversion of the native to the alkaline conformation (Davis et al., 1974). Study of the kinetics of the alkaline isomerization reaction indicates that for the Ile82 and Leu82 variants, the drop in the apparent pKa is due entirely to a drop in the pKH of the titrating group (from T l to -9.5), whereas for the Gly82 and Ser82 variants, both pK^ and are lowered (from -11 to -9.1, and from -300 to -20). Little change is observed in the intrinsic (UV) CD spectra of the Gly82, Ser82 and Tyr82. variants, indicating that the overall secondary structure occurring in these proteins is not affected (Pielak et al., 1986). However, all of the variants have altered CD spectra in the Soret region, with the most notable difference being the decreased intensity of the negative Cotton effect at 417 nm in the spectra of the oxidized forms of the variant proteins (Pielak et al., 1986; Rafferty et al., 1990). 45 These spectral differences are attributed either to the loss of the direct interaction between the 7r-orbitals of the Phe82 phenyl ring and those of the heme group, or to the altered conformation of the polypeptide chain in the vicinity of the heme group. In addition, the Soret CD spectra of the variants and of the wild-type protein are very similar at temperatures above 40° C, which suggests that amino acid substitutions at position 82 may decrease the stability of the native conformation of the polypeptide chain surrounding the heme. Collectively, the results from studies of the reduction potential, alkaline isomerization, Fe(EDTA)2~ reactivity and circular dichroism of the variant proteins suggest that they all have a lowered stability and a moderate perturbation in heme environment and possibly in the conformation of the adjacent polypeptide chain. The electron transfer activity of the position 82 variant iso-1-cytochromes c has been assessed by a number of means. All of the variant proteins, as the sole source of cellular cytochrome c, support viable growth of yeast cells under non-fermenting conditions, thus demonstrating that they are capable of carrying out electron transfer with both cytochrome c reductase and oxidase of the mitochondrial electron transfer chain. In addition, all of the variants show at least partial activity in in vitro steady-state assays with cytochrome c peroxidase. Using semi-synthesis, ten Kortenaar et al. (1985) (see Table 1.2) have also shown that a Leu82 variant of horse cytochrome c has nearly normal activity in mediating electron transfer from ascorbate- TMPD to cytochrome c oxidase. These results indicate that Phe82 is not essential to the mechanism of electron transfer of cytochrome c, but do not rule out a role of Phe82 in optimizing the efficiency of the electron transfer reaction. In addition, it is conceivable that in the absence of Phe82, electron transfer occurs via an alternative mechanism. The identity of residue 82 does affect the steady state reactivity of the cytochrome c variants with H202-oxidized cytochrome c peroxidase (Table 1.3). However, the results of these steady state assays are not straightforwardly interpretable, as they are influenced by both the rate of association/dissociation of cytochrome c and cytochrome c peroxidase, and the rate of the electron transfer reaction within the intermolecular complex. 46 Liang et al. (1987, 1988) have examined the intermolecular electron transfer rates within a preformed 1:1 complex between iso-1-cytochrome c and cytochrome c peroxidase in which the heme iron has been replaced by a zinc ion. The reaction scheme is described below, with ZnP representing zinc-substituted cytochrome c peroxidase, and Fe(II,III) cyt c representing the two oxidation states of cytochrome c. Flash photolysis of the initial complex A generates the zinc-protoporphyrin triplet state (3ZnP), which can either decay back to the ground state or reduce ferricytochrome c with rate constant k t. A hv A* kj B [ZnP, Fe(III)cyt c] — > [3ZnP, Fe(Hl)cyt c] — > [ZnP**, Fe(II)cyt cj The resulting intermediate B returns to the ground state by thermal electron transfer, with rate constant k b , from Fe(II)cyt c to the cation radical ZnP*. B k b A [ZnP-\ Fe(II)cyt c] —> [ZnP, Fe(m)cyt c] The thermal reaction is analogous to the physiological oxidation of ferrocytochrome c by H 2Oj-oxidized cytochrome c peroxidase. The rate constant k b can alternatively be measured within a complex in which cytochrome c is initially in the reduced state. In this case, the triplet-state zinc protoporphyrin is oxidized by an exogenous oxidant ([Cc^NHs^Cl] 2*) to the cation free radical, which is subsequently reduced by cytochrome c. [Co(NH,) 5 Cl] J + A hv \ B k b [ZnP, Fe(II)cyt c] — > [3ZnP, Fe(II)cyt c] -V> [ Z n P \ Fe(II)cyt c] — > [ZnP, Fe<m)cyt c] [Co(NH 3) 5crr —> [Co(H,0)J I+ This scheme precludes the possibility that structural rearrangements associated with the reduction of cytochrome c in the conversion of A* to B are deterrnining the rate of the subsequent decay of the intermediate B. The rate constants k t for the photoinitiated electron transfer are similar for the wild-type protein and the Ser82 and Tyr82 variants, moderately lowered for the Leu82 and Ile82 variants, and substantially lowered for the Gly82 variant (see Table 1.3). This rate is affected by the distance between the redox sites. The data thus indicate that the complex formed between 47 zinc-cytochrome c peroxidase and cytochrome c is similar for all position 82 variants, except the Gly82 variant, which is inferred to form a perturbed complex. The rate of the thermal electron transfer reaction is strongly dependent on the identity of the residue at position 82: the variants with non-aromatic side chains (Ser, Leu and He) react -10" times slower than the wild-type and Tyr82 variants. It is notable that in reactions where ferrocytochrome c is oxidized (i.e. those with cytochrome c peroxidase-H202 and with Zn+-cytochrome c peroxidase) a decrease in reduction potential of the cytochrome c heme iron would be expected, in the absence of other effects, to increase the reaction rate. The experimental data (Table 1.3) show that the various position 82 variants have a wide range of values for these reaction rates, and that the rates do not correlate with cytochrome c reduction potentials, as is most evident for the Gly82 and Ser82 variants. The results therefore emphasize that the nature of the side chain present at position 82 does directly affect the electron transfer activity of cytochrome c. An aromatic side chain at position 82 is inferred to facilitate electron transfer by forming hole superexchange interactions between cytochrome c and cytochrome c peroxidase (Liang et al., 1987, 1988). Modelling of the intermolecular complex suggests the pathway would include the heme and Phe82 phenyl ring of cytochrome c, and the imidazole ring of Hisl81 and heme of cytochrome c peroxidase (Section I.B.5). CD spectroscopic studies indicating that the it-electron systems of Phe82 and of the heme in iso-1-cytochrome c are coupled (Pielak et al., 1986) lend some support to this proposal. However, more recent studies on the kinetics of electron transfer within the Zn-cytochrome c peroxidase - iso-1-cytochrome c complexes (Everest et al., 1990) downplay the importance of hole-superexchange pathways. These studies instead suggest that the rate of interconversion between conformational substates of cytochrome c having differing reactivity with Zn-cytochrome c peroxidase has a role in determining the rate of interprotein electron transfer. 48 G. Site-directed mutagenesis of Arg38 in yeast iso-1- cytochrome c Arg38 is invariant in eukaryotic cytochromes c and also occurs in several bacterial cytochromes c2. The guanidinium group of this residue interacts with the rear buried propionic acid group of the heme. Two structural roles have been proposed for Arg38. Arg38 has been suggested to function in stabilizing the protein by providing a counter-charge for the internal carboxylate group (Takano and Dickerson, 1981a). Wallace also suggests Arg38 stabilizes the fold of the protein, although he emphasizes that the network of hydrogen bonds formed by the guanidinium group serves to bind the bottom loop of the molecule to the main body (see Table 1.2). Moore has proposed two roles related to the electrostatic interactions between Arg38 and heme group. First, Arg38 may lower the pK a of the adjacent propionic acid group to a value below ~4.5, and thereby contribute to the pH-independence of the heme reduction potential within the physiological pH range. This proposal is based on the observed variation with pH of the reduction potential of cytochromes c2 which possess amino acid replacements at Arg38 (Moore et al., 1984). Second, the side chain of Arg38, through direct electrostatic interaction with the heme iron, may act as a trigger for remote conformational changes upon oxidation/reduction of the cytochrome c molecule (Moore, 1983). Cutler et al. (1989) have replaced Arg38 in yeast iso-1-cytochrome c with lysine, histidine, glutamine, asparagine, leucine and alanine. These amino acid substitutions have very little effect on either the electron transfer or structural properties of the iso-1-cytochrome c protein: all of the variants support the growth of yeast on lactate, exhibit normal in vitro reactivity with cytochrome c peroxidase, and have NMR and absorption spectra very similar to those of the wild-type protein. The focus of the work by Cutler et al. was on the proposed role of Arg38 in controlling the reduction potential of iso-1-cytochrome c. The variation of reduction potential with pH for all of the variants was found to be identical to that for the wild-type protein. This result suggests that Arg38 is not responsible for maintaining a low pK a for the heme propionate group. However, the identity of the amino acid at position 38 does have a marked effect on the reduction potentials of the variant proteins, which were observed to be as follows: Arg38 49 (wild-type): 272mV; Lys38: 249mV; His38: 245mV; Gln38: 242mV; Asn38: 238mV; Leu38: 231mV; and Ala38: 225mV. It is notable that the observed shifts in reduction potential for the Lys38 and Gln38 variants follow the same pattern observed for the same substitutions generated semi-synthetically in non-covalent complexes of horse cytochrome c (Proudfoot and Wallace, 1987; see Table 1.2). H. Site-directed mutagenesis of Cysl02 in yeast iso-1-cytochrome c Amongst eukaryotic cytochromes c, yeast iso-1- and bullfrog cytochromes c are unique in having a cysteine at position 102. In the latter protein, Cysl02 forms an intramolecular disulfide bond with Cys20 (Brems et al., 1982). In yeast iso-1-cytochrome c, Cysl02 is of particular interest because its free sulfhydryl group is highly reactive toward both chemical modification (Zuniga and Nail, 1983; Motonaga et al., 1965) and oxidation (Cutler et al., 1987), and in addition is involved in the covalent dimerization of iso-1-cytochrome c via intermolecular disulfide bond formation (Bryant et al., 1985). The reactivity of Cysl02 complicates electrochemical analyses of iso-1-cytochrome c, as the protein is readily autoreduced and exhibits non-Nernstian behavior. Dimerization in the absence of exogenous thiol reducing agents also hinders the study of the oxidized form of the protein. Two approaches to alleviate these problems have been used. The free sulfhydryl group has been blocked by modification with iodoacetamide (Nail and Landers, 1983) or methyl thiosulfonate (Ramdas et al., 1986). Alternatively, site-directed mutagenesis has been used to replace Cysl02 in yeast iso-1-cytochrome c with either a threonine (Cutler et al., 1987) or a serine (Mayo et al., 1986) residue. In the work of Cutler et al. threonine was chosen as a replacement because it is the most frequently occurring residue at this position in eukaryotic cytochromes c. The Thrl02 variant iso-1-cytochrome c has been shown by Cutler et al. to be functionally indistinguishable from the genuine wild-type protein. It has normal behavior in vivo, as it is transported into the mitochondria, is methylated, and supports growth of yeast cells on lactate. In addition, it has a normal absorption spectrum, including a 695 nm band, well-behaved electrochemistry, and a typical reduction potential. Iso-1-cytochrome c bearing Thrl02 thus serves as the "wild-type" background 50 for a large part of the structural and functional studies described in this thesis. I. Objectives of the present research The underlying objective of the studies described in this thesis is to further the understanding of the structure and function of the cytochrome c molecule. The first goal of the current project was to obtain an accurate description of the three-dimensional structure of the wild-type yeast iso-1-cytochrome c protein. The structure of yeast iso-1-cytochrome c was compared to those of tuna and rice cytochromes c. As these cytochromes c possess about 60% amino acid sequence divergence, these comparisons provide information on the effect of differences in amino acid sequence on various structural aspects of the cytochrome c molecule. Equally importantly, the wild-type iso-1-cytochrome c structure will provide a basis for both the interpretation of the properties of singly-mutated iso-1 variant proteins, and the design of new variants. A major focus of this work was to determine the structural and functional role of the evolutionarily conserved residue phenylalanine 82. This involved determining the effects of amino acid substitutions at position 82 on the structure of iso-1-cytochrome c, and interpreting differences in functional properties of the variant proteins in terms of the altered structural properties. The role of the invariant residue arginine 38 was similarly, although less extensively studied. Appendix: Basic primer on structure determination using X-ray crystallography This appendix describes the basic theory and some practical details of the use of the X-ray diffraction method in determining the three-dimensional structure of a protein molecule. Its intent is to provide the reader who is unfamiliar with the method sufficient background to comprehend the crystallographic aspects of the research described in this thesis. For a more thorough discussion, the reader is referred to Blundell and Johnson (1976) or Sherwood (1976). 1. Crystalline structure A crystal is a solid in which the component molecules are arranged such that there is long-range, well-defined order in three dimensions. Within the crystal, relatively precise 51 intermolecular interactions are formed, with the molecules packing in a symmetrical manner. The crystal can be represented as a fundamental unit cell which repeats in a three-dimensional lattice. Each identical unit cell contains one or more asymmetric units which are related to one another by-well-defined symmetry elements. Generally, an asymmetric unit is composed of one protein molecule. Thus the objective of the X-ray crystallographic experiment is to determine the atomic structure of the asymmetric unit. 2. Diffraction theory The interaction of X-rays with irradiated matter is mainly electronic. This occurs through a process called Thomson scattering, in which the electric field of the incident X-ray causes an electron to oscillate, and thereby emit its own electromagnetic radiation in all directions. When X-rays interact with an object (i.e. a collection of atoms), each electron in the object acts as an independent scatterer. However, superposition of waves emitted by different electrons occurs. The intensity and phase of the total wave scattered by an object in a particular direction is entirely dependent on the distribution of electrons within the object This concept is the foundation of structure determination by X-ray diffraction methods, and is expressed in the cardinal equation of X-ray scattering: F(S) = / P(?) exp i(S-r) df, which states that F(S), the total wave scattered in the direction S, consists of the sum of individual j . waves exp i(S-r) scattered in the direction S by infinitesimal volumes, dr, of electron density, p(r) located at the position r. The integration is over all the infinitesimal volumes in the object Mathematically, the set of total waves, called the diffraction pattern, represents the Fourier transform of the distribution of electron density in the object 3. Basic X-ray crystallographic theory For a regularly arranged group of objects, such as a unit cell arranged in a crystal lattice, all of the individual unit cells scatter X-rays in an identical manner. But there is destructive interference of all scattered X-rays .except for those travelling in a few certain directions with 52 respect to the translational symmetry of the crystal lattice. A convenient representation of this interference is that for a crystal's real lattice, there is a reciprocal lattice which defines the permissible directions of the diffracted X-rays. The reciprocal lattice contains a sampling of the diffraction pattern of the unit cell. Each position in this lattice represents a permitted diffracted wave, called a reflection, and is specified by a triplet of integers hjc.1. For diffraction by a crystal, two simplifications can be made to the Fourier transform of the electron density (equation 1). The continuously variable direction of the diffracted X-ray, S, can be replaced by the discrete direction specified by hkl. Second, because appreciable electron density is localized near atomic nuclei, appropriate substitution of the atomic electron density function pj and the atomic position (XJ, yy Zj) can be made. The integral is then replaced by a summation over the n individual atoms contained in the unit cell: n F(hkl) = S yOj exp 27.1013, + ky, + lz,). (2) This is the structure factor equation, which again shows that individual reflections, referred to as structure factors, will have an amplitude (intensity) and phase determined by the atomic positioning within the unit cell. Equally importantly, this equation allows one to calculate exactly how a known distribution of atoms within the unit cell would diffract X-rays. The atomic electron distribution function in equation 2, p, has two components. The first, the atomic scattering factor, is determined by the number and spatial arrangement of electrons around a positionally fixed atomic nucleus, and thus is dependent only on the identity of the atom (i.e. the atomic number). The second, the atomic temperature factor B, corrects for thermal motion of the atomic nucleus (and of its associated electrons). Atomic motion permits the electrons to occupy a larger volume of space, thus decreasing the effective electron density and the scattering power of the atom. Each atom has an associated B-factor, which provides a measure of the mean-square displacement of the atom from its average position. A property of the Fourier transform is that it can be inverted. Inversion of the Fourier transform of the electron density (eq. 1) yields the electron density equation, P(r) = f F(S) exp -i(S-r) dS. 53 or equivalently, p(x.y.z) = E S E |F(hkl)| exp ia(hkl) exp -27ri(hx + ky + lz). (3) h— k— 1— Thus, the distribution of electron density in the unit cell can be deduced from the Fourier transform of the diffraction pattern. In practice, equation 3 is used to calculate the amount of electron density present at selected points throughout the unit cell. The resultant electron density map allows for a reconstruction of the atomic structure within the unit cell. However, the diffracted waves contain two pieces of information: the amplitude, which can be readily measured experimentally; and the phase, which is unobservable. [The electron density equation has been written in a form which emphasizes that the structure factor has these two components, |F(hkl)| and a(hkl).] Assigning phase information to the reflection data constitutes the major obstacle in the crystal structure determination. 4. Patterson synthesis and molecular replacement methods A Patterson map of the unit cell can be calculated using only the experimentally observable intensities of the diffracted X-rays: P(u.v,w) = E E E |F(hkl)|8 exp - 2 m ( r m + kv + Iw). j (4) h— *—- i— j In contrast to the electron density map, which has peaks occurring at the positions of atoms in the unit cell, the Patterson map has peaks at positions corresponding to interatomic vectors within the unit cell. Thus, a peak at the point (u,v,w) in the Patterson map indicates that there exist in the real unit cell two atoms related positionally such that u=xi-x2, v=y1-y1 and w=z1-z2. Because of its much greater complexity (it contains n2 peaks instead of only n, where n is the number of atoms in the real unit cell), the Patterson map cannot be interpreted to yield directly the atomic positions in a protein molecule. However, the experimentally determined set of interatomic vectors which is obtained from this type of map is particularly useful in a number of search methods, collectively referred to as molecular replacement Molecular replacement (Rossman, 1973) is one method for determining the phases of the observed diffraction data, and requires that a preliminary model be proposed for the three-dimensional structure of the unknown protein. Generally, this preliminary model is based on the 54 known structure of a highly related protein, frequently the homologous protein from another species of organism. The modelled structure is not immediately useful in assigning phase information to the diffraction intensities measured for the unknown protein, which represent the Fourier transform of the contents of the unknown protein's crystallographic unit cell. Therefore, what is required is that the search molecule be orientationally and translationally positioned with respect to the symmetry-related molecules in this unit cell. The search for this positioning is carried out in two stages. In the first stage, the rotation function is used to correctly orient the model. In this procedure, a set of intramolecular interatomic vectors is calculated for the search model. This set of vectors is then systematically rotated, in steps about three mutually orthogonal axes, and a comparison is made with a Patterson map calculated with the observed diffraction data. The comparison is usually restricted to short vectors (within a molecule's radius from the Patterson origin), in order that only intramolecular interatomic vectors in the observed vector set be included. The superposition of the modelled and observed sets of interatomic vectors will be maximal when the orientation of the search model coincides with that of one of the molecules in the unit cell of the unknown protein. Once the correct orientation of the search model has been thus defined, the translation function is used in the second stage to position the oriented model with respect to the symmetry elements present in the crystal unit cell. In this procedure, a symmetry axis is chosen, and the model is systematically translated to all the grid points on a plane perpendicular to the chosen axis. For each prospective positioning of the search molecule, the symmetry related molecule is generated, and then a set of intermolecular interatomic vectors is calculated and compared against the Patterson map. The correct location for the search model with respect to the symmetry axis can hopefully be identified as a point which gives rise to a high agreement between the observed and calculated interatomic vectors sets. If the positioning of the search model with respect to a different symmetry axis can be determined, from another two-dimensional search about this second axis, then the positioning of the search molecule within the unit cell is defined. The entire contents of the unit cell can then be generated by applying the crystallographic symmetry elements to the approximately oriented and positioned search molecule. 55 Finally, phases can be calculated for each of the experimentally observed structure factor amplitudes, and an initial electron density map computed. 5. Refinement That the true values of the phases of the diffraction intensities cannot be directly measured .Vi has several consequences. Most importantly, the phases as determined by calculation or by mdirect experimental means serve only as estimates for the true phases, and will undoubtedly contain substantial error. Removal of this error, while at the same time maximizing the accuracy of the atomic model, is the objective of structural refinement, the process by which the agreement between the proposed structure and the observed diffraction data is optimized. Refinement is necessarily an iterative process, in which indicated corrections are made to the proposed model and new structure factors (amplitudes and phases) having (hopefully) greater accuracy are calculated and then used to initiate another cycle. Because accurate structural information can be obtained only after extensive refinement, protein crystallographers expend a great deal of effort in refinement of their structures. Assessment of the agreement between the calculated and observed diffraction patterns is based on the structure factor amplitudes. The most commonly used index is the conventional R-factor, defined as R = E ||F0(hkl)| - F.(hkl)|| / E |F0(hkl)|. an •£ Ul bid A low R-factor implies that there is good agreement between the calculated phases and the true phases. Clearly, the R-factor will have a minimum value of 0 when the agreement between F 0 and F c is perfect Typically, well-refined protein structures have values below -0.20. Iterative examination of Fourier maps constitutes one strategy in structural refinement As an example, inspection of the initial map calculated with phases estimated using molecular replacement methods may indicate that corrections to the original model are required. The revised model can then be used to obtain improved estimates for the calculated phases, and another electron density map computed. This procedure is carried out repetitively, with the aim that the calculated phases will converge to the real phases. It should be noted that because the electron 56 density map is synthesized from observed intensities combined with phases calculated using the current proposed model, the features of these maps will be biased toward the original structure. In practice, manual adjustments to the model are interspersed with automated refinement procedures, which are used to speed up the refinement process and to increase the accuracy of the determined atomic positions. With these methods, the positional and temperature factor parameters of the atoms of the proposed structure are adjusted by least-squares analysis to minimize the overall discrepancy between calculated and observed structure factor amplitudes. Another effective tool in the refinement process is the difference Fourier map, which identifies features of electron density accounted for in one set of structure factors, but not in another. For structural refinement, it is useful to compare the observed and calculated structure factors according to the following equation: Lp(x,y,z) = S E E [F c (hkl) - F„(hkl) ] exp iccc(hkl) exp -27ri(hx + k y + lz). I (5) h— k— 1—. j I Positive peaks will occur in this map at the positions of previously unincluded atoms (e.g. solvent atoms). Wrongly positioned atoms in the model will appear within negative peaks, possibly adjacent to positive peaks indicating the correct positioning. Frequently, coefficients of the type 2F Q - F c are used to calculate maps that combine features of both the direct Fourier (FQ) and difference Fourier (F 0 - Fc) maps. When two homologous proteins have the identical (isomorphous) crystal form (e.g. yeast iso-1-cytochrome c and its variants), the phases of the two independent sets of diffraction intensities will in general be very similar. In this case, a difference map of the type Ap(x.y.z) = E S S [F(hkl)(native) - F(hkl)(variant)] exp ia c(hkl.native)-" " " " e x p -27ri(ha; + k y + lz). ( 6) can be used to identify conformational differences between the two proteins. Another important aspect of the structural refinement process is resolution. Resolution is the minimum distance between two groups which appear in the electron density map as having distinct or separate electron density peaks. The resolution of a structure is critically dependent on the completeness of the diffraction intensity data set used in the structural determination. Equation 3 shows the image of the electron density is synthesized from a Fourier series containing an 57 infinite number of terms. In practice, the series is truncated, partly because higher order terms are too weak to be measured (i.e. are beyond the diffraction limit of the crystal). A decrease in the quality of the electron density map accompanies a decrease in the number of reflections that contribute to the synthesis of the map. This problem is compounded by the fact that it is the high order terms which contain information on fine details. Furthermore, in least-squares structural refinement, the atomic parameters (x,y,z and B) are adjusted against the measured intensities. Inclusion of a greater number of reflections means that these parameters are determined by a greater number of observations. These considerations demonstrate that increasing the resolution allows for an increased accuracy in the determination of atomic positions. In general, the accuracy of a structural determination is very difficult to assess, but it must be emphasized that the level of uncertainity will be greater for structures determined at low resolution. 58 n. EXPERIMENTAL PROCEDURES USED IN STRUCTURAL ANALYSES A. Source of protein for crystallization experiments Wild-type yeast (Saccharomyces cerevisiae) iso-1-cytochrome c (Lot no. 33F-7260) was. purchased from Sigma Chemical Co. (St Louis). The protein as supplied is greater than 95% isozyme-1, as confirmed using denaturing SDS-polyacrylamide gel electrophoresis, and was used without further purification. For use, the dry protein was dissolved to a suitable concentration in buffer, and any insoluble material was removed by centrifugation. Iso-1-cytochrome c proteins possessing amino acid substitutions were obtained from yeast strains (GM-3C-2) that lacked functional iso-1- and iso-2-cytochrome c genes, and contained plasmids (YEpl3) bearing iso-1 genes encoding the mutated protein. Isolation of iso-1-cytochrome c from yeast cultures (typically 40 1) was performed essentially as described by Cutler et al. (1987). Briefly, cytochrome c was released from yeast cells by ethyl acetate extraction, and then purified by successive CM-cellulose and CM-Sepharose ion exchange, and Sephadex G-50 gel filtration chromatographies. The protein was concentrated and exchanged into the appropriate buffer by ultrafiltration, and stored in liquid nitrogen or in a -70° C freezer. B. Growth of crystals The initial screening that determined conditions suitable for the formation of wild-type iso-1-cytochrome c crystals has been described by Sherwood and Brayer (1985). A pH in the range 5.8 to 7.2, a final ammonium sulfate concentration of at least 88% saturation, and at least 20 mM DTT were required to effect crystal growth. In order that the parameters be established appropriate for the growth of large, single crystals of iso-1-cytochrome c, with minimal concomitant formation of microcrystalline and precipitated material, a large number of growth conditions were finely sampled, using the vapor diffusion technique in tissue culture plates (McPherson, 1982). The optimal conditions using this method were determined to be the equilibration of 5 ul of protein solution (25 mg/ml) containing 78% saturated (3.17 M) ammonium sulfate, 40 mM dithiothreitol, and 0.1 M sodium phosphate (adjusted to pH 6.2 using ammonium 59 hydroxide or acetic acid), against 1.0 ml of 92% saturated (3.74 M) ammonium sulfate in the same buffer. Although large crystals of iso-1-cytochrome c could be obtained using this hanging drop procedure, trials set up under these conditions often did not yield crystals, due apparently to the absence of nucleation sites. For this reason, free interface diffusion (Salemme, 1972), in which the formation of crystal nuclei is favored by the protein initially experiencing a supersaturating concentration of precipitant, was attempted and found to be the most reliable method for producing the large crystals required for collection of high resolution data. Crystallization conditions were selected based on the optimized conditions determined using the vapor diffusion method. The final ammonium sulfate concentration (90%) was chosen to be slightly lower than the 92% used in the vapor diffusion experiments, in which a slightly higher precipitant concentration is required to promote crystal nucleation. This lower final concentration would be expected to favor slower crystal growth and less loss of protein through precipitate formation. A typical trial, carried out in a melting point capillary (1.5 mm inner diameter), involved the layering of 5 /ul of a concentrated protein solution (-200 mg/ml) in a buffer containing 0.1 M sodium phosphate (pH 6.2) and 40 mM dithiothreitol, on top of 45 M1 of 100% saturated (4.06 M) ammonium sulfate in the same buffer. A fair amount of turbidity formed initially at the interface between the protein and saturated ammonium sulfate solutions. The resultant precipitate would then sink into the column of ammonium sulfate. But as the two solutions mixed, and the concentration of precipitant in the ammonium sulfate phase decreased, much of the precipitate was observed to redissolve. Crystal growth initiated at nuclei that had formed within the initial precipitate, and generally occurred at the original interface or along the trail made by this precipitate as it fell into the column of ammonium sulfate. Crystals grew to a maximal size of 0.9 x 0.6 x 0.5 mm in about two weeks. At the end of this period, the solution had become completely clear (the initial protein solution was bright red), with all the protein incorporated into the crystals present In general, very little precipitate remained. 60 The iso-1-cytochrome c proteins containing amino acid substitutions proved to be much less cooperative in forming large, single crystals. Both the hanging drop and free interface diffusion methods, employing similar conditions to those used to grow wild-type iso-1-cytochrome c crystals, could effect crystallization of the variant proteins. However, during the early stages of most crystallization trials, much of the protein fell out of solution in the form of brown, denatured protein precipitate or fine, needle-shaped aggregates, instead of becoming incorporated into crystal nuclei. This problem could be alleviated to some degree using the hair-seeding technique developed by Leung et cd. (1989). In this method, a well-formed crystal of wild-type iso-1-cytochrome c is crushed in a buffered solution of ammonium sulfate. The tip of a human hair is immersed in this seeding solution, and then passed through a droplet of protein solution containing the variant iso-1-cytochrome c. Precipitate formation is reduced, as this process must compete with the incorporation of protein into the seeded crystal nuclei. The difficulty with this procedure is in introducing only a small number of initiation sites for crystal growth. As was frequently the case, the presence of numerous nucleation sites gave rise to a shower of small, but well-formed, crystals. Thus, in general, only small crystals of the variant iso-1-cytochrome c proteins could be obtained. This limited the resolution at which the mutant structures could be determined. The exact growth conditions and the sizes of the crystals employed in the studies discussed herein are summarized in Table ILL It is notable that in contrast to Cysl02-containing iso-1-cytochrome c proteins, the Gly82 variant in which Cysl02 was replaced by Thrl02 was well-behaved in the absence of highly reducing conditions. The optimal growth of crystals of this variant was obtained in solutions that contained no dithiothreitol. C. Characterization of the crystals 1. Oxidation state of crystalline iso-1-cytochrome c Crystals grown in the presence of a high concentration of reducing agent (40 mM dithiothreitol) would be expected to contain cytochrome c protein in which the heme iron is in the reduced (Fe2+) state. This was verified, as a crystal of wild-type iso-1-cytochrome c dissolved in Table HI . Growth conditions, sizes and unit cell dimensions of crystals of wild-type and variant iso-1-cytochromes c Protein Crystallization method and conditions3 Crystal Unit cell crystal size (mm) dimensions (A) a (=b) c Wild-type (Cysl02) B C D E F G Ser82(Cysl02) Gly82(Cysl02) Gly82(Thrl02) B C Tyr82(Thrl02) Ile82(Thrl02) Ala38(Thrl02) HD } Final A.S. 92%, 45mM DTT. pH 6.3 HD. Final A.S. 92%. 45mM DTT, 0.2 M NaCl, pH 6.0 FED 1 FID > Final A.S. 90%, 40mM DTT, pH 6.2 FID J FID. Final A.S. 90%, 40mM DTT, pH 6.2 FID. Final A.S. 90%, 45mM DTT, pH 6.2 HD S "1 HTJSJ F i n a l 9 2 % - 0 m M D T T ' P H 6 -° HD!S. Final A.S. 90%, 20mM DTT, pH 6.0 HD.S. Final A.S. 90%, 20mM DTT, 0.15 M NaCl, pH 5.4 HD,S. Final A.S. 90%, 20mM DTT, pH 6.0 36.46 136.86b 0.6x0.4x0.4 0.8x0.5x0.5 0.7x0.5x0.4 0.8x0.6x0.5 0.8x0.6x0.5 0.9x0.7x0.5 0.3x0.3x0.2 36.45 136.48 0.3x0.3x0.1 36.45 136.57 36.48 137.20b 0.5x0.3x0.2 0.5x0.4x0.3 0.5x0.4x0.1 36.43 136.67 0.5x0.4x0.2 36.48 136.79 0.3x0.2x0.1 36.44 136.84 a H D : hanging drop; FTD: free interface diffusion; S: seeded. All crystallization trials used sodium phosphate buffer (0.1 M) and were conducted at room temperature. Final A.S. refers to the Final ammonium sulfate concentration, in per cent saturation (100% = 4.06 M). b Averaged over all crystals used of this protein. phosphate buffer yielded a visible absorption spectrum typical of that for reduced cytochrome c. Crystals of the Gly82(Thrl02) variant of iso-1-cytochrome c were grown in the absence of dithiothreitol. . Spectroscopic measurements showed that this protein was crystallized in its oxidized form. 2. Treatment of crystals prior to X-ray analysis A curious observation was that after 1-2 months, wild-type iso-1-cytochrome c crystals left undisturbed in their original hanging drops became internally disordered and lost their ability 62 to diffract X-rays, despite exhibiting no altered morphological characteristics. Because it was felt that decomposition of the reducing agent may be a factor in the crystal disordering, prior to their analysis using X-ray diffraction, crystals were treated in the following manner. The crystal was removed from the vessel in which it was originally grown and immersed in ~100 ul of freshly prepared mother liquor contained in a depression plate. The mother liquor was identical in composition to that used to grow the crystal, except for an ammonium sulfate concentration greater by -0.16 M (4% saturation). The slightly higher ammonium sulfate concentration was used to stabilize the crystal during subsequent manipulation during mounting. In the mounting procedure, a crystal was drawn into a thin-walled glass capillary having a diameter (0.7 or 1.0 mm) just large enough to accommodate the crystal. In order that crystal slippage and X-ray scattering by excess fluid surrounding the crystal be minimized, the crystal was then dried as thoroughly as possible using a finely-drawn out glass capillary and strips of filter paper. Finally, a short column of mother liquor was introduced at each end of the mounting capillary, which was then sealed with wax. 3. Space group and external morphology of the crystals X-ray precession photographs of wild-type iso-1-cytochrome c crystals are shown in Figure II.l. Based on the 4-fold symmetry of the hkO layer of the diffraction pattern, and on the systematic absence of axial reflections with h,k ^ 2n, and 1 ^ 4n, the space group of the crystals was assigned to be P432i2, or its enantiomorph PA^l. Unit cell parameters were initially determined from precession photographs. They were later more accurately determined, from diffractometer settings of 25 strong reflections with 20.7° < 26 < 32.3°, to be c= 6=36.46(5) A, and c= 136.86(12) A (standard deviations in parentheses). The unit cell dimensions observed and the crystallographic symmetry present indicated that only one iso-1-cytochrome c molecule occurs in the asymmetric unit (Matthews, 1968). In all cases, whether or not seeding with wild-type iso-1-cytochrome c crystals was performed, crystals of the variant iso-1-cytochromes c were isomorphous with those of the wild-type protein (see Table ILL). 63 Figure ILL Precession photographs from crystals of wild-type yeast iso-1-cytochrome c. (Top) The hkO zone of the reciprocal lattice. Evident is the four-fold symmetry about an axis perpendicular to the plane of the photograph and passing through the origin of the layer. The a* and b* axes run horizontally and vertically. Axial reflections having h (or k) odd are systematically absent The outermost spots on this photograph correspond to a resolution of 2.98 X. The photograph was taken with a precession angle (u) of 15° and an exposure time of 20 hours. (Bottom) The hOl zone of the reciprocal lattice. The a* axis runs horizontally, and the c* axis vertically. The systematic absence of reflections with l*4n is evident along the c* axis. The outermost spots on this photograph correspond to a resolution of 2.25 X. The photograph was taken with M =20° and an exposure time of 12 hours. For both photographs, the crystal-to-film distance was 75mm, and CuKa radiation (X = 1.5418 X) was used, with power to the X-ray tube of 26mA, 40kV. 6^  Crystals of reduced iso-1-cytochrome c have a deep orange-red color and a tetragonal bipyramidal shape (Figure II.2). As determined from precession photography, the orientation of the reciprocal lattice with respect to the external morphology of the crystals is as follows: the a and b crystallographic unit cell axes make a 45° angle with the equatorial edges of the tetragonal bipyramid, while the c axis is perpendicular to the equatorial plane. Thus, the c axis runs parallel to the external 4-fold symmetry axis of the crystal. D. Collection of X-ray diffraction data All reflection data were collected on an Enraf- Nonius CAD4F11 diffractometer having a crystal-to-detector distance of 368 mm, and a helium-purged path for the diffracted beam. The incident radiation was nickel-filtered CuKa, produced from a fine focus (0.75 x 15.0 mm) X-ray Figure EL2. Photomicrograph of a crystal of wild-type yeast iso-1-cytochrome c. The solution surrounding the deep red crystal is the mother liquor from the hanging drop within which the crystal was grown. The ajb axis of the crystal runs between the pointed ends of the crystal, whereas the c axis runs perpendicular to this axis and within the plane of the photograph. The maximum dimension of the crystal shown is -0.9 mm. 65 tube operated at 26 mA, 40 kV. All data collections were carried out at an ambient temperature of 15°C. The strategy for data collection, chosen to maximize the amount of data that could be collected from any one crystal, employed fairly narrow scan widths, coupled with relatively slow scan speeds. Typically, continuous 0.5-0.6° omega scans at a speed of 0.55°/min were used. Normally for a given crystal, data were collected in spherical shells, beginning with the highest resolution shell. Background counts for each reflection were measured using scans 1/6 of the total scan width on either side of the reflection peak. Crystal decay and slippage were monitored by measuring at approximately 2.5 hour intervals the intensities of three strong standard reflections. Yeast iso-1-cytochrome c crystals were fairly resistant to radiation damage; the typical decay experienced by a crystal during data collection (generally T1000 reflections, 3 weeks) was about 35%, based on intensity control reflections. E. Data processing The general procedures used to process diffraction intensity measurements into structure factor amplitudes are described here; specific details pertaining to individual data sets are given in later sections. Correction for background, absorption, crystal decay, Lorentz and polarization effects were applied to each set of diffraction intensities. For most data sets, background corrections simply involved, for each individual reflection, the subtraction of the measured background counts from the counts for the peak. Some sets were processed using an alternative handling of backgrounds, in which for each individual reflection, the background correction applied was based on an average of measured backgrounds for neighboring reflections in reciprocal space. The gains yielded by this method are that the merging statistics for multiply measured reflections are significantly improved and the number of negative net intensities is reduced, and were most evident for data sets containing many weak intensities. Treatment of absorption effects employed the empirical method of North et al. (1967), in which a phi-dependent correction factor for each reflection is obtained from an averaged absorption curve generated from measurements made every 5° on two strong phi-independent reflections. Corrections for crystal decay were applied based on 66 an interpolated curve generated from the decay profiles of the standard reflections. Each set of structure factors was placed on an absolute scale, on the basis of one of two methods. For strongly diffracting crystals from which data had been collected over a large range of theta, Thiessen and Levy's implementation of Wilson's statistical method (Thiessen and Levy, 1973; Wilson, 1942) was used to derive an estimate for the scale factor. For data sets collected from more weakly diffracting crystals, the Wilson method was found to yield unreliable results. For these data sets the scale factor was obtained by performing a linear rescale, based on F Q , against the common reflections in a set of merged, scaled structure factors measured from three crystals of wild-type iso-1-cytochrome c. F. Structure solution of iso-1-cytochrome c using molecular replacement methods 1. Construction of a search model for yeast iso-1-cytochrome c For use as a search model in the molecular replacement method, a three-dimensional atomic model of yeast iso-1-cytochrome c was constructed based on the known tertiary structures of tuna and rice cytochromes c. The initial step in model construction was the incorporation from tuna ferrocytochrome c of atoms of the polypeptide backbone, of the heme group, and of amino acid side chains of residues (63 in total) conserved in the primary structures of tuna and yeast iso-1-cytochromes c. Then, for amino acid residues (40 in total) with non-identical side chains, the appropriate yeast side chains were appended via a least-squares fitting procedure (R.J. Read, unpublished)" based on the positions of the N, CA, and C atoms. The conformation of each new yeast iso-1-cytochrome c side chain was modelled, where possible, by maintaining the torsion angles of the original tuna side chain. The homologous residues of rice cytochrome c were used to model the first five N-terminal residues of yeast iso-1-cytochrome c, which are absent in the tuna protein. These residues were approximately positioned in the yeast iso-1-cytochrome c model structure through the least-squares superposition of the alpha-carbon backbones of tuna and rice cytochromes c. In order that incorrect bond distances and unfavorable interatomic contacts be removed, the atomic model for yeast iso-1-cytochrome c derived to this point was subjected to eight cycles of structural idealization (Hendrickson, 1985). 67 2. Rotation function search The set of molecular replacement programs used in these studies was an early version of the MERLOT program package developed by P. Fitzgerald (1988) which was adapted for use on the University of British Columbia Amdahl 5850 computer. The preliminary model constructed for yeast iso-1-cytochrome c was oriented, with respect to the crystal axis directions of the unit cell, using Crowther's fast rotation function (Crowther, 1973). Structure factors for the model were calculated with the yeast iso-1-cytochrome c coordinates centred at the origin of a triclinic unit cell with orthogonal cell axes 70 X in length. The overall temperature factor for the model was assumed to be 15 X 2 . An F > 3op criterion was applied in the selection of reflections used from the measured diffraction data set The Patterson search of the asymmetric volume of rotation space (0 < a < 90°, 0 < 0 < 90°, 0 < 7 < 360°) was carried out using 1.25° steps in a, and 5° steps in 0 and 7. The search radius about the Patterson origin was limited to 20 X, and origin removal was applied. Several different resolution ranges were used in the selection of the structure factors to be included in the calculation of the rotation function. Finer scans, employing 1° steps in a, |3, and 7, about possible orientations as located by the coarse rotation function, were subsequently conducted using a program written by E.E. Lattman. 3. Searches for the translational positioning of the model for yeast iso-1-cytochrome c a. Translation function search The translation function of Crowther and Blow (1967) was utilized in initial attempts to determine the translational positioning of the oriented model of yeast iso-1-cytochrome c within the crystallographic unit cell. Searches were calculated on a 0.75 X 0.75 X grid for each of five independent Harker sections, using 946 reflections with F > 3op in the resolution range 10 to 4.0 X. In addition, when the search was for the set of intermolecular vectors between two molecules having relative positions dependent on the space group enanuomorph, both of the possible Harker sections were calculated. For example, if molecule 2 is related to molecule 1 by a counterclockwise rotation of 90° about the positive z axis, then the set of intermolecular vectors from molecule 1 to molecule 2 appears most strongly on section w=l/4 for space group P4A2, 68 and on section w=3/4 for space group P432i2. In this case, both w=l/4 and w=3/4 Harker sections were calculated. b. Packing analysis The symmetry elements present in the crystallographic unit cell severely restrict the positioning of molecules within the cell. For instance, a molecule cannot be situated such that its centre is very near a two-fold rotation axis in the crystal if interpenetration by the molecule related to it by this rotation axis is to be avoided. A crystal packing analysis, based on that described by Bott and Sarma (1976), was used to define the regions in the crystallographic unit cell capable of accommodating the oriented, modelled molecule of yeast iso-1-cytochrome c. In this procedure, a skeleton consisting of the a-carbons of the 81 residues located at the surface of the molecule, as determined using the method of Connolly (1983), was oriented from the results of the rotation function analysis. This atomic skeleton was systematically translated in 1 X steps through the region of the unit cell (0 < x <, 1/2, 0 < y < I, 0 < z < 1/2), and at each position the immediately adjacent, symmetry-related skeletal molecules were generated and the number of close (5 A or less) intermolecular contacts was calculated. In order that computing time be reduced, contact calculations were not initiated at a given position if two symmetry-related molecules were found to interpenetrate (i.e. if the centres of these two molecules were closer than 25 X, the estimated miniumum diameter for yeast iso-1-cytochrome c), and calculations at a given position were terminated once 15 close contacts had accumulated. The packing analysis was carried out in both enantiomorphic space groups. c. Correlation coefficient searches Those regions of the unit cell defined as permissible by the packing analysis were then searched for the translational positioning of the oriented model for yeast iso-1-cytochrome c which would yield the greatest agreement between calculated and observed structure factors. This agreement was measured using the following correlation coefficient: 69 Z [(FQ-FQ) • (Fc-Fc)J [L(F 0 -F 0 ) ' • Z(F C-F C) 2]^ J ' where F 0 is an observed structure factor magnitude, F c is the magnitude of the corresponding structure factor calculated for the positioned model for yeast iso-1-cytochrome c (all atoms), and F Q and F c are the respective average values over the reflections used in the calculation. The value of the correlation coefficient obtained is independent of the relative scales of the observed and calculated structure factor magnitudes, thereby eliminating potential scaling errors. The searches were carried out in both enantiomorphic space groups, and usually on a 1 X grid. At each point, the correlation coefficient was calculated for the 416 reflections with F > 3a p in the resolution range 10 to 5.0 X. The computer program used to perform this analysis was written by Dr. W. Hutcheon. 4. Rigid body refinement of orientational and translational positioning The orientational and translational positioning of the preliminary model for yeast iso-1-cytochrome c, as determined by the rotation function, packing analysis and correlation coefficient searches, was refined using a rigid body procedure (Ward et al^ 1976). The three rotational and three translational parameters were adjusted so as to nunimize the conventional crystallographic R-factor. For each cycle of refinement, each parameter in turn was offset by a small increment (initially, offsets of +/- 0.5° for rotations, and +/- 0.5 X for translations were used), while the other parameters held their original values. The R-factor, for the 581 reflections with F > 3ap in the resolution range 10 to 4.5 X, was calculated for the positioned model after each adjustment At the start of the next cycle, each parameter was assigned its value that gave the lowest R-factor during the previous cycle. The size of the increments for each of the parameters was decreased as the analysis proceeded, and the refinement was concluded when no further reduction in R-factor could be obtained. 70 G. Structure refinement procedures The stereochemically restrained least-squares method of Hendrickson and Konnert (1981) was used to refine the structures of yeast iso-1-cytochrome c. This method adjusts the atomic parameters of the model to improve both the agreement between observed and calculated structure factor magnitudes, and the accordance of bonded and non-bonded interatomic distances present with those occurring in small-molecule structures. Stereochemical restraints were applied to: covalent bond lengths, bond angles, planarity (of amide, carboxyl and guanidiniuhi groups, and aromatic rings), chirality at asymmetric carbon atoms, non-bonded interatomic contacts, hydrogen bond distances, conformational torsion angles, and similarity in temperature factors of covalently bonded atoms. For all refinements, data of lower resolution than 6 X were excluded, as these are most severely affected by disordered solvent (Schoenborn, 1988). In addition, a criterion of either F > 2ap or F > 3op was used in the selection of reflections to be included. Most of the refinement cycles were computed on an IRIS 3030 workstation, although some of the early refinement cycles for the wild-type iso-1-cytochrome c structure were performed on the Amdahl 5850. The same general strategy was used in the refinements of all structures. The emphasis placed by the refinement program on both stereochemical ideality and agreement between observed and calculated structure factors can be varied. Typically, fairly tight weightings on ideal geometry (see Table II.2) were maintained throughout the course of the refinements. In some cases after the atomic model had been adjusted manually, restraint weightings on bond distances were loosened slightly, and then subsequently tightened after two or three cycles. The weighting on structure factors was maintained at 1/2 to 1/3 the overall average discrepancy between F 0 and F c . All atoms in the atomic models, including those belonging to solvent molecules, were refined with full occupancies. Progress in the refinement, in terms of the drop in R-factor and the magnitude of positional shifts yielded, declines markedly after about five consecutive cycles, and thus usually refinement was interrupted after not more than eight cycles so that the model could be examined in electron density maps. 71 Table H.2. Typical weighting on stereochemical ideality used in restrained least-squares refinement of iso-1-cytochrome c structures Stereochemical restraint type Refinement weighting used 1-2 bond distance 0.020 A 1-3 angle distance 0.030 X 1-4 planar distance 0.050 X 1-2 bond involving hydrogen atom3 0.012 X 1-3 bond involving hydrogen atom 0.027 X Planar 0.020 X Chiral centre 0.150 X 3 Non-bonded contact" single torsion 0.250 X multiple torsion 0.250 X possible hydrogen bond 0.250 X Staggered (±60°, 180°) torsion angle 19.0° Planar torsion angle (0 or 180°) 3.0° Temperature factor 1-2 bond (main chain) 1.20 X 2 1-3 angle (main chain) 1.50 X 2 1-2 bond (side chain) 1.70 X 2 1-3 angle (side chain) 2.00 X 2 1-2 bond involving hydrogen atom 3.00 X 2 1-3 bond involving hydrogen atom 5.00 X 2 aThe restraints involving hydrogen atoms apply only to the refinement of the wild-type iso-1-cytochrome c structure. ^This class of restraint incorporates a reduction of 0.1 X from the radius of each atom involved in a contact * . • H. Electron density maps 1 Map inspection When necessary, manual adjustments to the atomic models were made through inspection of difference electron density maps. Electron density maps were computed using the programs of the ROCKS system (Reeke, 1984), or the fast Fourier program FSFOR written by W. Furey and adapted to the IRIS 3030 by A. Berghuis. The coefficients used were of the type (2F0-FC, ac), (FQ-FC, a c), and (F 0 -F c \ ac') where F c ' and a c ' represent structure factors and phases calculated 72 without the inclusion of the portion (up to 9%) of the atomic model to be examined. Map interpretation was assisted by the use of the program FRODO (Jones, 1978), which displays a superposition of the atomic skeleton on envelopes indicating the spatial distribution of electron density. The version of FRODO used was adapted to the IRIS 3030 by S.J. Oatley, and was further modified by S.A. Evans. 2. Modelling of solvent structure Water molecules were introduced into significant peaks of otherwise unoccupied electron density observed in 2 F 0 - F C or F Q - F C maps, and only at positions where the new water molecule could form hydrogen bonds with protein atoms or other (previously identified) water molecules. The authenticity and positioning of all water molecules were monitored throughout the course of refinement, using 2 F 0 - F C and F 0 - F c ' maps. In the latter case, water molecules were deleted from the atomic model, and were retained in the refinement only if electron density peaks subsequently appeared at the sites they originally occupied. 3. Preliminary difference maps in the analysis of variant yeast iso-1-cytochromes c The first step in the structural analysis of a variant iso-1-cytochrome c was the inspection of difference electron density maps. A map with the coefficients FQ(wild-type) minus FQ( variant) and phases calculated for the wild-type structure was used initially to locate significant structural differences between the wild-type and variant iso-1-cytochromes c. For the calculation of these maps, it was found that unless the input reflections were carefully selected so as to include only those having significant intensity differences, the resultant maps contained appreciable noise and were difficult to interpret When comparing diffraction intensities measured from crystals of wild-type iso-1-cytochrome c with those measured from crystals of the variant proteins a problem occurs for reflections which are observed in only one of the two data sets: it is uncertain whether the observed intensity difference arises from structural differences between the two iso-1-cytochromes c, or is due to errors in intensity measurement A primary consideration in this respect is that the crystals used of the variant iso-1-cytochromes c diffracted more weakly, 73 resulting in a greater number of weak intensities and also in greater uncertainty in the measured intensities in the variant data sets. The strategy chosen in an effort to accommodate these problems was to include in the calculation of the difference map only those reflections which met one of the following conditions: the reflection was observed (F > 3op for the variant, and F > 2ffp for the wild-type data set) in both data sets; or the reflection was unobserved in one data set, but fairly strong (F > 3a p in the variant, and F > 6op for the wild-type data set) in the other. Usually, regions of the iso-1-cytochrome c molecule identified by the FQ(wild-type)-F0(variant) map as being perturbed structurally were subsequently examined in a 2FQ(variant)-Fc' map. In this latter map, the region of interest is excluded from the calculation of structure factor magnitudes and phases, thus minimizing the bias toward the conformation of this region present in the wild-type structure. I. Inclusion of hydrogen atoms Hydrogen atoms were refined in the atomic model of wild-type iso-1-cytochrome c. They were included at a point in the refinement when it was judged that for many hydrogen atoms, particularly those on main chain amide nitrogens and well-ordered aliphatic and aromatic carbons, electron density was visible on 2F Q -F C maps as small bulges protruding from the density belonging to their heavier parent atoms. It was thus felt that inclusion of hydrogens in the refinement model would improve both the bonding geometry and thermal parameter values of the heavy atoms, and the agreement between calculated and observed structure factors. Hydrogen atoms were initially introduced into the iso-1-cytochrome c structure in ideal X-ray positions using the program HAFFIX (Honzatko et al., 1985), and were assigned a temperature factor of 1.3 times that of the parent heavy atom. Hydrogens having ambiguous positions, such as those on hydroxyl groups, were positioned manually so as to form reasonable hydrogen bonds. Water molecules were left as neutral oxygen atoms. During structure refinement, separate restraint weighting was maintained for bonding geometry and thermal parameters involving hydrogen atoms (Wlodawer and Hendrickson, 1983) (see Table II.2). Tight restraints were applied to bonding geometry, so that hydrogen atoms would be tightly coupled to their parent atoms. The 74 thermal parameters of hydrogen atoms were not as tightly restrained, but in most cases showed no tendency to assume values greatly different from those of their parent atoms. The torsion angles of rotor methyl carbons and amine nitrogens were not restrained. J. Comparison of cytochrome c structures Tuna [both reduced (1.5 X) and oxidized (1.8 X)] (Takano and Dickerson, 1981a,b) and rice (1.5 X) cytochromes c (Ochi et al., 1983) are determined to resolutions comparable to that of yeast iso-1-cytochrome c (wild-type). Coordinates for these other cytochromes c, entries 4CYT, 3CYT and 1CCR respectively, were obtained from the Protein Data Bank (Bernstein et al., 1977). The direct structural comparison of the various species of cytochrome c required that these other cytochromes c be superposed on yeast iso-1-cytochrome c. This was carried out by using an iterative least-squares procedure to determine for each cytochrome c, the rotation and translation to be applied in order to minimize the positional difference between corresponding main chain atoms (residues 1 to 103 only) of yeast iso-1- and this other cytochrome c. The rotation matrices and translation vectors used are listed in Table II.3. Because the variant iso-1-cytochromes c were crystallized isomorphously with wild-type isoT-cytochrome c, direct structural comparisons of the variant and wild-type proteins did not require this preliminary superposition. Since the structure of yeast iso-1-cytochrome c is in the reduced state, most of the comparisons pertaining to the tuna molecule discussed herein refer to tuna ferrocytochrome c. Specific. instances where comparisons are made with tuna ferricytochrome c are indicated. 75 Table BL3. Rotation matrices and translation vectors applied for structural superposition of tuna and rice cytochromes c onto yeast iso-1-cytochrome c Rotation matrix a. Tuna (reduced) 0.27945 0.38538 -0.70389 -0.54071 . 0.65303 -0.74774 b. Rice (oxidized) -0.67668 -0.00102 0.58991 0.59763 0.44057 -0.80177 c. Tuna (oxidized, outer molecule) 0.55471 -0.18403 0.68101 0.66073 _-0.47805 0.72771 d. Tuna (oxidized, inner molecule) -0.05221 -0.59576 -0.87437 -0.36044 -0.48244 0.71774 Translation vector 0.87943 0.46062 0.12016. -7.79118 12.86195 . -7.61227. -0.73628" -0.54299 -0.40380. 22.80440* 22.47183 . 35.40532. 0.81144" -0.31569 0.49184. "-20.39990" 15.07751 . 10.90701. -0.80146" 0.32489 -0.50210 18.20815" 55.23132 10.77491 The application of the rotation matrix and vector which superposes the atomic coordinates ( X Q J Q ^ J J ) of tuna or rice cytochrome c onto those of yeast iso-1-cytochrome c is as follows: Rotation matrix xo V 4 y0 + e = c 76 m. THE STRUCTURE OF WELD-TYPE YEAST ISO-1 - CYTOCHROME c A. Details of the structure solution 1. X-ray diffraction data Diffraction data to 1.23 X resolution for wild-type iso-1-cytochrome c were collected from six crystals (see Table II.l), as detailed in Table III.1. Background averaging was used in the processing of all diffraction data beyond 2.0 X resolution. The data sets B, C, and F were placed on an absolute scale using the method of Wilson (1942) (Thiessen and Levy, 1973). The Table DX1. Crystals of wild-type iso-1-cytochrome c used in data collection to 1.23 X resolution Data Resolution Number of reflections3 Scale Merging R c Scaling R d set range (X) •. factor"3 (on I)(%) (on F) (%) measured unique B 20 - 2.5 11568 6860 14.91 2.7 -C 20 - 1.7 11530 10940 8.25 2.2 -D 1.75 - 1.50 6101 5831 9.11 1.1 4.6 E 1.75 - 1.40 11114 10486 7.85 1.5 5.2 F 20 - 2.00 12079 6812 7.89 4.1 -G 1.50 - 1.23 14532 13868 8.32 2.8 5.6 aThe unique region of reciprocal space is 1/16 of the sphere. The volume normally collected was h: 0 —> °°, k: 0 —> h, 1: 0 —> » . For crystal B, both hkl and khl were measured, and for crystal F both hkl and -h,-k,-l. hhe scale factors given are the multiplicative factors which place the structure factors in each individual data set on an absolute scale. E E | Ii(hkl) - I(hkl) | cThe merging R is defined as — . S E I;(hkl) hkl i-1 The calculation of the merging R includes all reflections measured more than once (i.e, duplicates, symmetry mates and Friedel mates) and for data sets with a small amount of replicated data (sets C, D, E and G) is dominated by the measurement of intensity control reflections. ^The scaling R is calculated including only those reflections in the two-dimensional zone (hkO or hOl) used in the linear rescale against the same set of merged reflections from Crystals B, C and F. The definition of the scaling R is the same as that for the merging R, except F is used in place of I. 77 remaining data sets were placed on the same scale by performing a linear rescale against a set of merged data from crystals B, C and F, using as a basis a two-dimensional zone of structure factors from 20 to 2.0 X (hOl, 955 reflections, for data sets E and G; or hkO, 135 reflections, for set D) that was measured from all crystals. Data sets B and C were used in the molecular replacement analyses. For use in high resolution refinement, a complete data set to 1.23 X was obtained by merging the six independent sets of structure factors, as outlined in Table 111.2. The majority of the data from 20 to 1.4 X has been measured from at least two separate crystals. The fairly high merging R-factors for data of greater resolution than 1.7 X are typical of high resolution analyses (Karplus and Schulz, 1987) and are indicative of the overall weaker intensity of high resolution Table ITJ.2. Summary of merging of data sets for wild-type iso-1-cytochrome c Resolution Crystals Independent Unique Merging R a range (X) used measurements reflections (on F) (%) 20 - 2.50 B, C, F 10633 3602 4.7 2.50 - 2.00 C, F 6423 3215 9.3 2.00 - 1.75b C,D,E,G 3845 3204 22.8 1.75 - 1.70 C, D, E 2629 890 21.5 1.70 - 1.50 D, E 9502 4751 15.1c 1.50 - 1.40 E, G 6766 3383 20.7C 1.40 - 1.23 G 8741 8741 6.00 - 1.23 All 48539 27786 8.1 aThe definition of this merging R is the same as that given in the footnotes to Table III.l. In each specified resolution range, the merging R value calculated includes reflections which have been measured from more than one crystal. bIn this resolution range, only hkO (C and D) or hOl (C, E and G) reflections had measurements from more than one crystal. cThe calculated merging R value for these shells includes only those replicately measured reflections for which F & v e ^ 3a p 78 reflections. 2. Structure solution using molecular replacement a. Rotation function Several trials of the rotation function, using various resolution limits in the selection of diffraction data to be included in the calculation, were performed in attempts to determine the orientation of the model of yeast iso-1-cytochrome c. In retrospect, it is evident that as higher resolution data were included, the rotation function solution obtained more closely approached the optimal orientation (see Table 111.3), although in all trials, the strongest peak corresponded to the correct solution. For the Crowther fast rotation function, the discrimination of the correct solution from both background and false peaks also improved with the inclusion of higher resolution data. It was based on this consideration that the orientation chosen for use in further molecular replacement searches was the result of trial D (a = 28.2°, j3 = 83.9°, 7 = 228.5°). Table IEL3. Summary of results of the rotation function searches for yeast iso-1-cytochrome c Rotation function Resolution limits (A) Model a 7 Peak height3 (0) Next highest peak3 (a) A Coarse 10.0 - 5.0 32 83.6 217.3 4.4 3.8 Fine 10.0 - 4.5 31 85 227 B Coarse 25.0 - 4.0 ^ all 30 85 230 5.0 4.2 Fine 25.0 - 4.0 atoms 30.6 86.5 226.5 C Coarse 10.0 - 4.0 29.6 83.2 225.2 6.0 4.5 Fine 10.0 - 3.5 - 29.6 84 227.8 D Coarse. , 10.0 - 2.9 752 28.8 82.9 228 7.4 5.6 Fine 10.0 - 3.1 atoms 28.2 83.9 228.5 Optimal orientation and 27.1 84.2 229.0 translational positioning0 x= 0.115 y= 0.545 z=0.0584 aPeak heights are given as multiples of the r.m.s. background level. h^e optimal orientation and translational positioning are taken to be those determined using rigid body refinement (see Section III.A.2.c). 79 That the performance of the rotation function improved with the inclusion of higher resolution diffraction data is in accord with the high degree of similarity between the structure of the search model used and that of the actual yeast iso-1-cytochrome c molecule. In contrast, inclusion of high resolution data has been found to affect adversely the accuracy of the rotation function in cases where the search model bears lesser structural homology to the actual molecule (Read and James, 1988). An additional factor in trial D yielding the best results may be that an edited search model was used in this run. The editing procedure removed portions of the search model having positions which may have been poorly predicted in the model-building process (atoms beyond CB of side chains of residues with high sequence variability within eukaryotic cytochromes c, and of lysine and glutamate side chains which projected into the solvent medium) and left 752 of the original 890 atoms. b. Translational Searches The use of the translation function of Crowther and Blow was unsuccessful in determining the translational positioning of the oriented model of yeast iso-1-cytochrome c. The most serious problems encountered were the low signal-to-noise ratio and the large number of peaks observed. Typically, the strongest peaks were only 2 to 3 times the r.m.s. background level and were only marginally higher than the next largest peak. A subsequent re-examination of the translation function maps, after the correct translational positioning had been determined, revealed that one search, involving the molecules at (x, y, z) and at (-x, -y, 1/2 + z), had actually yielded the correct solution as the strongest peak. However, no pair of translation function searches on individual Harker sections yielded a consistent value for any of the components of the translational positioning vector. On the other maps, the correct solution was found to correspond to the 5th, 6th or 7th largest peaks. A possible reason for the failure of the translation function is the relatively inaccurate orientational parameters used (a = 30.6°, 0 =86.5°, 7=226.5°) . A packing analysis was used to define the regions of the unit cell in which the oriented model of yeast iso-1-cytochrome c could be positioned without conflicting with neighboring molecules generated by the crystallographic symmetry elements. This analysis located 7 distinct 80 regions (for each of the possible enantiomorphic space groups) at which fewer than 6 intermolecular contacts would occur. [For example, for the space group P432i2, these regions are: (0.0823±0.0549, 0.521± 0.027, 0.051110.0219); (0.480± 0.014, 0.974± 0.014, 0.0438 ±0.0146); (0.0, 0.5, 0.161 ±0.0146); along the line joining the points x=0.0, y=0.5 and x=0.5, y=0.0, with z=0.263±0.0146; (0.480± 0.014, 0.041± 0.014, 0.321+ 0.0146); (0.027± 0.014, 0.562± 0.014, 0.438±0.0292); and (0.5, 0.027 ± 0.014, 0.431 ±0.0219).] It is of note that this packing analysis was very restrictive in defining the molecular positioning consistent with the occupation of the observed crystallographic unit cell by eight iso-1-cytochrome c molecules: of 24605 grid points examined, only 306 (1.2%) were identified as being suitable positions for the centre of the yeast iso-1-cytochrome c model. Whereas this analysis restricted subsequent translational searches to 1.2% of the total search volume of the unit cell, a value of 13% was yielded by a simpler packing function that minimizes the interpenetration of solid sphere representations of the molecule (Hendrickson and Ward, 1976). The translational positioning identified as being allowable based on packing can be understood upon considering the crystallographic symmetry elements present and the relative dimensions of the unit cell and of the cytochrome c molecule. That the a and b crystallographic cell axis lengths (36.46 X) are only slightly longer than the approximate diameter of the cytochrome c molecule (25-30 X) requires that a molecule centre be located as distant as possible from the 2t screw axes parallel to a and b, which lie in the z=l/8 and z=3/8 planes respectively. Also, a molecule centre cannot be positioned near the diagonal two-fold axes, which lie on the z=0, 1/4, and 1/2 planes. Thus the requirement for remoteness from both these 2j and diagonal 2-fold axes restricts the molecule centres to a positon most ideally very near the 4-fold screw axis at a z value of 1/16, 3/16, 5/16 or 7/16, or possibly adjacent to the diagonal 2l screw axes. The next step involved translational searches for the maximum correlation coefficient between calculated and observed structure factors. The initial search was two-dimensional, using only 54 hkO reflections (in the resolution range 10-5.0 X) to determine the x and y components 81 of the translational positioning vector. This analysis, which is independent of the choice of the two enantiomorphic space groups, revealed that a correlation coefficient of 0.785 is obtained with the centre of the oriented model of yeast iso-1-cytochrome c positioned at x=0.11, and y=0.55. The results of the packing analyses indicated that for this positioning of x and y, the only z positioning allowed was 0.0438-0.0585 in the space group P432i2. (No solution could be found in space group P4A2.) A correlation coefficient search around this location yielded a value of 0.46 (10-5.0 X, 416 hkl reflections) when the oriented model of yeast iso-1-cytochrome c was positioned at (0.110, 0.535, 0.0585), a point at which the packing analysis had indicated a total of 3 intermolecular contacts. Subsequently, all other regions identified as being allowed by packing, in both space groups, were searched. No correlation coefficient greater than 0.30 was found, which is indicative of the high degree of discrimination for the correct solution by the approach described. Also, on the basis of these results, the correct enantiomorphic space group was taken to be P432,2. c. Rigid body refinement The orientational and translational positioning of the model of yeast iso-1-cytochrome c determined using the rotation function, packing and correlation coefficient searches, (a = 28.2° 0=83.9° , 7=228 .5° ; x=0.110, j>=0.535, z=0.0585), was optimized through rigid body refinement Systematic adjustment of each of the six parameters about their original values yielded a lowering in the R-factor from 0.54 to 0.51 (for 581 reflections, 10-4.5 X), and the optimal positioning listed in Table III.3. 3. Structure refinement Diffraction data of increasingly higher resolution were included as the refinement progressed. The course of the refinement can be conveniently discussed as two stages: to 2.8 X resolution, fixing of the gross positioning of the molecule in the unit cell and correction of major errors in the conformation of the starting model; and at high resolution, attainment of maximum accuracy in atomic positions of the model. 82 The refinement to 2.8 X included 82 least-squares cycles and two rounds of manual intervention as outlined in Figure III.1. Diffraction data (F > 3a p) from crystal C was used. Initially, an overall isotropic temperature factor of 14.8 X J (as estimated by Wilson's statistical analysis) was assumed. Restrained refinement of individual atomic temperature factors was initiated after cycle 27. Major adjustments to the polypeptide backbone were performed manually on residues -5 to 2, 21 to 22, 52 to 63, and 85 to 88. Only 19 water molecules were added to the atomic model in this stage, after cycle 76. The overall r.m.s. shift in atomic positions between the 0 - C 0 I i i i i I i i -i i I i i i i I- i i i i I i i i i I i i i i 1 i i i i I i i i i I i R e f i n e m e n t c y c l e Figure DXl. Course of structural refinement of wild-type yeast iso-1-cytochrome c to 2.8 X resolution. The plot shows the crystallographic R-factor as a function of the refinement cycle number. The resolution ranges of the diffraction data used are indicated below the plot Points at which major revisions to the refinement model occurred are noted. 83 2.8 X structure and the starting model was 1.0 X. High resolution structure refinement (Figure III.2) was initiated with a 2.8 X resolution model refined to an R-factor of 0.192. The sigma cutoffs applied were F > 2a p for data from 6.0-1.4 X, and F > 3ap for data from 1.4-1.23 X. A more stringent rejection criterion was used for reflections below 1.4 X resolution because of the greater uncertainty in these measure-ments and the lack of multiple observations (see Table III.2). The percentage of the total possible 0.30-0 . 2 5 -O o cd 0 . 2 0 -0.15 Crys. B.F~, • 1.7-1.4 A ovod. okas. (10795 refl.) Crystol C . 5.5 - 2.3 A (3645 refl.) Crystal C . 5.5 - 2.0 A (5308 refl.) Crystals F * C 6.6 - 1.7 A (8070 refl.) Crys. B.F.C.r. 6.0 - 1.23 i (11367 refl.) .E Ic G L (3 O F ) Crystal F 6.0 - 2.0 A (5695 refl.) Crystols F.g.D.E & 6.0 - 1.4 A (10379 refl.) Crys. B.F.C.D.E & G •6.0-2.0 A data merged (10508' refl.) Crys. B.F.C.D.E&G 6.6-1.4 X, 2 OF (12513 refl.) Crys. RFf .D .E Ic G •2.0-1.4 A avgd. bkgs. (10768 refl.) I I I I I I | I I I I | I I I I | I I I I | I I I I I Ii I I I | I I I I | 50 60 70 80 90 100 110 120 I I I I | I I I I | I I I I | I 10 20 30 ' I ' 4 0 R e f i n e m e n t c y c l e Figure m.2. Course of structural refinement of wild-type yeast iso-1-cytochrome c at high resolution. The plot shows the crystallographic R-factor as a function of the refinement cycle number. Points at which manual adjustments were made to the model are indicated by downward-pointing dashed arrows. Remarks have been included to indicate points at which changes were made in the selection of reflections used in the refinement process. Asterisks indicate points at which reprocessing of the reflection data occurred. Tables III.l and II1.2 provide additional documentation on the structure factor data sets used. 84 data used as a function of resolution is shown in Figure III.3. There is a significant falloff in the amount of data used beyond -1.5 X resolution. For the resolution range 1.4-1.23 X, less than 7% of the theoretically available data has been included in the current structure refinement. Because most of the required corrections to the atomic model had been made during the earlier stage, in general, further manual adjustments to the atomic model were minor. Most corrections were restricted to the side chains of amino acids, with particularly large adjustments being made to Ser2, Thr8, Thrl2, Glnl6, Ser47, Asn62, Tml72, Arg91 and Glul03. In addition, a number of surface 0.50 0.40 -0.30 -s-O o £0 0.20 0.10 0.00 0.00 6.0 5.0 4.0 Resolution (A) 3.0 2.5 2.0 1.7 0.05 0.10 0 .15 0.20 0 .25 0.30 0 .35 0.40 (Sin 0) / A Figure HX3. Dependence on resolution of the R-factor and the percentage of available data used for the final refined structure of yeast iso-1-cytochrome c. In this analysis, reciprocal space was divided into shells according to sin#A, each shell containing at least 150 reflections. For each shell, both the agreement between calculated and observed structure factors (A—A), and the percentage of data used (o—o, axis at top right) are shown. For the purpose of assessing the accuracy of the atomic coordinates of the yeast iso-1-cytochrome c structure, curves representing the theoretical dependence of R-factor on resolution assuming various levels of r.m.s. enor in the atomic positions of the model (Luzzati, 1952) are also drawn (dashed lines). 85 lysine and glutamic acid side chains, as well as the polypeptide chain backbone of residues -5 to -2, and 54 to 58 required frequent adjustments throughout the course of refinement. Many additional water molecules (116 occur in the final model) and also 1 sulfate ion (see discussion below, Section III.D.4) were located and incorporated into the refinement model. Hydrogen atoms were included in the atomic model when the structure of yeast iso-1-cytochrome c had been refined to an R factor of 0.205 at 1.4 X. 4. Quality of the final structural model The agreement with ideal stereochemistry in the final refined structure of yeast iso-1- cytochrome c is summarized in Table III.4. Overall, deviations from ideality are reasonably small for all classes of geometrical restraints. The overall R factor for the 12513 reflections used from 6.0 to 1.23 X is 0.192. The agreement between the observed and calculated structure factors as a function of resolution is shown in Figure III.3. Curves representing the theoretical dependence of R factor on data resolution, assuming various values for the r.m.s. error in a set of atomic coordinates (Luzzati, 1952), are also drawn in Figure III.3. This analysis gives an estimate of 0.18 X for the r.m.s. error in atomic positions in the refined structure of iso-1-cytochrome c. This value, should be regarded as an over-estimate of the error, as it assumes that discrepancies between observed and calculated structure factors are due entirely to errors in the coordinate set, and neglects considerations such as errors in intensity measurements and the omission of the solvent continuum (Chambers and Stroud, 1979). The error in atomic positions is likely much lower than 0.18 X for well-defined portions of the structure, but undoubtedly much higher for mobile surface side chains. A separate estimate of the atomic coordinate error can be obtained from an unrestrained refinement of the final model (Read et al., 1983). For yeast iso-1-cytochrome c, this analysis was carried out without hydrogen atoms present and resulted in a lowering of the R-factor from 0.202 to 0.184 in three cycles. Atomic positions were found to deviate by an overall r.m.s. value of 0.12 X from those of the final restrained model. 86 Table JJL4. Agreement with ideal stereochemistry in the final refined model of wild-type yeast iso-1-cytochrome c at 1.23 X resolution Class of restraint R.m.s. deviation from ideality 1-2 bond distance 0.026 X 1-3 angle distance 0.050 X 1-4 planar distance 0.062 X 1-2 bond involving hydrogen atom 0.011 X 1-3 bond involving hydrogen atom 0.021 X Planar 0.024 X Chiral centre 0.179 X 3 Non-bonded contact3 single torsion 0.173 X multiple torsion 0.185 X possible hydrogen bond 0.261 X Staggered ( ± 6 0 ° , 180°) torsion angle 19.3° Planar torsion angle (0 or 180°) 4.3° Temperature factor 1-2 bond (main chain) 1.7 X 2 1-3 angle (main chain) 2.3 X 2 1-2 bond (side chain) 2.9 X 2 1-3 angle (side chain) 4.4 X 2 1-2 bond involving hydrogen atom 2.0 X 2 1-3 bond involving hydrogen atom 2.9 X 2 aThe r.m.s. deviations from ideality for this class of restraint incorporate a reduction of 0.1 X from the radius of each atom involved in a contact Figure III.4 shows the high quality of the electron density maps for iso-1-cytochrome c. In the electron density map of the heme group, dimples are apparent in the centres of the five-membered pyrrole rings and small bulges of electron density belonging to the hydrogen atoms of the methine and side chain methyl carbons are visible. Figure III.4b shows that a dimple is also present in the centre of the pyrrolidine ring of Pro71, and that electron density can be seen for hydrogen atoms of the side chains of Tyr67 and Leu68. The high quality of such electron density maps is also evident in the observation that for atoms with temperature factors lower than about 20 X 2 , carbon, nitrogen and oxygen atoms can be readily distinguished from each other by 87 Figure III.4. Stereo diagrams of portions of the electron density map calculated for the final model of yeast iso-1-cytochrome c. The regions of the molecule shown are (top) the heme group, and (bottom) the polypeptide chain from residues 67 to 71. These maps were calculated with coeffi-cients of the type 2F Q -F C , ac and have been contoured at an electron density level of 0.5 e/A3. the height of the electron density peak centred on each atom. 5. Effect of the inclusion of hydrogen atoms An analysis of the effects of including hydrogen atoms in the refinement process was made by deleting these atoms from the final atomic model and running 6 further refinement cycles. The most notable trend indicated was a downward shift in the temperature factors of atoms having 88 one or more hydrogen atoms bonded to them (Table III.5). This suggests that for protein structures refined without the inclusion of hydrogen atoms, temperature factors of non-hydrogen atoms will tend to be systematically too low due to their compensating for electron density belonging to the missing hydrogen atom(s). The effect of inclusion of hydrogens on the agreement between calculated and observed structure factors is a decrease of 1.0% in the overall R-factor for data to 1.23 X. The most significant improvement occurs at low to moderate resolution (> 2.0 X), as expected since hydrogen atoms make little contribution to the high angle scattering (Stout and Jensen, 1968). At the completion of refinement of the structure of yeast iso-1-cytochrome c, an assessment was made of the validity of including hydrogen atoms. The majority of the hydrogen atoms were found to be well-behaved, as they clearly reside in small lobes of electron density (see Figure III.4) and possess temperature factors similar to those of their parent heavy atoms. Furthermore, as Table III.4 shows, deviations of hydrogen atoms from their ideal positions with respect to their parent atoms is negligible. Problems that were apparent arise at heavy atoms Table m.5. Effect of inclusion of hydrogen atoms on refined atomic temperature factors Atom type Average shift in temperature factor (in X 2) for atoms having the indicated number of bonded hydrogens 0 1 2 3 N +0.42 (4) -0.72 (104). CA -0.58 (96) -1.09 (12) C -0.12 (108) O +0.14 (109) side chain C +0.65 (76) -0.21 (111) -0.22 (165) -0.27 ( 65) Each entry represents the average shift in temperature factor, after removal of hydrogen atoms and refinement for an additional 6 cycles. Atoms have been grouped according to atom type and the number of bonded hydrogen atoms, with the number of atoms in each subclass given in parentheses. The C type refers to carbonyl carbons. 89 whose electron density peaks are elongated in shape, due to either thermal motion or static disorder. At these sites, hydrogen atoms residing in the electron density smears had refined temperature factors that were much lower than would be expected. In addition, in cases where a hydrogen atom was free to rotate about its heavy atom (e.g. hydroxyls and primary amines), it sometimes refined into these smears of electron density rather than into apparently obvious hydrogen bonding positions. B. Description of the conformation of the iso-1-cytochrome c molecule 1. Overall conformation The yeast iso-1-cytochrome c molecule has the typical cytochrome c fold, with the polypeptide chain organized into a series of a-helices and fairly extended loop structures. The protein folding serves to envelop the heme prosthetic group within a hydrophobic pocket formed by a shell of polypeptide chain one to two residues thick. The polypeptide chain backbone, heme group and heme ligands of yeast iso-1-cytochrome c are shown in Figure III.5. Figure ITL5. Stereo .diagram of the polypeptide chain backbone and heme group of yeast iso-1-cytochrome c. Main chain atoms are represented as thin lines and the heme group as thick lines. The heme thioether linkages formed by the side chains of Cysl4 and Cysl7, and the heme ligands formed by the side chains of Hisl8 and Met80 are also shown. The a-carbons of every 5th residue, in addition to those of the N - and C-terminal residues, are labelled with their three-letter amino acid names and sequence numbers. The molecule is shown here in its standard orientation (see legend to Figure 1.2). The heme group is seen edge-on, and that portion of the molecule containing the exposed heme edge directly faces the viewer. 90 2. Main chain torsion angles A plot of all main chain torsion angles (0 and for iso-1-cytochrome c is shown in Figure in.6. Evident in this plot is the preponderence of residues with the a-helical conformation ( -60° , - 4 0 ° ) , and of glycines that belong to type II j3-turns (85°, 5°) . All non-glycine residues fall within or near allowed regions, except for Lys27 (-121°, -127°) . Lys27 is the first residue in a tight turn that has the conformation of a distorted reverse 7-turn (Milner-White et al., 1988; Nemethy and Printz, 1972; Bandekar and Krimm, 1985), in which the amide group of residue / 180 120 -60 -ip 0 -60 120 - 180 • A.* . n n 180 120 - 6 0 0 60 120 180 Figure ffl.6. Ramachandran plot for wild-type yeast iso-1-cytochrome c. The main chain <p and 1// dihedral torsion angles of glycine residues are denoted by the symbol n; those of all other residues are denoted by a +. Main chain conformations for an alanyl residue (having an N - C A - C angle, r, of 112°) in poly(L-alanine) that are fully allowed, and allowed assuming shortened permissible minimum interatomic contact distances (Ramakrishnan and Ramachandran, 1965) are enclosed by solid and dashed lines, respectively. 91 (Lys27) hydrogen bonds the carbonyl group of residue i+2 (Gly29) (see Figure III.7). The additional hydrogen bonds present, Gly29 N to Cysl7 O and Lys27 NZ to Leul5 O, may serve to stabilize this strained conformation. Of note is the lowered stability of variant iso-1-proteins which possess side chains (Leu, Gin, Trp and Tyr) at position 27 (Hickey et al., 1988) which are unable to form the latter interaction. The conformation observed for Asn56 (42°, 47°) is unusual in that both 0 and \p have values greater than 0° , but is not uncommon for asparagine residues (Matthews, 1977). 3. Secondary structure in yeast iso-1-cytochrome c The secondary structural elements, assigned on the basis of the observed hydrogen-bonding patterns and main chain <j> and \p angles, present in yeast iso-1-cytochrome c are detailed in Table IU.6. The average main chain torsion angles for all residues having an a-helical conformation are in good agreement with those observed in other highly refined protein structures (Sheriff et al., 1987; McGregor et al., 1987). However, as described below some distortions from ideal a-helical geometry do occur. The N-terminal a-helix contains a kink at Ala7 and Thr8, with both the Ala7 O - Lysll N and Thr8 N - Lys4 O hydrogen bonds being long. This distortion accommodates hydrogen Figure IIL7. Stereo diagram of the distorted 7-turn at residues 27 to 29 in yeast iso-1-cytochrome c. The polypeptide main chain is shown in thick lines, and side chains in thin lines. Hydrogen bonds occurring between Lys27 N and Gly29 O, Cysl7 O and Gly29 N, and Lys27 NZ and Leul5 O are shown as broken lines, and their corresponding hydrogen bond lengths (in A) are indicated. 92 Table IH.6. Secondary structural elements present in yeast iso-1-cytochrome c Secondary Residues Main chain structural element involved torsion angles8 ( ° ) a-helix 3 - 12 (-64.7, -40.8) /3-turn (type II) 21 - 24 (-65, 128), (84, 8) distorted 7-turn 27 - 29 (-123, -128), (-57, -49), (-103, 165) /3-turn (type II) 32 - 35 (-55, 138), (66, 19) /3-turn (type II) 35 - 38 (-64, 126), (86, -11) /3-turn (type II)b 43 - 46 (-82, 147), (87, 9) a-helix 50 - 55 (-65.5, -37.8) a-helix 61 - 69 (-63.6, -38.6) a-helix 71 - 74 (-66.3, -40.0) /3-turn (type II) 75 - 78 (-66, 128), (99, 0) a-helix 88 -- 101 (-63.5, -42.2) Overall; a-helix 43 residues (-64.3, -40.3) /3-turn (type II) 5 turns (-66.4, 133.4), (84.4, 5.0) aThe main chain torsion angles listed refer to the average (<t>, angles for residues in each a-helical segment, to (0, v//)2 and (0, i//)3 for residues in each type II /3-turn, and to (0, (0. and (<t>, for residues in the distorted 7-turn. Overall averages for the former two classes are also listed. DMediated through a water molecule. bonding by the side chains of two nearby threonine residues to the carbonyl group of residues in the preceding turn of the helix (Thr8 OG1 - Lys5 O, and Thrl2 OG1 - Thr8 O). The C-terminal end of this helix also possesses an unusual distortion in which the carbonyl groups of residues 12, 13 and 14 are directed markedly away from the helix axis, and the carbonyl group of residue 10 accepts a hydrogen bond from the amide groups of both residues 14 and 15. This distortion appears to occur in order to accommodate the formation of a thioether bond from Cysl4 to the heme group. The helix encompassing residues 61 to 69 is distorted towards a 3i 0 helix at both its N -and C - terminal ends. The carbonyl group of the first residue of this helix is involved in 93 hydrogen bonding with the /'+3 and i+4 main chain amides (Asp60 O to Asn63 N and Met64 N). The last turn of this helix also assumes a 310-helix hydrogen bonding pattern (Thr69 N hydrogen bonds Glu66 O, and Asn70 N hydrogen bonds Tyr67 O). This latter distortion may be caused by Thr69, whose OG1 atom forms a hydrogen bond with Ser65 O. Also, in the middle of this helix, Glu66 N and Asn62 O do not form the expected hydrogen bond, whereas Asn63 O hydrogen bonds both Glu66 N and Tyr67 N. A threonine residue also appears to cause a distortion in the C-terminal a-helix (residues 88 to 101), which is kinked at Thr96 to allow the side chain OG1 atom of this residue to hydrogen bond the carbonyl group of residue 92. This results in the amide nitrogens of both residues 96 and 97 being involved in bifurcated hydrogen bonds with the carbonyl groups of residues 92 and 93, and with those of residues 93 and 94 respectively. Beginning at residue 99, the C-terminal helix adopts main chain torsion angles characteristic of a 3i 0 helix. In this aCl distortion (Baker and Hubbard, 1984), LyslOO N hydrogen bonds the carbonyl group of residue 97, and AlalOl N forms a bifurcated hydrogen bond to the carbonyl groups of residues 97 and 98. This allows the side chain of Lys99 to hydrogen bond to the carbonyl group of residue 96, and also facilitates the hydrogen-bonded interaction of the two most C-terminal residues with the rest of the molecule (Cysl02 O hydrogen bonds Gly34 N, and the C-terminal carboxylate group of residue 103 forms a salt bridge to His33 NE2). The other two helices present in yeast iso-1-cytochrome c (residues 50 to 55, and 71 to 74; see Table III.6) are short and thus contain only one or two main chain hydrogen bonds of the type that characterize an a-helix. Overall, the a-helices in iso-1-cytochrome c are typical of those found in other high resolution protein structures, in that their conformations do not strictly adhere to that of the idealized a-helix (Arnott and Dover, 1967). Particularly notable in the present study is that the occurrence of threonines within a helix causes substantial distortion of regular a-helical geometry, and in two of the helices, marks the end of these secondary structures. The propensity for threonine to cause distortions in a-helices has also been observed in other protein structures (McGregor et al., 1987; Poulos et al., 1987a). 94 Aside from the helical segments described, little other regular secondary structure occurs in the iso-1-cytochrome c molecule. Residues 37 to 40 and 57 to 59 form a very short two-stranded anti- parallel /3-sheet (Figure 111.8). This secondary structure element contains only three inter-strand main chain hydrogen bonds. There are five turns of the /3 type II class, which possess average main chain torsion angles typical of this class of secondary structure (see Table III.6; Richardson, 1981). The /3-turn occurring at residues 43 to 46 is distorted, in that Ala43 O forms a hydrogen bond with a water molecule instead of with Tyr46 N as would be expected in a regular type II /3-turn. This distortion is likely due to local interactions formed in the final folded state of the protein (Richardson, 1981), as it facilitates the hydrogen bonding of Glu44 O to F£is26 NE2, as well as the packing of the side chain of Tyr46 against the pyrrolidine ring of Pro30. The remaining regions of the polypeptide chain form irregular loop structures. Figure m.8. Stereo diagram of the short segment of antiparallel /3- sheet in yeast iso-1-cytochrome c. The two strands are formed by residues 37 to 40, and 57 to 59. The polypeptide main chain is shown as thick lines, and side chains as thin lines. The four interstrand hydrogen bonds that occur (Gly37 N - Trp59 O, Arg38 O - Trp59 N, Ser40 N - Val57 O, and Val57 N - Ser40 OG) are shown as thin, dashed lines and the bond distances (in X) involved have been indicated. 95 4. Conformation of side chains The positioning of all the side chains of yeast iso-1-cytochrome c is shown in Figure III.9. Figure 111.10 shows the distribution of values for side chain dihedral torsion angles for those cases where a staggered conformation is expected (i.e. at sp3 carbons; X values of + 6 0 ° , 180°). The relatively low value of 19.2° for the overall deviation of these torsion angles from their optimal staggered conformations is typical of well-refined protein structures. Yeast iso-1-cytochrome c has 16 lysine residues, some of which have poorly defined electron density for portions of their side chains. Excluding 29 torsion angle values (from 13 lysine residues) judged to be uncertain because they are determined by the positions of atoms beyond the last well-defined side chain atom (usually CD or CE), the r.m.s. deviation falls to 16.5°. Several analyses of the preferred values for side chain dihedral angles in proteins have been recently published (Ponder and Richards, 1987; Summers et al^ 1987; McGregor et al., 1987). The side chain conformations observed in iso-1-cytochrome c show similar trends to those noted in these studies. As Figure ITI.10 shows, the g~ conformation (+60° ) at XI is strongly avoided, Figure m.9. Stereo diagram illustrating the positioning of side chains in yeast iso-1-cytochrome c. Drawn with thin lines are side chain groups; drawn with thick lines are the polypeptide chain backbone and also the heme group. Every 5th a-carbon has been labelled with its three-letter amino acid designation and sequence number. The orientation of view is the same as that in Figure III.5. 96 Torsion angle (° ) Figure DI.10. Distribution of side chain dihedral torsion angles in yeast iso-1-cytochrome c Only those angles for which a staggered conformation is expected to be most favored have been included (168 angles in total). The distribution of only the XI torsion angles, excluding those belonging to proline residues, (85 angles in total) is shown by the shaded bars. accounting for only 12 of 85 XI angles present. For residues within a-helices, this avoidance is absolute except for Thr8 and Thrl2 in the N-terminal a-helix, whose conformations are influenced by side chain hydrogen bonding interactions as described above. In general, threonine and serine are residues for which the g~ conformation is not disfavored with respect to g* and t (McGregor et cd., 1987). Six of the 12 side chains in iso-1-cytochrome c that have the g~ conformation at XI are threonines or serines. The remaining six side chains are all from glutamates and lysines. For these residues, X2 usually strongly favors the t conformation if XI is g" (McGregor et cd., 1987; Ponder and Richards, 1987), and this is the case in four of the six side chains in iso-1-cytochrome c. The XI torsion angles of aromatic residues are clustered closely about preferred values: 180° (r.m.s. A = 10°) for all but 2 phenylalanines and tyrosines; and -60° (r.m.s. A = 4.6°) for 3 of 4 histidines and the single tryptophan present In 5 out of 97 7 occurrences, isoleucines and valines have the most preferred conformation with the lone hydrogen atom of the CB carbon being gauche to both the main chain N and C atoms. Of the sulfur-containing side chains, all three cysteines are g+; and the two methionines, Met64 in an a-helix, and Met80 which forms a heme ligand, are tg"g~ and ttt, respectively. Overall, the conformations of the majority of the side chains in iso-1-cytochrome c are consistent with established torsional angle preferrences, and are in agreement with side chain rotamer templates compiled in other studies (Ponder and Richards, 1987; McGregor et al., 1987). 5. Side chains with multiple conformations Five side chains of yeast iso-1-cytochrome c are indicated by their appearance in electron density maps to exist in multiple conformations. The residues involved, and their alternative conformations and interactions are detailed in Table III.7. In the current structural determination, these side chains have been refined in only the conformation judged to have the greatest occupancy. Ser47, Glu88 and Glul03 are on the surface of the protein molecule. The alternative conformations adopted by both Ser47 and Glul03 are fixed by interactions made to water molecules which are (more strongly) bound to neighboring protein molecules in the crystal lattice. Glu88 alternatively makes intramolecular interactions, through bridging water molecules, with one of two basic side chains: with Lys4 NZ via Wat221, and with Arg91 NH1 via Wat214. Leu9 is partially buried, and in one of its conformations makes van der Waals contacts with another partially buried leucine (Leu85). The electron density belonging to Leu85 is suggestive that this side chain also undergoes dynamic movement, which may be associated with the alternative conformations adopted by Leu9. Leu58 is in a flexible region of the molecule and can interact with an adjacent molecule in the crystal lattice. 6. Poorly ordered regions of the iso-1-cytochrome c molecule Presumably due to their high mobility, several regions of the iso-1-cytochrome c structure are poorly defined in electron density maps (see Table III.8). All such regions are on the surface 98 Table JH..7. Side chains with multiple conformations in yeast iso-1-cytochrome c Residue Atoms affected Conformation/ Estimated occupancy3 Torsion angles" ( ° ) Interactions madec Leu9 CG, CD1, r / 0.7 -141, 67 CD2 contacts Ile95 O CD2 a / 0.3 -111, 123 CD2 contacts Leu85 CD1 Ser47 OG r / 0.8 176 OG Hbond to Sul 02, Watll2 a / 0.2 -57 OG Hbond to Sul 01, Wat210 Leu58 CG, CD1, r / 0.5 -169, -78 CD2 contacts Gly37 O CD2 a / 0.5 -177, 93 CD1 contacts His#39 ring; CD2 contacts Asp#60 CB Glu88 CG, CD, r / 0.6 -172, -171, -21 OE2 Hbonds Wat221 OE1, OE2 a / 0.4 -166, 167, 57 OE2 Hbonds Watl42 and Wat214 Glul03 CG, CD, r / 0.5 -163, 53, -133 CG contacts Lys#86 CB; OE1, OE2 OE2 Hbonds Lys#87 NZ a / 0.5 -95,-58,-57 OE2 Hbonds Watl31 and Watl82 aThe 'r' designation refers to the conformation in which the side chain was refined and the 'a' to the alternate conformation as manually positioned in electron density maps. The occupancies of the two conformations have been estimated from the magnitudes of the respective electron density peaks. DThe torsion angles refer to XI, X2 and X3, as applicable, for each conformation of the side chain. cWhere a '#' precedes a residue number, that residue belongs to a symmetry-related molecule in the crystal lattice. Note that 'contacts' refers to a van der Waal contact and that hydrogen bond has been abbreviated as Hbond. of the molecule, have a high degree of solvent accessibility, and form no strong interactions with other protein groups. The accuracy of the coordinates of the affected atoms should be considered correspondingly low. 7. Heme conformation and interactions The protoporphyrin IX heme prosthetic group of yeast iso-1-cytochrome c is buried within a hydrophobic pocket formed by the polypeptide chain. Only five atoms of the heme (CMC, CBC, CAC, CHD and CMD), which are positioned at the front edge of this group, are exposed to external solvent The solvent-accessible area of the heme group is 48.8 A 2 , which represents just 99 Table DL8. Disordered regions of the yeast iso-1-cytochrome c structure Residue Appearance in electron density maps Thr-5 to Main and side chain atoms: weak and fragmented Glu-4 Phe-3 Main chain: weak Lys4 CE onward: noisy Argl3 CD onward: weak Glu21 CG, CD: very weak. Lys22 NZ: weak Glu44 CG onward: very noisy and diffuse Lys54 to Main chain: weak. Lys54 side chain weak. Lys55 Asp60 Main chain: weak and fragmented Glu61 CG onward: noisy and diffuse. Glu66 Side chain carboxyl: weak Leu85 CG, CD1, CD2: fairly strong, but density spread out Lys86 CG onward: very weak LyslOO CG onward: fragmented and diffuse 9.6% of the total surface area of this group (508 X 2) and less than 1% of the total surface area of the cytochrome c molecule (4930 X 2). The heme group is covalently attached to the polypeptide chain via two thioether bonds to the side chains of Cysl4 and Cysl7. The bond geometry of these thioether linkages is typical for carbon-sulfur single bonds, with the average bond distance being 1.79 X, and the average C B - S G - C h e m e angle being 101.2°. The heme group itself is not absolutely planar, but is distorted into a saddle shape with the front and rear edges of the heme deviating toward the right, and the top and bottom edges toward the left of the molecule. Deviations of the planes of individual pyrrole rings with respect to the plane of the porphyrin ring as a whole, and with respect to the plane of the Fe-coordination pyrrole nitrogen plane, are detailed in Table III.9. All four rings show similar angular deviations with respect to the Fe-coordination sphere (i.e. the plane defined by the pyrrole nitrogen atoms), although the distortion is not one of a doming or ruffling of the porphyrin ring 100 Table D2.9. Heme conformation, interactions and ligand geometry in wild-type yeast iso-1-cytochrome c 1. Angular deviations between both the plane normals of individual pyrrole rings and the heme coordinate bonds, and both the pyrrole nitrogen plane and the porphyrin ring plane3 Pyrrole N plane 9.4C a. Pyrrole ring: A B 11.1° C 8.8C D 8.2° b. Heme coordinate bond: Fe - Hisl8 NE2 bond Fe - Met80 SD bond 2. Heme iron coordination bond distances (X) Hisl8 NE2 Met80 SD Hem NA Hem NB Hem NC Hem ND 2.1C 4.9C 1.99 2.35 1.97 2.00' 1.99 2.00 Porphyrin ring plane 6.7C 11.9" 9.8C 6.0C 3.3C 7.5C 3. Hydrogen bond interactions formed by heme propionic acid groups Heme atom Hydrogen bond partners and distances OlA Tyr480H (2.83 X), Watl21 (2.81 X) Watl68 (2.85 X) 02A Gly41N (3.21 X), Asn52ND2 (3.34 X), Trp59NE2 (3.09 X) OlD Thr490Gl (2.64 X), Thr780Gl (2.90 X), Lys79N (3.17 X) 02D Thr49N (2.94 X) 3Each pyrrole ring plane is defined by nine atoms, which include the five ring atoms plus the first carbon atom bonded to each ring carbon. The porphyrin ring plane is defined by the five atoms in each of the four pyrrole rings, the four bridging methine carbons, the first carbon atom of each of the eight side chains and the heme iron (33 atoms in total). The pyrrole N plane is defined by only the 4 pyrrole nitrogens. These two latter planes differ in orientation by an angle of 2.6°. (Scheidt, 1979). Pyrrole rings B and C are both involved in thioether linkages to the polypeptide chain, and show the greatest deviations with respect to the porphyrin ring plane as a whole. 101 These results suggest that the covalent bonds attaching the heme to the polypeptide chain are important factors in establishing the observed heme conformation. This is consistent with the atoms of pyrrole rings B and C having lower temperature factors (3.7 and 3.8 X 2 on average, respectively) than atoms of pyrrole rings A and D (5.6 and 4.8 X 2 on average, respectively). The heme iron coordinate bond distances are also listed in Table III.9 and are typical of those found in small-molecule six-coordinate, iron-porphyrin complexes (Scheidt, 1979). The out-of-plane coordinate bonds involving the Hisl8 and Met80 ligands show only slight deviations from being perpendicular to the pyrrole nitrogen plane. The heme iron atom is found to be displaced very slightly (by 0.03 X) from this plane, in a direction toward the Met80 SD ligand atom. The imidazole ring of Hisl8 lies almost perpendicular (99°) to the pyrrole nitrogen plane of the heme. Its orientation, in which a 46.5° angle is made between the imidazole ring and a vector joining the NA and NC pyrrole nitrogen atoms, is such that the CD2 and CE1 atoms make minimal contacts with the heme pyrrole nitrogens. As predicted by nuclear magnetic resonance and circular dichroism spectroscopies (Serin et al., 1983), the ligation of the Met80 side chain to the heme iron has R chirality. The two heme propionic acid groups are buried within the protein matrix, where they form a number of hydrogen bonds to internal polar groups of the protein (Figure and Table •III.9). Thus while internally positioned, these propionic acid groups occupy a local environment which is clearly hydrophilic in character. In addition to the hydrogen bonds listed in Table III.9, an ionic interaction mediated by two bridging water molecules is formed between the carboxylate atom OlA of the heme propionate and the guanidinium group of Arg38. C. Hydrogen bonding The positions of hydrogen atoms in the structure of iso-1-cytochrome c were refined assuming shortened (X-ray) bond distances between the hydrogen atoms and their respective parent heavy atoms. However, for the analysis of hydrogen bonding, hydrogen atoms belonging to nitrogen or oxygen atoms were re-introduced with regular bond lengths to their parent atoms. A summary of all intramolecular hydrogen bonding interactions occurring in the structure of yeast 102 Figure ITL11. Interactions formed by the heme propionic acid groups in wild-type yeast iso-1-cytochrome c. Shown are the local environment and hydrogen bonding interactions observed for the heme propionic acid group attached to (top) pyrrole ring A and to (bottom) pyrrole ring D. The heme and propionic acid groups are drawn with thick lines and the surrounding polypeptide chain residues with thinner lines. Hydrogen bonds are illustrated with thin dashed lines. Groups involved in forming hydrogen bonds to the heme propionyl carboxyl oxygen atoms, along with the hydrogen bond lengths observed, are detailed in Table ni.9. iso-1-cytochrome c is given in Table 111.10, in which hydrogen bonds have been classified in terms of involvement of only main chain atoms, both main chain and side chain atoms, and only side chain atoms. The average geometrical parameters observed for these three classes of hydrogen bonds in the iso-1-cytochrome c structure are in excellent agreement with results obtained by Baker and Hubbard (1984) in their extensive analysis of hydrogen bonding in proteins. 103 Table 111.10. Intramolecular hydrogen bondsa occurring in wild-type yeast iso-1- cytochrome c 1. Hydrogen bonds involving only main chain atoms N -Gly6 N -Ala7 N -Thr8 N -Leu9 N -PhelO N • Lysll Thrl2 N Argl3 N Cysl4 N LeulS N Cysl7 N Hisl8 N Gly24 N Lys27 Gly29 N Leu32 N Gly34 N N -Ser2 O Ala3 O Lys4 O Lys5 O Gly6 O Ala7 O Thr8 O Leu9 O PhelO O PhelO O Cysl4 O Cysl4 O Glu21 O Gly29 O Cysl7 O Thrl9 O Cysl02 O Ile35 N -Gly37 N • Arg38 N • Ser40 N -Ile53 N -Lys54 N • Lys55 N -Trp59 N • Met64 N Ser65 N Tyr67 N Leu68 N Thr69 N Thr69 N Asn70 N Tyr74 N Leu32 O Trp59 O Ile35 O Val57 O Thr49 O - Asp50 O - Asn52 O - Arg38 O - Asp60 O - Glu61 O - Asn63 O - Met64 O - Ser65 O - Glu66 O - Tyr67 O - Asn70 O Ile75 N -Thr78 N -Phe82 N -Leu85 N -Arg91 N -Asn92 N -Asp93 N -Leu94 N -Ile95 N -Thr96 N -Tyr97 N -Leu98 N -Lys99 N -LyslOO N AlalOl N Cysl02 N Pro71 O Ile75 O Met80 O Leu68 O Lys87 O Glu88 O Lys89 O Asp90 O Arg91 O Asn92 O Asp93 O Leu94 O Ile95 O - Thr96 O - Tyr97 O - Leu98 O AYmgfiS: 2.12 (0.24) X 2.99 (0.22) A 155.0(12.8)° 146.7(16.1)° 142.0 (16.4)c 2. Hydrogen bonds involving main chain and side chain atoms Phe-3 N - Thr-5 OG1 His33 Glyl N - Thr96 OG1 His33 Ser2 N - Asp93 OD1 His33 Lys5 N - Ser2 OG Arg38 Thr8 OG1 - Lys5 O Arg38 Thrl2 OG1 - Thr8 O Gly41 Hisl8 ND1 - Pro30 O Ala43 Val20 N - Glu21 OE1 Tyr46 Glu21 N - Glu21 OE1 Thr49 His26 ND1 - Asn31 N Asn52 His26 NE2 - Glu44 O Lys55 Lys27 NZ - Leul5 O Val57 Asn31 ND2 - Glu21 O Asn62 N - Asn31 OD1 ND1 - Val20 O NE2 - Glul03 OXT NH1 - His33 O NH2 - His33 O N - Heml04 02A N - Tyr48 OH OH - Val28 O N - Heml04 02D N - Thr49 OG1 NZ - Tyr74 O N - Ser40 OG N - Asp60 OD1 Asn63 N -Thr69 OG1 Lys73 N -Lys79 N -Lys79 NZ -Met80 N -Lys86 NZ -Arg91 NH2 Arg91 NH2 Thr96 OG1 Cysl02 SG Cysl02 SG Asp60 OD1 - Ser65 O Asn70 OD1 Heml04 OlD Ser47 O Thr78 OG1 Thr69 O - Leu85 O - Lys86 O - Asn92 O - Leu32 O - Leu98 O AYfiiages: 2.08 (0.27) A 2.93 (0.25) A 150.8 (15.7)° 133.6 (19.6)c 131.5 (20.0) 3. Hydrogen bonds involving side chain atoms only Thr-5 OG1 - Asn62 OD1 Asn31 ND2 - Thrl9 OG1 Tyr48 OH - Heml04 OlA Thr49 OG1 - Heml04 OlD Asn52 ND2 - Heml04 02A Trp59 NE1 - Heml04 02A Asn63 ND2 - Asp60 OD2 Tyr67 OH - Met80 SD Thr78 OG1 - Heml04 OlD Arg91 NE - Ser65 OG Axeiagfis: 2.15 (0.21) A 3.00 (0.26) A 152.6 (16.4)° 115.6 (18.8)° 114.2 (21.2)° 104 Table DI.10 (continued) aFor each potential hydrogen bond, the donor of the hydrogen atom is listed on the left, and the acceptor on the right The averages listed refer to H...A and D...A distances, and D-H...A, C-A...D and C-A...H angles respectively, where H denotes the hydrogen atom involved in the hydrogen bond, and A and D designate the acceptor and donor atoms. Standard deviations are given in parentheses. Note that interactions were accepted as hydrogen bonds only if they met all of the following criteria: a H...A distance < 2.6 A, a D-H...A angle > 120°, and a C-A...H angle > 90°. A considerable portion of the hydrogen bonding observed in iso-1-cytochrome c occurs within secondary structures. Of the 49 hydrogen bonds in which both partners are main chain atoms, only 7 (14.3%) are not part of secondary structural elements. Also, 9 of 36 hydrogen bonds formed between main chain and side chain atoms are directly involved in secondary structures: four are made by intrahelical threonine side chains (discussed above), one is made by a serine in a 0-sheet (Figure III.8), and four make capping interactions (Richardson and Richardson, 1988) at the N-termini of a-helices. Of the 213 main chain groups that could potentially form hydrogen bonds, 96 make hydrogen bonds to other main chain atoms in the molecule. An additional 33 main chain groups make intramolecular hydrogen bonds to side chain atoms. In total, 61% of main chain atoms form intramolecular hydrogen bonds, and in only 23 of the 108 residues does a main chain atom not directly form such a hydrogen bond. In addition, 31 carbonyl oxygen atoms and 9 amide nitrogen atoms are each involved in two hydrogen bond interactions. Only 24 (11% of the total) main chain groups (10 amide nitrogens, and 14 carbonyl oxygens) do not form hydrogen bonds to other protein atoms or to solvent molecules. The extent of hydrogen bonding involving side chain atoms is even greater. Yeast iso-1-cytochrome c possesses 62 polar side chains, which bear 91 atoms capable of participating in hydrogen bonding. Hydrogen bond interactions are not observed for only 2 side chains, and for only 6 polar atoms. The two amino acid residues found not to be involved in hydrogen bonding are both surface lysines (residues 4 and 100), whose side chains are directed into the solvent medium. Failure to observe hydrogen bonding in these cases is likely due to the substantial 105 mobility of these lysines (see Table III.8) and of their associated solvent molecules as well. Considering that side chain oxygen atoms are capable of participating in two (carboxyl and amide) or three (hydroxyl) hydrogen bonds each, and that many side chain nitrogen atoms can act as hydrogen bond donors to two (Gin NE2; AsnND2; and ArgNHl,2) or three (Lys NZ) acceptors, yeast iso-1-cytochrome c contains a total of 197 side chain hydrogen bonding functionalities. Of these, 131 (67%) are observed to participate in hydrogen bonding. Of the 119 hydrogen bonds formed by side chain atoms, 45 are intramolecular, with the remainder involving solvent molecules or other protein molecules in the crystal lattice. Overall, 90.1% of all main chain and side chain polar groups form well-defined hydrogen bond interactions. The saturation of hydrogen bonding potential considering all possible hydrogen bonding functionalities is 69.4% (360 of 519). This high degree of hydrogen bonding present in iso-1-cytochrome c is typical of that found in other carefully refined protein structures (Baker and Hubbard, 1984), and undoubtedly contributes significantly to the stability of the folded state, of this protein. The lack of fulfillment of hydrogen bonding potential that is present in the iso-1-cytochrome c structure is due in most cases (particularly for main chain atoms) to the fold of the protein rendering some potential sites inaccessible to favorable hydrogen bonding interactions. D. Solvent structure 1. The complement of solvent molecules associated with iso-1-cytochrome c The volume occupied by one molecule of iso-1-cytochrome c is estimated, by the method of Connolly (1983), to be 14610 X3, Therefore, -8130 X3 of space (35.8% of the total) is left unoccupied in the asymmetric unit of the crystallographic unit cell. Assuming that this vacant space is occupied by water molecules, and that the density of the solvent medium is thus 1.0 g/cm3, one would estimate that -272 water molecules also occur in the asymmetric unit During the structural refinement of yeast iso-1-cytochrome c, a total of 116 water molecules and 1 sulfate ion were identified. Of these, 6 water molecules occupy sites that are inaccessible to the probe sphere used to delimit the envelope enclosing the volume of the protein molecule (four of these six are buried in the protein interior, whereas two occupy depressions in the protein surface). The 106 remaining 110 waters and 1 sulfate ion represent 41% of the theoretical maximum calculated above, a percentage comparable to that found in other protein structures determined using crystals having a low solvent content (James and Sielecki, 1983; Blake et al., 1983; Frey et cd., 1987; Morize et al., 1987). The unique complement of water molecules and sulfate anions associated with one molecule of iso-1-cytochrome c is illustrated in Figure 111.12. The temperature factors of the water molecules range from 10.1 to 62.2 X2, with a mean of 37.1 A*. The majority of the water molecules populate the first solvation layer of the protein molecule: 93% are within 4 X of the protein surface, and the overall average distance from each water molecule to the nearest protein atom is 3.1 X. Figure 01.12. Stereo diagram of the solvent molecules associated with a single molecule of wild-type iso-1-cytochrome c. Shown are 131 water molecules (crosses) and 3 sulfate anions (tetrahedrons). The asymmetric unit of the crystallographic unit cell contains only 116 water molecules and 1 sulfate ion, but an additional 15 water molecules and 2 sulfate ions that are involved in contacts with two (or more) symmetry-related protein molecules have also been included in this drawing. The sulfate anions (SUL), and the 9 conserved water molecules between yeast iso-1-, tuna and rice cytochromes c (see Table IV.6) have been labelled. The course of the polypeptide chain of the protein is drawn using only main chain atoms (thin lines). 107 2. Hydrogen bonding interactions Solvation of polar protein groups plays an important role in stabilizing the folded conformation of a protein molecule (Edsall and McKenzie, 1983; Peters and Peters, 1985). As summarized in Table III.ll, most of the characteristics of the hydrogen bonds made between protein atoms of iso-1-cytochrome c and the ordered solvent are typical of those found in other high resolution protein structures (Baker and Hubbard, 1984). In total, 265 hydrogen bonds are made by the 116 water molecules and one sulfate anion (2.3 per solvent molecule on average). Of the 116 water molecules, 76 (65.5%) interact directly with the protein molecule, through a total of 134 hydrogen bonds, or 1.76 hydrogen bonds each on average. Of the hydrogen bonds formed, 54% are to main chain atoms of the protein and 46% to side chain atoms. One anomaly in the pattern of hydrogen bonding interactions made by water molecules to yeast iso-1-cytochrome c Table 111.11. Summary of hydrogen bonds made by water molecules in the structure of wild-type iso-1-cytochrome c Hydrogen Number of Average Number of atoms involved^ Types of side bonding H bonds distance3 chains involved partner (A) Protein Water Main chain N 25 3.07 (0.24) 25 21 — Main chain 0 46 2.88 (0.22) 37 31 — Side chain N 29 2.89 (0.32) 24 26 8Lys, 3Arg, 2His 4Asn, 2Gln Side chain 0 34 2.84 (0.31) 25 28 2Thr, 3Ser, 2Tyr, 3Asp, 5Glu, 3Asn, 2Gln Water molecule 71 2.76 (0.33) — 81 - — , aThe standard deviation from the mean is given in parentheses. bFor each class of hydrogen bonding between water and protein (except for main chain N), the number of atoms of both water and protein involved will be smaller than the total number of hydrogen bonds. This is because some water molecules make hydrogen bonds to more than one protein atom of a given type, and some protein atoms of each type (except for main chain N) make hydrogen bonds to more than one water molecule. 108 relates to the preference for water molecules to interact with oxygen, as opposed to nitrogen, atoms of the protein. For the 13 protein structures considered by Baker and Hubbard (1984), the ratio of hydrogen bonds made to oxygen atoms versus to nitrogen atoms averaged 3:1 considering main chain atoms only, and 2.6:1 overall. The same ratios found for yeast iso-1-cytochrome c are 1.84:1 and 1.49:1, respectively. This can be accounted for partially by the large number of basic side chains present in iso-1-cytochrome c (the ratio of side chain O to N hydrogen bonding sites is only 1.1:1). However, this does not account for the observed increased participation of main chain amide nitrogens in acting as donors of hydrogen bonds to water molecules. Previous structural studies of proteins have shown the associated water molecules are organized into networks (Teeter, 1984; Wright, 1987). If a water network is defined as a group of atoms, including at least two water molecules, that interact with each other through a continuous array of hydrogen bonds, most of the water molecules (73 of 116) associated with yeast iso-1-cytochrome c are observed to participate in forming 11 distinct networks (see Table 111.12) that cover large sectors of the protein surface. On average, each of these networks is anchored to the protein surface by 5 hydrogen bonds. The largest network contains 18 water molecules and forms 14 hydrogen bonds to protein atoms. A further six small networks contain only two water molecules each and make zero to two hydrogen bonds to protein atoms. Overall, only six water molecules are neither directly hydrogen bonded to the protein, nor part of hydrogen bonding . networks anchored to the protein molecule (4 of these make no contacts with any other atom). One instance of an ordering of water molecules into a pentagonal cluster (Teeter, 1984) is observed, and involves 4 water molecules and the OD1 atom of Asn31. Of note is the fairly large number (35, or 30.2%) of water molecules found to make no hydrogen bonds to other water molecules. Disregarding the 4 that are completely internal, the remainder are of two main classes. The first form only one hydrogen bond to the protein molecule, and thus are only loosely held in position themselves and therefore unlikely to be able to order other solvent molecules around them. The second form several hydrogen bonds, and are involved in bridging polar protein groups. For these water molecules, the hydrogen bonding 109 Table IQ.12. Organization of water molecules into networks associated with yeast iso-1-cytochrome c. Net- Number of water worka molecules (and of hydrogen bonds made to protein) 1 6 (4) 105 203 132 158 159 183 Argl3 NH1 Lys86 N Lys87 N Asp90 OD1 2 2 (1) 106 157 Gly37 0 3 18 (14) 107 113 115 123 126 Lysll O Thrl2 O (2) Leul5 N 128 143 156 165 167 Glnl6 N Glnl6 OE1 Lys#27 O 181 186 188 189 198 Gly#45 O (2) Ser#47 N Lys#79 NZ 210 212 220 Gly83 N Gly84 N Gly84 O 4 6 (7) 108 211 133 174 191 194 Gln#16 NE2 Gly23 N Gly24 O Asn31 OD1 (2) Arg38 NH2 Glu44 N 5 5 (2) 109 130 141 187 200 Gln42 O (2) 6 4 (4) 111 131 163 182 Gly34 O Phe36 O (2) Arg38 N 7 3 (1) 114 116 148 Tyr97 OH 8 10 (10) Sul 127 140 149 153 Gly41 O Ala43 O Tyr46 O (2) 164 169 170 185 207 Tyr48 N Glu#66 O Asn#70 O Lys#73 O Lys#73 NZ (2) 9 3 (4) 119 195 218 Val20 N Glu21 OE1 Glu21 OE2 Lys27 NZ 10 12 (10) 120 150 161 173 177 Glu-4 O Glu-4 OE2 Glu-4 OE2 178 179 202 205 208 Ser65 OG (2) Glu66 OE1 209 214 Glu66 OE2 Arg91 NH1 (2) Asn92 OD1 11 2 (2) 124 #124 Trp59 O Trp#59 O. 12 2 (0) 137 190 13 3 (3) 138 139 219 Asp50 N Lys#99 NZ Asp50 OD1 14 2 (2) 146 193 Thrl2 OG1 Lys#89 NZ 15 2 (0) 151 #151 16 4 (2) 155 175 176 213 Gln42 NE2 Ala#51 N 17 2 (2) 217 #217 Asp90 OD2 Asp#90 OD2 aWater networks have been arbitrarily ordered according to the water molecule in each network having the lowest sequence number. ^Groups having numbers preceded by a '#' belong to an asymmetric unit other than the one containing the remainder of the water molecules and protein atoms present in the network. potential is saturated by protein groups, or the protein itself occludes interaction with additional water molecules. Water molecules Protein atoms forming hydrogen bonds present0 110 A trend clearly evident from Table -111.13 is that the water molecules forming the greatest number of hydrogen bonds have the smallest mean-square positional displacements, as measured by observed atomic temperature factors. [It should also be noted that since occupancy and temperature factor are highly correlated (Edsall and McKenzie, 1983), these results must also be considered to be consistent with a greater occupancy at solvent sites at which there is the potential for the formation of a larger number of hydrogen bonds.] These data also show that the most tightly bound water molecules are those that interact directly with the protein molecule, and in general, this is particularly true when the interactions made are with main chain atoms. This is characteristic of the solvent structures of many other proteins (Blake et al., 1983; Kamphuis et al., 1984). The eight most tightly bound water molecules have an average B-factor of 13.3 X2 (a value lower than the .overall average B-factor of protein atoms) and form an average of 3.6 hydrogen bonds each to the yeast iso-1-cytochrome c molecule. As illustrated in Figure 111.13, the two water molecules observed to make 4 hydrogen bonds to main chain atoms have a Table DI.13. Temperature factors of water molecules bound to yeast iso-1-cytochrome c as a function of the number of hydrogen bonds made Hydrogen bonds made Average temperature factor of water molecules making the indicated specifically to: number of such hydrogen bonds (in X2) 0 1 2 3 4 or more Any atoms (protein 46.5 41.5 38.8 35.9 27.8 and solvent) (4) (29) (37) (27) (19) Any protein atom 44.8 36.1 35.3 27.0 16.4 (40) (46) (15) (9) (6) Main chain atoms 41.2 33.5 31.2 23.8 12.9 (71) (29) (9) (5) (2) Each entry in this table refers to the average temperature factor for the water molecules making the specified number of hydrogen bonds to atoms of the type given in the column at the left. The number of water molecules in each grouping is given in parentheses below the average temperature factor entry. I l l Figure 10.13. Stereo diagrams of the local environments of the two water molecules forming four hydrogen bonds to main chain atoms of iso-1-cytochrome c. (Top) WatllO is positioned within a loop of the polypeptide chain, and makes hydrogen bonds (dashed lines) to Thrl9 N, Pro25 O, Lys27 N and Gly29 O. (Bottom) Watl67 sits in a small depression on the protein surface, and forms hydrogen bonds to Lysll O, Leul5 N, Glnl6 N, Gly#45 O and Watl28. (Residues belonging to symmetry-related molecules in the crystal lattice are labelled with a #.) tetrahedral coordination sphere. 3. Internal water molecules In total, there are 4 water molecules completely buried within the interior of yeast iso-1-cytochrome c. One of these, WatllO, is positioned adjacent to the Hisl8 ligand and forms the hydrogen bonding interactions illustrated in Figure 111.13a. The other three internal water molecules are in close proximity to the heme group. As shown in Figure 111.11b, Watl66 is 112 hydrogen bonded to atoms belonging to three buried side chains (Asn52 ND2, Tyr67 OH, and Thr78 OG1). Watl21 and Watl68 together act as a bridge between the heme propionic acid oxygen OlA and the guanidinium group of Arg38 (see Figure IILlla). These water molecules also form hydrogen bonds to other internal main chain atoms (His39 O and Gln42 N with Watl21, and Asn31 O with Watl68). 4. Anion binding site One well-ordered solvent molecule, which appeared in electron density maps as a peak having an unusually large volume and bearing tetrahedrally arranged lobes, and when refined as a water molecule had a temperature factor that fell to a value of 2.0 X2, was modelled as a sulfate ion. Although an ion undoubtedly lies at this position, its precise identity is somewhat uncertain. The crystallization solution contained both sulfate and phosphate ions, although the sulfate concentration was 40 times greater. At pH 6.2, a phosphate would be expected to exist as H2P04~ or HP042", and thus would have different hydrogen bonding preferences from that of S0 4 2 \ However, the nature of the hydrogen bonds made by the anion in this case does not allow distinguishing between sulfate and phosphate based on these considerations. During refinement, the behavior of the sulfate atoms was reasonable, with no significant deviations from restraint bond distances and with the sulfur and four oxygen atoms all having similar temperature factors ranging from 33.5 to 35.0 X2. The electron density attributed to this sulfate ion and also the residues with which the sulfate ion forms hydrogen bond interactions are illustrated in Figure III. 14. The sulfate is located at the N-terminal end of an a-helical segment of polypeptide chain (residues 3 to 12), a common site for anion binding (Hoi et al., 1985). Three of the oxygen atoms of the sulfate are oriented so as to individually hydrogen bond to Ser2 OG, Ala3 N, and Lys4 N. Interestingly, this system of hydrogen bonds is identical to those occurring at the N-termini of helices that have key roles in binding sulfate in sulfate-binding protein (Pflugrath and Quiocho, 1985) and in binding phosphate in fiavodoxin (W.W. Smith et al., 1977). The sulfate ion in yeast iso-1-cytochrome c is further held in place by hydrogen bonds from the side chains of Ser47 and Lys73, residues 113 Figure rn.14. Stereo diagram of the electron density and hydrogen bonding interactions of the sulfate ion bound to iso-1-cytochrome c. Electron density, from a map calculated with coefficients of the type 2F0-F_, a„, belonging to the sulfate ion is represented by the solid wire envelopes. The hydrogen bonds (thin dashed lines) formed by the sulfate ion are Sul 01 - Ser2 OG, Sul 02 - Ala3 N, Sul 03 - Lys4 N, Sul 03 - Watl64; and involving adjacent protein molecules, Sul 02 - Lys#73 NZ, Sul 02 - Ser#47 OG and Sul 03 - Lys#73 NZ. Amino acid residues originating from adjacent molecules in the crystal lattice have been drawn using thick dashed lines, and have residue-number labels preceded by a which are from adjacent protein molecules in the crystal lattice. Cytochrome c has been shown to possess an anion binding site, which when occupied affects the rate at which cytochrome c carries out electron transfer reactions with both small molecule redox reagents (e.g. dithionite and ferricyanide) and cytochrome oxidase (reviewed in Ferguson-Miller et al., 1979; Pettigrew and Moore, 1987). Considering that it is chemical modification of those lysines located at the front of the cytochrome c molecule that has the greatest effect on these reactions, electron transfer is thought to occur via the front, exposed edge of the heme (Ferguson-Miller et al., 1979). Because the site at which the sulfate ion is most strongly bound in yeast iso-1-cytochrome c occurs near the rear of the molecule (Figure H1.12), it would seem unlikely that this site would directly influence these electron transfer reactions. 114 E. Polypeptide chain mobility and internal cavities The average B-factors of main chain and side chain atoms of each residue in iso-1-cytochrome c are shown in Figure JJI.1S. The overall average B for all non-hydrogen atoms is 16.5 X2. Refined crystallographic temperature factors can be used as a measure of the relative flexibility of different regions of a protein molecule (Ringe and Petsko, 1985). For yeast iso-1-cytochrome c, they clearly demonstrate the dominating influence of the heme group on _ FKAGSAKXGATLFKTRCLQCHTVEKGGPHKVGPNLHGIFGRHSGQA EGYSYTDANIKKNVLTOENNMSEVLTNP J KYIPGTKMAFGGLKKEKDRNDLITYLKKACE o Ly'" j n ^ , u Mo. , i , iy,. ,2y.. .2y i, .3y >. .3y. i > i , ^ i. yQi.. .. yj.. .6y " V q. . i ^ n .ay i. .8y. i .GM " '9y' < l0o' <. I Residue Figure ITL15. Average temperature factors of the main chain and side chain atoms of each amino acid residue in wild-type yeast iso-1-cytochrome c. Values for the polypeptide chain backbone are represented as (n—H), and for side chain groups as (n—A). The amino acid sequence of the protein is shown using the one-letter code above the axis indicating residue numbering. Note that the average temperature factors for the two N-terminal residues [Thr(-5): 53.6 X2 for main chain, and 54.7 A 2 for side chain atoms; and Glu(-4) 47.9 X2 and 50.8 XJ] are not shown. A further horizontal line defines the average B value (16.5 X2) of all protein atoms. The average closest distance to the porphyrin ring (for. definition, see legend to Table III.9) of atoms belonging to the main chain (a—a) and side chain (A—A) of each residue is shown at the top of the Figure, according to the axis scale at the top right 115 internal dynamics. The heme itself is tightly held within the molecule, having an average B-factor of 5.3 A 2 for the 43 non-hydrogen atoms. The regions of the polypeptide chain backbone observed to have the greatest rigidity are those involved in forming the heme pocket These include the heme-binding segment (Cysl4-Leul5-Glnl6-Cysl7-Hisl8), the right wall of the heme pocket (residues 28 to 32), the floor of the heme pocket (46 to 49), and the left wall containing the Met80 ligand (78 to 82). The three a-helical regions containing more than two turns (residues 3 to 12, 61 to 69, and 88 to 101) also have lowered mobility, and segments of these three helices also form part of the heme pocket Localized maxima in molecular flexibility occur at segments of the polypeptide chain that are looped away from the heme and occupy surface positions. These include the N-terminal region at the rear (residues -5 to -1), a j3-turn at the right periphery (21 to 25), another /3-turn at the bottom rear (36 to 39), the left rear wall of the molecule between two a-helices (54 to 58), the extreme left periphery (73 to 75), and the C-terminus of the molecule (residue 103). For several residues, side chain atoms possess lower B-factors than main chain atoms. These residues either form covalent or coordinate bonds to the heme (Cysl4, Hisl8 and Met80), or are directed into the interior of the molecule and form part of the heme pocket (Leu32, Tyr46, Tyr48, Asn52, Trp59 and Leu68). Figure 111.15 shows that for both main chain and side chain atom's of iso-1-cytochrome c, there is a strong correlation between close positioning to the heme group and low observed B-factors. Other trends relating to the temperature factors of iso-1-cytochrome c are evident For side chains of iso-1-cytochrome c, there is a strong positive correlation between solvent accessibility and B-factor. This consideration is also related to proximity to the heme group, as those side chains which are close to this buried moiety will, have a low degree of solvent accessibility. The side chains with the highest B-factors, relative to the main chain atoms of the same residue, are all hydrophilic and are directed into the solvent medium. These include Lys4, Lys5, Argl3, Glu21, Lys22, Gln42, Glu44, Lys54, Glu66, Asn70, Lys86, Lys87, Lys99 and LyslOO. In addition, the greater overall structural rigidity of the right side (residues 1 to 48, and 91 to the C-terminus) as compared to the left side (residues 49 to 90) of the molecule is apparent from 116 Figure 111.15. One further point of note is that the variation of B-factors along the polypeptide chain determined for iso-1-cytochrome c at 1.23 X resolution is very similar to that at a lower resolution of 2.8 X (Louie et al., 1988a). This indicates that refinement of B-factors gives meaningful results even when only data of moderate resolution is available. However, at 2.8 X resolution, the overall average B of protein atoms in the yeast iso-1-cytochrome c structure was lower, 13.8 X2. Temperature factors refined against X-ray data of moderate resolution tend to be systematically low, due to the absence of the influence of weak, high resolution structure factors (Ringe and Petsko, 1985), and to the effect of disordered solvent on low angle X-ray scattering (Stuart and Phillips, 1986). An additional factor is likely the absence of hydrogen atoms in the 2.8 X model. An assessment of the internal mobility of the yeast iso-1-cytochrome c molecule obtained crystallographically can be compared with that obtained using NMR spectroscopy (Williams, 1988; Pielak et al., 1988b; Williams et al., 1985c). Dynamic information derived from NMR data confirm the lack of atomic mobility in the interior of the cytochrome c molecule. The large chemical shift differences in the CD1 and CD2 methyl groups of those leucine side chains that are internally positioned are reflected in the well-defined appearance on electron density maps and the low temperature factors of these side chains. Particularly interesting is the much lower temperature factors for the side chains of aromatic residues in yeast iso-1-cytochrome c observed to have slow flip rates (PhelO, Tyr46, Tyr48, Trp59, TyT67 and Tyr97; average B-factor, 11.7 X2) as compared to those for aromatic rings that undergo rapid flipping (Phe-3, Phe36, Tyr74 and Phe82; average B-factor, 23.5 X2). Correlated with the observed low mobility of internal groups in yeast iso-1-cytochrome c is a particularly high packing efficiency. Of 893 non-hydrogen atoms, 307 could be considered to be part of its central core, if this is defined as being within half of the molecular radius (7 X) from the heme group. In total, these internal atoms make 640 inter-residue van der Waals contacts (centre-centre distance < 4.0 X), or on average 2.1 contacts per atom. An assessment of 117 the number and size of internal cavities, using the method of Connolly (1983), reveals only one internal cavity large enough to accommodate a probe sphere 1.4 X in radius. Groups enclosing this internal cavity include the non-polar side chains of Leu32, Met64 and Leu98, as well as the CHB atom of the heme. F. Crystal packing The packing observed in crystals of yeast iso-1-cytochrome c (see Figure Hl.16) can best be described as an interleaving along the crystallographic c axis of sheets of protein molecules, with each of the molecules centred near (< 5 X from) a 43 screw axis. Each sheet has a thickness of 1/8 of the c axis and alternate sheets have the cytochrome c molecules close to either the 43 axis in the middle of the a or the b crystallographic cell edge. Individual molecules make packing contacts not with other molecules in the same sheet, but with molecules in sheets above and below their own: in one direction in c, intermolecular contacts are generated by the diagonal Figure 10.16. Stereo drawing of the packing of molecules in crystals of yeast iso-1-cytochrome c. The closest neighboring molecules to the origin molecule (thick lines) are shown. The iron atoms of each of the heme groups of the molecules shown have been labelled. Overlaid are the boundaries of the crystallographic unit cell about the origin molecule. In total a portion of four sheets of molecules, which run parallel to the ab plane, are shown. Only one molecule in the second sheet (the origin molecule) and in the topmost sheet are presented. For clarity, the rearmost molecule belonging to the First sheet, and the front most molecule of the third sheet are not drawn. The origin molecule as pictured interacts with the sheet below through contacts generated by the diagonal two-fold, and with the sheet above through contacts generated by the 2j axis parallel to a. 118 two-fold operation, and in the other direction, by the 2j screw axes parallel to a or b. Only a small number of contacts is made between molecules related by the 43 screw axis, i.e. between every second sheet of molecules. Therefore, packing parallel to the c axis has the appearance of columns of cytochrome c molecules stacked very loosely end-to-end, with adjacent columns being antiparallel and displaced by 1/8 c. In total, three symmetry operations are found to generate all packing contacts, and Table 111.14 lists the intermolecular hydrogen bond and van der Waals contacts formed. Two adjacent protein molecules in the crystal lattice are joined by an additional 29 hydrogen bonds, formed through direct bridging interactions made by 16 water molecules. The high protein content of crystals of yeast iso-1-cytochrome c (estimated to be -64%, see Section III.D.l) is consistent with the observed relatively tight packing of the protein molecules. The largest solvent channels present in the crystals are narrow columns that run parallel to the crystallographic c axis and alongside the loose stacks of cytochrome c molecules described above. Interestingly, the heme plane almost exactly bisects the angle between the a and b crystallographic axes, and is nearly parallel to the c axis (the porphyrin heme plane normal makes an angle of 41.5° with a, and 3.6° with c). Therefore, with the crystallographic symmetry elements present, each heme group in the crystal is either perpendicular to or parallel to every other heme group. Crystals of yeast iso-1-cytochrome c have the shape of a tetragonal bipyramid, with the shortest dimension being along the crystallographic c axis (which also corresponds to the longest unit cell axis length). The equatorial edges of the bipyramid parallel the ab diagonals of the unit cell. Thus, the external morphology of the crystals suggests that the fastest crystal growth occurs along the ab diagonals, which is in agreement with the tightest intermolecular contacts being made by molecules related by the diagonal two-fold symmetry operations (Table III. 14). It is therefore tempting to speculate that crystal formation involves first, the interaction of two molecules of cytochrome c as a dimer, and then the association of such dimers to form two-layered sheets. The slowness of crystal growth in the c direction would be due to the weaker associations between sheets whose molecules interact through operation of the 2l screw axes parallel to the a and b crystallographic axes. 119 Table LTJ.14. Intermolecular packing contacts occurring in crystals of yeast iso-1-cytochrome c 1. Symmetry element: 43 screw axis a. 1/2-y, 1/2 + x, z-1/4 Lys-2 CD - Lys79 O Ala-1 O - Lys79 NZ Glyl O - Ser47 OG 3.12 vdW 3.53 Hb 3.06 Hb b. y-1/2, 1/2-x, 1/4+ z Ser47 OG - Sul 02 2.88 Hb 2. Symmetry element: diagonal 2-fold axis a. y, x, -z Thr-5 N - Asn56 O 2.91 Hb Thr-5 CG2 - His39 CD2 3.18 vdW His39 NE2 - Glu61 OE1 2.77 Hb His39 NE2 - Glu61 OE2 3.21 Hb Leu58 CD1 - Asp60 CB 3.69 vdW b. y-1, x+1, -z Thr8 CG2 - Lys9 O Lys5 CE - Leu9 CD1 Thr8 OG1 - Thr8 OG1 Thr8 CG2 - Thr8 CG2 Lys87 CE - Lys87 CE 3.32 vdW 3.59 vdW 3.32 vdW 3.32 vdW 3.01 vdW 3. Symmetry element: diagonal 2Y screw axis ci y*•• 1 x ~ z Lys-2NZ - Lys22 O 3.55 Hb Lys73 NZ - Sul 04 3.34 Hb . Lys73 NZ - Sul 02 3.19 Hb Lys86 O - Glul03 CB 3.26 vdW Lys87 CA - Glul03 O 3.49 vdW Gly88 N - Glul03 OXT 3.04 Hb b. y, x+1, -z Lys22 N - Glu88 OE1 3.11 Hb His33 CE1 - Glu88 OE1 2.66 vdW 4. Symmetry element: 2^ screw axis \\ a a. 1/2 + x, 1/2-y, 1/4-z Gln42 OE1 - Gly77 N 3.31 Hb Gln42 NE2 - Pro76 O 3.28 Hb Tyr48 O - Lys73 NZ 2.92 Hb Asp50 OD1 - Asn70 ND2 2.94 Hb Asp50 OD2 - Asn70 ND2 3.37 Hb Ile53 CG2 - Tml72 O 3.39 vdW Ile53 CD1 - Lys73 CD 3.32 vdW Lys54 NZ - Asn70 OD1 3.34 Hb Lys54 NZ - Gly83 O 2.20 Hb b. x-1/2, 3/2-y, 1/4-z Glnl6 OE1 - His26 N Glnl6 NE2 - Gly24 O Lys27 NZ - Glu44 OE1 Lys27 NZ - Glu44 OE2 c. 1/2 + x, 3/2-y, 1/4-z Pro25 CB - Ala81 O Pro25 CG - Ala81 O 3.20 Hb 2.50 Hb 3.25 Hb 3.47 Hb 3.25 vdW 3.29 vdW The symmetry operations listed are those which when applied to the origin molecule generate the symmetry equivalent neighboring molecule. Following each contact is the length (in X) of the interaction, and whether a hydrogen bond (Hb) or van der Waals contact (vdW) is made. 120 Yeast iso-1-cytochrome c is known to dimerize in solution (Bryant er al., 1985), through the formation of an intermolecular disulfide bond involving Cysl02. Since it was considered likely that the strongest intermolecular interactions occurring during the process of crystal nucleation involved two iso-1-cytochrome c molecules associating as a dimer, it was of interest to determine if these dimer interactions could promote the covalent dimerization of iso-1-cytochrome c, or if this process could actually occur within dimers present in crystals of this protein. As shown in Table III. 14, dimer contacts made by a pair of iso-1-cytochrome c molecules in the crystal lattice are of two types. Those generated by the symmetry operation (y-1, x+1, z) involve the antiparallel association of the N-terminal helices of two adjacent molecules, whereas those generated by (y, x, -z) involve the packing of the rear, lower left of two molecules. However, neither dimer interaction observed in the crystal lattice of yeast cytochrome c appears to be related to the interaction between two iso-1-cytochrome c molecules which would be required for intermolecular disulfide bond formation to occur; two Cysl02 residues of dimer-associated molecules are no closer than 17 X in both forms of dimers. G. Distinctive features of the yeast iso-1-cytochrome c molecule In this section, several distinctive features of the yeast iso-1-cytochrome c molecule are described, in terms of their structures and their intramolecular interactions formed. 1. N-terminus Typical of fungal cytochromes c, yeast iso-1-cytochrome c has an extension, 5 amino acid residues in length, at its N-terminus. Residues -4 to -1 have <j>, \}J values characteristic of an extended conformation (Schulz and Schirmer, 1979). Glyl, the residue preceding the start of the N-terminal a-helix, adopts an unusual conformation (<f> = -132° , \jj = -146° ; accessible only to glycine residues), causing the polypeptide chain to undergo a bend at this position. Thus, the N-terminal segment in yeast iso-1-cytochrome c is projected parallel to the rear surface of the molecule (see Figure III.5), making few interactions with the body of the molecule. The most prominent contacts are made by the side chain of Phe(-3), which occupies a small, surface pocket 121 formed by the atoms Glu61 CG and CD, Asn92 CA, and Ile95 CB and CG2. The lack of intramolecular interactions formed by the N-terminal segment is reflected in the high temperature factors of residues -5 to -1 (see Figure 111.15). Cytochrome c can be reversibly unfolded by a variety of treatments (extremes in pH, heat, the presence of urea or guanidine hydrochloride) (Saigo et al., 1986; Bryant et al., 1985). Comparative studies on the denaturation of homologous cytochromes c have shown that there is a good correlation between the relative susceptibilities of a given cytochrome c to each denaturant (Osheroff et al., 1980; Saigo et al., 1986; Bryant et al., 1985). The high flexibility of the N-terminal extension in yeast iso-1-cytochrome c, and thus presumably the ease with which this region can be unfolded, may contribute to the lower stability under denaturing conditions of cytochromes c possessing this extension (Saigo, 1986; Margoliash and Schejter, 1966; Ochi et al., 1983). An interesting point relating to the unfolding of cytochrome c is the specific stabilizing effect of certain anions (e.g. phosphate) (Osheroff et al., 1980). In yeast iso-1-cytochrome c, the occupation of the anion binding site (see Section III.D.4 and Figure 111.14) may a factor in stabilizing the folded state of the N-terminal region of the molecule. 2. Arginine 13 In all known primary sequences of eukaryotic cytochromes c, the side chain of residue 13 is basic. This residue has been proposed to play a role in stabilizing the heme crevice through forming a salt bridge to the acidic side chain (usually glutamic acid) of residue 90 on the opposite side of the crevice (Osheroff et al., 1980). In yeast iso-1-cytochrome c, despite the occurrence of an apparently compensating substitution of an aspartate at position 90, which could serve to maintain an appropriate distance between the two groups involved in the ionic interaction (Osheroff et al., 1980), a salt bridge is not formed. Apparently, because the aspartate side chain is branched at the CG atom, it is prevented from adopting a conformation directing it toward the side chain of Argl3 by steric conflicts with the intervening Leu9 and Leu85. Instead, the Argl3 side chain is directed more into the solvent medium; the guanidinium group is positioned directly above the side chain of Phe82, and forms hydrogen bonds to a number of water molecules. The absence of an 122 intramolecular salt bridge between residues 13 and 90 may be an additional factor in the increased susceptibility of yeast iso-1-cytochrome c to alkaline isomerization and denaturation by guanidine hydrochloride (Saigo, 1986; Osheroff et al., 1980). Based on the structure of yeast iso-1-cytochrome c, two other roles for residue 13 can be suggested. These are the occlusion, by the aliphatic portion of the side chain, of solvent from the top of the heme crevice, coupled with the participation of the positively charged side chain group in intermolecular interactions with redox partners (Poulos and Finzel, 1984; Ferguson-Miller et al., 1978). Notably, both Falk et al. (1981) and Satterlee et al. (1987) have previously observed from NMR studies that residue 13 influences the character of the heme environment of cytochrome c. 3. e-N-Trimethyl lysine 72 The cytochromes c of fungi and plants are tri— methylated at the epsilon nitrogen of lysine 72 (Paik et al., 1989). This residue is specifically-modified by the enzyme S-adenosylmethionine: protein-lysine N-methyltransferase (DiMaria et al., 1979). Various roles, generally relating to involvement in forming intermolecular interactions, have been proposed for the tri-methylated lysine residue. Polastro et al. (1978) have shown that the methylated iso-1-cytochrome c species binds more tightly to mitochondria than does the unmethylated species, possibly through an increased affinity for cytochrome c oxidase (Holzschu et al., 1987). Farooqui et al. (1981) have found that methylated iso-1- cytochrome c is degraded intracellularly at a decreased rate, likely as a result of the indirect protection from proteolytic attack effected by increased binding to mitochondria. Methylation of lysine 72 has been suggested to be required for transport of newly synthesized cytochrome c from the cytoplasm to the inner mitochondrial membrane (DiMaria et al., 1979; Paik et al., 1980). Finally, the presence of Tml72 has been shown to result in an increased binding affinity of iso-1-cytochrome c for cytochrome b2 (Holzschu et al., 1987). Despite these findings, Holzschu et al. (1987) have shown that replacement of Tml72 by an arginine residue has only minor effects on the properties of yeast iso-1-cytochrome c. Thus, the functional significance of trimethylation of the lysine at position 72 is not yet firmly established. 123 The electron density and environment of Tml72 in yeast iso-1-cytochrome c is shown in Figure 111.17. The side chain of Tml72 has essentially a fully extended conformation, and projects directly toward the front of the molecule. The bulky and aliphatic trimethylated amine is positioned at the front face of iso-1-cytochrome c, and has one of its methyl groups packed against Ala81. Relative to other lysine side chains in iso-1-cytochrome c, the side chain of Tml72 is fairly rigidly positioned (average B-factor 20.7 X2), despite forming only the single intramolecular interaction. The structural determination of yeast iso-1-cytochrome c coupled with other functional studies indicate two possible roles for trimethylation of lysine 72. First, the aliphatic portion of the side chain of Tml72, in occupying a position adjacent to the Met80 ligand, may contribute to maintaining the integrity of the heme pocket This would be consistent with the lowered stability of a variant iso-1-cytochrome c in which trimethyllysine 72 is replaced by an arginine (Holzschu et al., 1987). The less hydrophobic side chain of the latter residue would be unlikely to pack against residue 81 or to adopt the same rigid conformation observed for Tml72. Secondly, the Figure IIL17. Stereo diagram of the local environment of Tml72 in yeast iso-1-cytochrome c. Representative electron density (dashed line envelopes) in this region of the molecule is shown from a 2 F 0 - F C a c map. The direction of view is from the top of the molecule. The quaternary ammonium group of Tml72 occurs at the front face of the iso-1-cytochrome c molecule, which is located at the lower edge of this diagram. 124 trimethylated amine group may provide a hydrophobic patch for interaction with other proteins. Holzschu et al. (1987) have shown that the Arg72 variant of iso-1-cytochrome c has an -4-fold higher for binding to cytochrome b2. Additional evidence is provided by NMR studies of the interaction between cytochrome bs and cytochrome c from the yeast Candida krusei, which show that the linewidth of the trimethyl group of Tml72 is considerably broadened upon bimolecular complexation (Eley and Moore, 1983). The indicated decrease in mobility of Tml72 suggests that this residue forms part of the protein-protein interface. The hydrophobic patch also appears to be conserved in rice and tuna cytochromes c: in rice cytochrome c, the conformation of Tml72 is similar to that in yeast; and in tuna cytochrome c, Lys72 is not methylated, but the occurrence of an isoleucine at position 81 (Ala in yeast, Val in rice) places a hydrophobic group at the corresponding spatial position. From an analysis of the primary sequences of eukaryotic cytochromes c, it is notable that whereas plant and fungal cytochromes c have a small side chain (Val or Ala) at residue 81, animal cytochromes c, which are not methylated, have a conserved isoleucine residue at this position. In addition, amino acid replacements (by Ala and Val) at position 81 of horse cytochrome c, generated using semi-synthesis, have been shown to affect the binding affinity of the variant proteins to cytochrome c oxidase (Boots and Tesser, 1987; see Table 1.2). 4. Cysteine 102 In the structure of yeast iso-1-cytochrome c, Cysl02 is positioned on the inward-facing side of the C - terminal a-helix. The sulfhydryl group of Cysl02 is inaccessible to solvent, and occupies a predominantly hydrophobic pocket formed by the side chains of Val20, Leu32, Ile35, Phe36 and Leu98. The XI torsion angle of -55° places the SG atom in a position where it can potentially form a hydrogen bond to the carbonyl group of Leu98 or Leu32 (see Figure 111.18). Because the side chain of Cysl02 is normally directed into the interior of the molecule, covalent dimerization of iso-1-cytochrome c via intermolecular disulfide bond formation (Bryant et al., 1985) would require at least a partial unfolding of the C-terminal helices of the two molecules involved. Since the C-terminal helix is an important structural component of the heme pocket, 125 Figure HL18. Stereo diagram of the local environment of Cysl02 in yeast iso-1-cytochrome c. Representative electron density (dashed line envelopes) in this region of the molecule is shown from a 2 F 0 - F C a c map. Cysl02 occurs in the C-terminal a-helix, which is partially shown oriented vertically at the left of the diagram. The internal face of this helix faces the right in this diagram. Possible hydrogen bonds involving the sulhydryl group of Cysl02 are indicated as thick dashed lines. . dimerization would be expected to destabilize the overall fold of the protein. These considerations are thus consistent with experiments which show that dimerization increases the susceptibility of iso-1- cytochrome c to the following: denaturation by heat, guanidine hydrochloride, urea, and acid (Bryant et al., 1985); alkaline isomerization, and imidazole and azide binding to the heme iron (Saigo, 1986); and digestion by proteases (Motonaga el al., 1965). From measurements of the same susceptibilities, Bryant et al. (1985) and Motonaga et al. (1965) have found that reaction of Cysl02 with iodoacetate or thiosulfite also causes destabilization of iso-1-cytochrome c Inspection of the structure of yeast iso-1-cytochrome c indicates that the pocket occupied by the SG atom of Cysl02 is not large enough to accommodate many additional atoms, and thus derivitizarjon of the sulfhydryl group with bulky substituents would likely perturb the native conformation of (at least) this region of the molecule. It is also notable that Moench and Satterlee (1989) have shown using NMR techniques that both dimerization and modification with 5,5'-dithiobis(2-nitrobenzoate) cause significant structural changes in the iso-1-cytochrome c molecule, which in turn perturb the heme environment 126 H. Amino add residues at which site-specific replacements have been made Much of this dissertation describes structural studies on variant iso-1-cytochromes c in which the naturally occurring amino acid residues (Phe82, Arg38 and Cysl02) have been specifically replaced. This section details the conformations and local environments of Phe82 and Arg38. Cysl02 was discussed above. I. Phenylalanine 82 Phe82 is part of the fairly extended 80's region of polypeptide chain which sweeps across the upper left face of the heme group. The side chain of Phe82 adopts a nearly ideal conformation, with torsion angles XI = 172° and X2 = -104° . The phenyl ring is packed against the heme group, and occupies a hydrophobic pocket that is located just below the surface of the protein molecule (Figure HI.19). This pocket is formed by the upper edge of the heme group, the side chains of Leii68, Pro71, Met80 and Leu85, and the backbone of residues 83 and 84. The plane of the phenyl ring is nearly parallel to that of the heme group. The interplanar Figure UJ.19. Stereo diagram of the local environment of Phe82 in yeast iso-1-cytochrome c. Representative electron density (dashed line envelopes) in this region of the molecule is shown from a 2F 0 -F^ ac map. The direction of view is from the upper front of the molecule. Indicated as thick dashed lines are hydrogen bonds between Watl72 and the main chain amide nitrogen of residue 72 and the carbonyl groups of Phe82 and Gly83. distance and angle are ~5 X and -23°, respectively. Van der Waals contacts that are formed by the phenyl ring within the hydrophobic pocket (CE1 - Gly84 CA: 3.4 A; CZ - Hem CBB: 3.3 X) likely promote the parallelism of the phenyl and heme groups. It is notable that it is the extended conformation of residues 83 and 84, in which the invariant Gly84 adopts a conformation inaccessible to residues having a side chain, which permits the close packing interactions made by the left face of the phenyl ring. The packing of the side chain of Phe82 adjacent and approximately parallel to the heme group is consistent with the proposed interaction of the 7T-electron systems of these two groups (Pielak et al., 1986; Poulos and Kraut, 1981). A notable feature of the local environment of the side chain of Phe82 is the absolute exclusion of polar groups. The phenyl ring itself is positioned to occlude the access of solvent to the heme crevice. The orientation of the peptide bond planes in the adjacent segment of polypeptide chain backbone (residues 81 through 84) is such that the carbonyl groups are directed away from the heme group. Thus, Phe82 clearly plays a structural role in maintaining the non-polarity of the upper left portion of the heme pocket 2. Arginine 38 Arg38 occurs in a flexible, external loop positioned at the rear right of the floor of the heme pocket Its side chain adopts a fairly extended conformation, such that the guanidinium group occupies a position where it can interact with the buried propionic acid group of heme pyrrole ring A. This interaction is mediated by two internal water molecules, which form bridging hydrogen bonds between the NH1 and NE atoms of Arg38, and the OlA atom of the propionic acid (see Figure 111.20). The position of the guanidinium group is further fixed by hydrogen bonds between both the NH1 and NH2 atoms and the carbonyl group of His33. On the solvent exposed edge of the guanidinium group, NH2 forms a hydrogen bond to an external water molecule (Watl08). The extensive network of hydrogen bonds formed by this guanidinium group prompted Wallace to suggest that the function of Arg38 is to stabilize the conformation of the bottom loop of the protein molecule (see Table 1.2 and references listed therein). 128 Figure HJL20. Stereo diagram of the local environment of Arg38 in yeast iso-1-cytochrome c. Representative electron density (dashed line envelopes) in this region of the molecule has been shown from a 2F 0 -F C , ac map. The direction of view is from the solvent medium and toward the Hisl8 face of the heme group. The hydrogen bonding network involving the guanidinium group of Arg38 and the internal water molecules Watl21 and Watl68 is represented as thick dashed lines. 129 IV. STRUCTURAL COMPARISON OF YEAST ISO-1-, TUNA AND RICE CYTOCHROMES c The availability of well-refined structures for yeast iso-1-, tuna and rice cytochromes c permits a comparison of the structural features of three members of the cytochrome c family which have -40% amino sequence divergence, and which have been determined by independent workers, in different crystal space groups. Key details of the structure determinations of these cytochromes c are listed in Table IV.l. An amino acid sequence alignment of these three proteins is shown in Figure IV.l. The numbers of amino acid sequence identities between pairs of these three cytochromes c are presented in Table IV.2. Table IV.l. Details of the structure determinations of the various cytochromes c Property Yeast Tuna Tuna Rice iso-1- (reduced) (oxidized) Space group P432,2 P2,2,2 P43 P6, No. of molecules per asymmetric unit 1 1 2 1 Unit cell dimensions (A) a 36.46 37.33 74.42 43.78 b 36.46 87.10 74.42 43.78 c 136.86 34.44 36.30 110.05 Resolution (A) 1.23 1.50 1.80 •1.50 No. of reflections 12513 13840 16831 n.s.b Method of refinement3 H.K. J.L. J.L. H.K. R-factor 0.192 0.173 0.208 0.200 Estimated coordinate accuracy (X) 0.18 0.15 0.20 n.s. R.m.s. deviations from ideal stereochemistry0 bond distances (X) 0.026 0.020 0.021 0.018 angle distances (X) 10 torsion angles ( ° ) 0.050 0.048 0.036 0.040 3.6 7.1 4.4 3.6 No. of solvent molecules 117 53 49 46 a H.K.: stereochemically restrained least-squares (Hendrickson and Konnert, 1981). J.L.: simultaneous energy minimization and reciprocal space refinement (Jack and Levitt, 1978). Dn.s.: not specified by original authors. CA11 deviations from ideality are with respect to the dictionary of ideal distances used in the refinement of yeast iso-1-cytochrome c. 130 Table IV.2. Matrix of structural equivalence and amino acid sequence identity for yeast iso-1-tuna and rice cytochromes c Yeast iso-1- Tuna Tuna Rice (reduced) (oxidized) Yeast isoT-Tuna (reduced) Tuna (oxidized) Rice (oxidized) 108 0.54 0.55 0.51 66 (64%) 103 0.42 0.62 66 (64%) 103 (100%) 103 0.59 64 (59%) 65 (63%) 65 (63%) 111 The number of amino acid residues in each protein is given along the diagonal of the matrix. The upper triangular portion of the matrix indicates the number of identical residues found in common between each pair of proteins, as aligned in Figure IV. 1. The number of identical residues as a percentage of the total number in the smaller protein is given in parentheses. The lower triangular portion of the matrix indicates for each pair of proteins, the overall deviation (in A) in the positions of corresponding main chain atoms of residues 1 to 103. Values for oxidized tuna cytochrome c are averages for the inner and outer molecules in the crystallographic asymmetric unit -8-7-6-5-4-3-2-1 1 5 10 15 20 25 30 Yeast 1so-1 T E F K A G S A K K G A T L F K T R C L 0 C H T V E K G G P H K V G P N L Tuna G O V A K G K K T F V O K C A 0 C H T V E N G G K H K V G P N L R i c e A S F S E A P P G N P K A G E K I F K T K C A O c H T V O K G A G H K O G P N L 35 40 45 SO 55 60 65 70 Yeast Iso-1 H G I F G R H S G 0 A E G Y S Y T D A N I K K N V L W D E N N M S E Y L T N P Tuna W G L F G R K T G 0 A E G Y s Y T D A N K S K G I V W N N D T L M E Y L E N P R i c e N G L F G R 0 S G T T P G Y s Y S T A O K N M A V I W E E N T L Y D Y L L N P 7 5 80 85 90 95 100 Yeast 1so-1 K Y I P G T K M Tuna K Y I P G T K M R i c e K Y I P G T K M A F G G L K K E K D R N D L I T Y L K K A C E I F A G I K K K G E R 0 O L V A Y L K S A T S V F P G L J K P 0 E R A 0 L I S Y L K E A T S Figure rv.l. Primary sequence alignment of yeast iso-1-, tuna and rice cytochromes c. The amino acid sequences of yeast iso-1- (Smith et al., 1979), tuna (Kreil, 1963, 1965), and rice (Mori and Morita, 1980) cytochromes c are shown aligned so as to maximize the sequence homology. Amino acid residues which occur identically in all three protein sequences are enclosed by boxes. 131 A. Overall structural conservation 1. Polypeptide backbone conformation A comparison of the polypeptide backbone conformation of yeast iso-1-cytochrome c with those of tuna and rice cytochromes c, in terms of the average positional differences between main chain atoms of corresponding residues, is shown in Figure rv.2. Also, summarized in Table IV.2 are the overall r.m,s. differences in positions of common main chain atoms between individual pairs of cytochromes c. These data indicate that amongst these cytochromes c, there is a high degree of structural similarity. The overall main chain r.m.s. deviation between individual determinations of tuna ferricytochrome c (0.27 X; Takano and Dickerson, 1981b) provides a baseline against which 2.5 11111111111111 111111111111111111111111111111111111111111n i m i 111111111111111111111111111 i i 11111111 i 2 .0 -O 1-5-> 0 1 0 <C s-<D > < 0 . 5 -0.0 II I I I I I I II 1 I II i I I IiI I I I I I I I I I I I I I I I I I I I I I I I I I I I I I I II I I I I I I I I I I I I I I I I I I I I I I I I I I II I I I I I Ii ' , I I II i i i I I I I I I I I I I I I I -5 1 5 10 15 20 25 30 35 40 45 50 55 60 65 70 75 80 35 30 95 100 Residue number Figure IV.2. Comparison of the polypeptide backbone conformations of yeast iso-1-, tuna and rice cytochromes c. The plotted lines indicate the average deviations observed between the positions of main chain atoms in corresponding residues of yeast and tuna (a— B ) , and yeast and rice (A—A) cytochromes c. Differences in the positions of residues -5 to -1 in yeast and rice cytochromes c • exceed 3 X, and have been illustrated on the separate, inset scale. 132 the magnitude of differences between other pairs of cytochromes c can be assessed. Comparison of different species of cytochromes c yields values which are not greatly larger. The similarity in overall folding of yeast iso-1-, tuna and rice cytochromes c is also evident from a comparison of main chain dihedral torsion angles. Disregarding those phi and psi values affected by large localized differences in conformation (as discussed below), the overall r.m.s. difference between corresponding phi and psi angles are 9.9° and 9.4° respectively, between yeast and tuna, and 10.2° and 9.3° between yeast and rice cytochromes c. Comparisons of several members of a single protein family (e.g. the serine proteases and the globins) have established that tertiary structure can be highly conserved despite the presence of only moderate amino acid sequence homology (Creighton, 1984). This is clearly the case for yeast iso-1-, tuna and rice cytochromes c. For these three proteins, this result is particularly unsurprising, since residues whose side chains are directed into the solvent medium account for the vast majority of sites at which variability in amino acid sequence occurs (Figure rv.3). Amino Figure TV.3. Stereo drawing showing the sites of variability in amino acid identity between yeast iso-1-, tuna and rice cytochromes c. The positions of the CB side chain carbons are shown for those amino acid residues whose identities vary between the three cytochromes c. This figure serves to indicate the orientation of the variant side chains with respect to the polypeptide backbone of the cytochrome c molecule, which is represented here as an a-carbon backbone. Internally directed variant side chains that cause conformational differences between the three proteins (see text for discussion) have been labelled. 133 acid substitutions which result in substantial differences in polypeptide chain conformation are described in Section IV.B. Chothia and Lesk (1985) have determined that six regions of the cytochrome c molecule have an equivalent folding pattern in tuna cytochrome c, R. rubrum cytochrome c2, P. denitrificans cytochrome c5sa, and P. aeruginosa cytochrome cSii. These six segments of polypeptide chain (residues 5 to 11, 14 to 20, 27 to 33, 60 to 71, and 90 to 101) form the core structure of the cytochromes c, and all are involved in creating the heme pocket It is notable that between yeast iso-1-, tuna and rice cytochromes c, the same six regions constitute the most spatially conserved segments of main chain (see Figure IV.2). In contrast, those regions of the polypeptide chain looped away from the heme group account for the majority of instances of localized conformational differences between the three proteins (see Figures 111.15 and IV.2). 2. Side chain conformations Between yeast iso-1-, tuna and rice cytochromes c, the agreement between side chain dihedral angles of corresponding residues is also very high. Table IV.3 shows a comparison of side chain conformations in these three cytochromes c, in terms of both the overall average differences in X values and the distribution of difference values, for several subgroups of side chains. Between corresponding residues of both yeast iso-1- and tuna, and yeast iso-1- and rice cytochromes c, approximately 70% of all comparable side chain dihedral angles are equivalent [two side chain dihedral angles are considered equivalent if they differ by less than 40° (Summers et al., 1987; Kamphuis et al., 1985)]. The.results for the correspondence of comparable XI angles shown in Table IV.3 can be directly compared with results compiled by Summers et al. (1987) in their analysis of seven pairs of proteins having various degrees of amino acid sequence homology. The fairly high sequence homology between these three cytochromes c, about 60% amino acid identity between yeast iso-1- and both tuna and rice cytochromes c, gives rise to just over 70% equivalence in XI angles, which agrees well with the data presented in Table 5 of Summers et al. (1987). Although the overall mean values for angular deviations presented in Table IV.3 obscure the details of differences in the orientations of individual side chains, they also point out 134 Table IV.3. Comparison of side chain torsion angles in yeast iso-1-cytochrome c with those found in the tuna (T) and rice (R) proteins Side chain dihedral angles considered Protein and no. of residues Mean angular deviation3 ( ° ) Number of angles Total Having deviations1 0-10 10-20 20-30 30-40 >40c a) All T 103 37.4 155 66 28 6 7 48 comparable0 0.43 0.18 0.04 0.05 0.31 R 103 36.9 159 48 40 16 9 46 0.30 0.25 0.10 0.06 0.29 b) Comparable0 T 70 37.6 70 36 8 2 3 21 XI 0.51 0.11 0.03 0.04 0.30 R 72 33.2 72 32 15 6 2 17 0.44 0.21 0.08 0.03 0.24 c) Identical T 62 29.2 119 60 25 4 3 27 residues0 0.50 0.21 0.03 0.03 0.23 R 60 30.7 118 41 34 9 7 27 0.35 0.29 0.08 0.06 0.23 d) Conserved T 49 23.8 89 50 19 2 3 15 residues 0.56 0.21 0.02 0.03 0.17 in all R 49 28.9 89 34 29 6 2 18 three0 0.38 0.33 0.07 0.02 0.20 e) Invariant T 21 19.7 45 26 11 1 1 6 residues in 0.58 0.24 0.02 0.02 0.13 eukaryotic R 21 25.3 45 17 14 5 1 8 cyt c e 0.38 0.31 0.11 0.02 0.18 f) Residues T 18 9.1 35 28 5 0 0 2 that form 0.78 0.17 0.0 0.0 0.06 heme R 18 17.3 35 18 11 2 0 4 pocket 0.50 0.33 0.06 0.0 0.11 aThis value refers to the mean of the absolute values of the individual angular deviations. "Listed on the second line is the proportion of angles having deviations in each range. individual Xn (n=1,2,3,4 or 5) torsion angles in two given side chains were considered comparable if an equivalent pattern of branching is present beyond the third atom defining the torsion angle (e.g. LysXl * ValXl; LysX2 * AspX2; but AspX2 = PheX2). I^dentical residues between yeast and tuna, or yeast and rice cytochromes c are those for which the amino acid residue present in the tuna or rice sequence is the same as that found at the corresponding position in the yeast sequence. The conserved residues in these three proteins 135 Table IV .3 (continued) have the same identity in the sequences of all of yeast iso-1-, tuna and rice cytochromes c (see Figure IV.l). eThe invariant residues in the primary structures of eukaryotic cytochrome c are listed in Table 1.1. the high degree of similarity in positioning of side chains. Considering all pairs of comparable side chain torsion angles between both yeast iso-1- and tuna, and yeast iso-1- and rice cytochromes c, the overall average difference in conformation is approximately 37°. As was the case in the four pairs of related proteins having greater than 40% sequence homology considered by Summers et al. (1987), in yeast iso-1-, tuna and rice cytochromes x the side chains of residues whose identities show conservatism in the primary structure have a particularly high degree of conservation of conformation. Both the overall average deviations in side chain torsion angles, and the proportions of side chain angles showing only a small difference in conformation (Table IV.3) demonstrate that amino acid residues whose identities are the same in all three cytochromes c have more similar side chain conformations than those whose identities are the same in just yeast iso-1- and one of tuna or rice cytochrome c. Likewise, those residues which are invariant in the eukaryotic cytochromes c possess the greatest degree of conservation of side chain conformation. For these invariant residues (Arg38, Lys73 and Arg91 are excluded; see discussion below) the largest individual difference in the value of a side chain torsion angle is only 20°. As Figure IV.4 illustrates, the heme groups of all three cytochromes c have very similar conformations, with comparable degrees of distortion from planarity, and essentially identical conformations of both propionic acid and vinyl side groups. Amino acid residues that interact closely with the heme group are highly conserved (18 of 23 are identical) and also display a high degree of structural conservation. Considering 31 side chain torsion angles in these 18 identical residues (those of Arg38 in all molecules, and of Leu94 in rice cytochrome c are excluded), the largest torsion angle difference that occurs between yeast iso-1-, and both rice and tuna 136 Figure rv.4. Conformations of the heme groups and of the side chains of conserved residues in the heme pockets of yeast iso-1- (thick lines), tuna (medium lines) and rice (thin lines) cytochromes c. Distinctly different conformations are observed only for Arg38 (all three proteins) and Leu94 (rice cytochrome c). cytochromes c is only 17° (Table rv.3). Thus conservation of both the identity and conformation of side chains in the heme pocket, coupled with the similarity in folding of the polypeptide chain in the vicinity of the heme group (see discussion above), results in nearly identical heme environments in these three cytochromes c. Shellnut et al. (1981, 1979) have shown that the near-heme residues strongly influence the electronic distribution within the 7r-orbitals of the heme group. Thus it is likely that the highly conserved packing of protein groups within the heme crevice is an important determinant of the functional properties of the heme in cytochrome c. 3. Intramolecular hydrogen bonding As would be expected from the strong similarity in both main chain and side chain conformations of yeast iso-1-, tuna and rice cytochromes c, intramolecular hydrogen bonding interactions are also highly conserved between these proteins. Among the three cytochromes c, the only deviations in the pattern of main chain hydrogen bonding from that occurring in the yeast protein (see Table IIL10) are listed in Table IV.4. The most notable differences arise from unique conformations adopted by the polypeptide chain of tuna cytochrome c (more fully detailed in 137 Table IV.4. Differences between yeast iso-1-, tuna and rice cytochromes c in main chain hydrogen bonding Hydrogen bond Species of Occurrence cytochrome c 27 N - 29 O tuna absent 28 N - 17 0 tuna present 40 N - 57 O tuna absent 53 N - 50 0 rice present 55 N - 51 O rice absent 55 N - 52 O rice present 56 N - 53 O rice present 66 N - 62 0 tuna,rice present 69 N - 65 O tuna,rice absent 74 N - 71 O rice present 100 N - 96 0 rice absent 101 N - 98 O tuna present 103 N -100 O rice present The differences listed are with respect to the hydrogen bonding observed in yeast iso-1-cytochrome c, Table III. 10. Only the main chain hydrogen bonding involving residues common to all three cytochromes c (residues T to 103) has been considered. Section IV.B.l). The absence of the 27 N - 29 O hydrogen bond, and the occurrence instead of a 28 N - 17 O hydrogen bond, are associated with the absence of the j-turn at residues 27 to 29. The lack of an antiparallel 0 - sheet interaction between residues 37 to 40 and 57 to 59 precludes the occurrence of the 40 N - 57 O hydrogen bond. The other variations in the pattern of hydrogen bonding are all minor, and arise from small distortions from regular hydrogen bonding within a-helical segments of polypeptide chain. These results further demonstrate that the conformation of an a-helix can be subtly influenced by its local environment in the protein molecule (see Section III.B.3). A number of intramolecular hydrogen bonds involving both a main chain and a side chain atom are also conserved in all three cytochrome c molecules (see Table IV.5.). Additionally, the eight hydrogen bond interactions formed between the propionic acid oxygens of the heme group 138 Table IV.5. Conserved hydrogen bonds involving side chains in yeast iso-1-, tuna and rice cytochromes c 3 2 N - Asp93 OD1 Tyr46 OH - 28 0 Hisl8 ND1 - Pro30 0 52 N - Ser49 OG or Thr49 OG1 Asn31 ND2 - 21 0 Tyr67 OH - Met80 SD His26 NE2 - 44 0 Lys79 NZ - Ser47 0 His33 N - Asn31 OD1 Met80 N - Thr78 OG1 43 N - Tyr48 OH aFor those residues designated only by residue numbers, the identity of the amino acid is not conserved in all of yeast iso-1-, tuna and rice cytochromes c. and protein atoms of the cytochrome c molecule (see Table III.9) are conserved in yeast iso-1-, tuna and rice cytochromes c. However, two notable differences in the interaction of the propionic acid groups do occur. In tuna cytochrome c, the side chain of Arg38 forms a direct hydrogen bond with the propionic acid group of pyrrole ring A (see Section I V.B.I). In rice cytochrome c, residue 52 is an aspartic acid, rather than an asparagine as in yeast iso-1- and tuna cytochromes c, and thus the hydrogen bond interaction must involve an acidic proton rather than the hydrogen atom of an amide nitrogen. In addition, the hydrogen bonding atom of the Asp52 side chain is the lower, rather than the upper atom. B. Large conformational differences between yeast iso-1-, rice and tuna cytochromes c 1. Polypeptide chain backbone Despite a high degree of structural similarity between these three proteins, the main chain conformation of yeast iso-1-cytochrome c differs substantially from those of rice and tuna cytochromes c at a number of locations (see Figure IV.2). In the majority of these instances, the differences observed are localized at sites of amino acid substitutions. The surface 0-turn that includes Gly23 has a distinct positioning in rice cytochrome c (see Figure IV.5). This apparently results from the substitution at residue 24 of an alanine for the glycine present in both the yeast and tuna proteins. A CB atom on residue 24 in yeast 139 Figure IV.5. Differences in conformation between yeast iso-1- (thick lines) and rice (thin lines) cytochromes c at residues 20 to 25. A loop structure is formed by residues 18 through 27 in both proteins, and the hydrogen bonds (dashed lines) joining the two arms of the loop (24 N to 21 O, and Thrl9 OG1 to 25 O) are conserved. However, the peptide bond Unking residues 24 and 25 is of opposite orientation in the two proteins. Also, occurring only within the loop of the yeast protein is WatllO, which forms a hydrogen bond to the carbonyl group of Pro25. cytochrome c would be positioned within 2.9 X of both Glu21 O and Thrl9 OG1. Thus the presence of Ala24 in rice cytochrome c appears to cause the /3-turn to have a more open conformation, with the length of the hydrogen bond between 24 N and 21 O being 3.14 X, as compared to 2.86 X in yeast cytochrome c. Consequently, residues 24 to 26 assume a completely different conformation in the rice protein to allow the polypeptide chain beyond residue 26 to maintain close packing interactions with the rest of the molecule. These conformational changes are mediated by the ^ angle of Ala24 having a value -180° different from that in the yeast and tuna proteins, as well as the presence of a glycine at position 25 (Pro in yeast; Lys in tuna) which adopts a conformation inaccessible to residues with a side chain. Another example of a localized conformational difference is observed in the region of residue 56, which is displaced further into solvent in tuna cytochrome c (see Figure IV.6). This appears to arise from the replacement of two small side chains, Ser40 and Val57 in both yeast and rice cytochromes c, with bulkier ones, Thr40 and Ile57 in tuna cytochrome c. In the yeast protein, residues 37 to 40 interact closely with residues 57 to 59 in an antiparallel /3- sheet type structure (Figure III.8). Consequently, if a threonine side chain were to occur at position 40, its CG2 atom would conflict sterically with the side chain of residue 57. In addition, the CD1 atom 140 Figure rv.6. EHfferences in conformation between yeast iso-1- (thick lines) and tuna (thin lines) cytochromes c at residues 55 to 57. Residues 38 through 41, and 54 through 60 are shown for both proteins. Hydrogen bonds formed between these adjacent strands of polypeptide chain in the vicinity of residues 40 and 57 are shown as dashed lines. Note that the bridging Watl48 occurs only in the tuna protein. of an Ile57 side chain would be positioned within 3.0 A of the Trp59 indole ring. Thus, in tuna cytochrome c, the hydrogen bonds Ser40 N - Val57 O and Val57 N - Ser40'OG present in yeast cytochrome c cannot be formed, and instead De57 interacts with Thr40 through hydrogen bonds made via a bridging water molecule. Beyond this region, the conformation of the polypeptide chain is restored to that present in yeast and rice cytochromes c. This is made possible by Gly56 (asparagine and alanine in the yeast and rice proteins, respectively) adopting a conformation permitted only for glycine residues. The maintenance in all three proteins of an interaction between the side chain hydroxyl group of residue 40 and the main chain amide nitrogen of residue 57 is notable. Proudfoot et al. (1989) have shown that replacements of Lys, Val or Phe at position 40 destabilize horse cytochrome c, and suggest that a hydrogen bond formed by residue 40 is essential for maintaining the integrity of the bottom fl-loop of the molecule. The conformational differences observed about residues 23 to 25, and 56 to 57 emphasize the importance of glycines in providing to the polypeptide chain the necessary flexibility to accommodate the substitution of bulky side chains elsewhere in the cytochrome c molecule. This point is further emphasized by patterns of conservation of amino acid sequence in eukaryotic 141 cytochromes c. In the -90 known primary sequences, where a residue with a side chain (usually alanine) occurs at position 24, it is almost always accompanied by a glycine at position 25; and where a threonine (instead of serine) occurs at position 40, and/or a residue larger than valine (most frequently isoleucine) occurs at position 57, a glycine is present at position 56. Substantial differences in conformation are also observed at the polypeptide chain termini of yeast, tuna and rice cytochromes c. In all three cytochromes c, the N-terminus is only loosely associated with the rest of the molecule, and each N-terminal region has a unique conformation (Figure IV.2). The N-terminal extension characteristic of fungal and plant cytochromes c is positioned differently in yeast as compared to rice cytochrome c. In yeast cytochrome c, bulkier side chains at three positions (Phe vs. Ala-3, Glu vs. Pro88, and Asn vs. Ala92) result in the N-terminus being displaced further into the solvent medium, whereas in the rice protein this region is packed against the surface of the body of the molecule. As Figure IV.2 shows, the polypeptide chain conformations of the three proteins become equivalent only after residue 3. The C-terminus of tuna cytochrome c has a unique conformation due to the occurrence of a tryptophan residue at position 33. In yeast iso-1-cytochrome c, Glul03 OXT is hydrogen bonded to His33 NE2, whereas in tuna, the bulky Trp indole ring causes the C-terminal carboxylate to be rotated away from this side chain. That the N - and C-termini of these three cytochromes c differ greatly in conformation is indicative of their relatively unconstrained positioning on the surface of these molecules. The unique conformation observed for tuna ferrocytochrome c at Lys27 is more difficult to rationalize. There are no amino acid substitutions in this region of the polypeptide chain with respect to the yeast protein, and in addition, in tuna ferricytochrome c, residue 27 has the same conformation as that in yeast iso-1-cytochrome c. It may be that whereas in the yeast protein, the strained conformation of residue 27 is stabilized by a Lys27 NZ - Leul5 O intramolecular hydrogen bond (see Figure III.7), in tuna ferrocytochrome c, a hydrogen bond between the side chain of Lys27 and an adjacent molecule in the crystal lattice serves to relieve this strained conformation. It should be noted that the occurrence of the same conformation of Lys27 in both 142 reduced (yeast iso-1-) and oxidized (tuna and rice) forms of cytochrome c brings into question the proposal of Rackovsky and Goldstein (1984) that this residue plays a role in redox-state dependent conformational switching. 2. Conserved amino acid side chains with variant conformations Cytochrome c contains a large number of fairly conservative lysine residues. Of the 16 lysine residues present in yeast iso-1-cytochrome c, all but 4 also occur in at least one of tuna or rice cytochromes c. With the exception of Lys79, whose side chain is involved in forming a conserved hydrogen bond interaction between the left and right halves of the molecule (see Figure III.9), the side chains of the majority of these residues are not positioned similarly. The large average deviation (50.5°) in side chain torsion angles of the lysine side chains that are in common between yeast iso-1- and tuna or rice cytochrome c is not surprising, as these lysines are located on the surface of the molecule. Their mobility and lack of intramolecular hydrogen bond formation are consistent with their proposed role in the interaction with negatively charged groups of redox partners (Ferguson-Miller et al., 1978). Arg38 is invariant in the primary sequences of eukaryotic cytochromes c and is thought to act in stabilizing the buried, propionic acid group of pyrrole ring A. However, as Figure IV.7 shows, in each of yeast iso-1-, rice and tuna cytochromes c, the side chain of Arg38 has a distinct conformation and thus there exists a correspondingly different mode of interaction between the guanidinium group and the heme propionic acid. In yeast, the NH1 and NE atoms form hydrogen bonds to two water molecules that are in turn hydrogen bonded to the heme propionyl OlA atom (see Figure 111.11a). In rice, the guanidinium group of Arg38 interacts end-on with the two bridging water molecules, with NH1 and NH2 donating hydrogen bonds. In tuna cytochrome c, Arg38 NE hydrogen bonds a lone bridging water molecule, while NH1 forms a direct hydrogen bond to the OlA heme atom. These differences appear to be due to amino acid substitutions in the local environment of Arg38 in the three cytochromes c. In yeast iso-1-cytochrome c, steric conflicts between the NH1 atom and the CGI atom of Ile35, which replaces Leu35 occurring in tuna, prevent the guanidinium group of Arg38 from directly 143 Figure IY.7. Comparison of the conformations of the Arg38 side chains in yeast iso-1- (top), tuna (middle) and rice (bottom) cytochromes c. Shown for each of the three protein molecules are Axg38, other protein groups in its direct vicinity, associated internal water molecules, and the hydrogen bonding network (dashed lines) involving its guanidinium group. 144 approaching the buried propionic acid group of the heme. In rice cytochrome c, the even more external positioning of the guanidinium group of Arg38 seems to be due to the unique hydrogen bonds formed between Arg38 NH2 and the OG1 atoms of two nearby surface residues, Thr42 and Thr43 (Gln42 and Ala43 in both yeast and tuna cytochromes c). In the case of the side chain of invariant Arg91, the guanidinium group occupies a similar position in all three protein molecules, but the alkyl portion takes distinct paths (see Figure IV.8). Takano and Dickerson (1981a) have suggested that the role of Arg91 is to hydrogen bond and thereby stabilize the conformation of the fairly extended 80's region of the polypeptide chain. However, the different orientations of the Arg91 guamdinium group require this to be accomplished by different means in each molecule: in tuna cytochrome c, hydrogen bonds are formed between NE and Ile85 O, and NH2 and Lys86 Or in yeast between NH2 and both Leu85 O and Lys86 O; and in rice between NH1 and Lys86 O only. The conformation of the Arg91 side chain is influenced by nearby amino acid residues, particularly residue 65 (Met in tuna): in yeast, the NE atom is hydrogen bonded to Ser65 OG; and in rice cytochrome c, the guanidinium group is stacked against the aromatic ring of Tyr65. In addition, in tuna cytochrome c the side chain of Figure IV.8. Comparison of the conformations of the Arg91 side chains in yeast iso-1- (thick lines), tuna (medium lines) and rice (thin lines) cytochromes c. Arg91, along with the polypeptide backbone in its direct vicinity and the amino acid side chains that appear to influence its conformation are shown for each molecule. Hydrogen bonds formed by the guaniijinium group of Arg91 are shown as dashed lines. 145 Arg91 appears to be stacked against the side chain carboyxlate group of Glu69 (Thr and Leu in yeast iso-1- and rice cytochromes c, respectively). It may be of significance in rice cytochrome c, in which Arg91 forms only one hydrogen bond to the 80's region, that the presence of prolines at residues 83 and 88 could provide additional structural rigidity to the 80's loop. Interestingly, replacement of Ala83 by Pro in horse cytochrome c stabilizes the protein against both alkaline and thermal denaturation (Wallace et al., 1989). The conformation of the highly conserved residue Leu94 differs in the rice protein from that in yeast and tuna cytochrome c by a 120° rotation in the X2 side chain torsion angle. In all three proteins, Leu94 is packed in the hydrophobic heme pocket, making close contacts with the side chains of residues 9, 68, 85 and 98 (all leucines in yeast iso-1-cytochrome c). The two conformations observed for Leu94 likely represent alternate means of achieving maximal packing efficiency. In yeast cytochrome c, both CD atoms of Leu94 are directed toward the CB carbon atom of Leu9. A similar conformation is observed in the tuna protein, in which the side chain of Leu9 is replaced by the CGI atom of the shorter threonine side chain. However, in the rice protein, steric constraints arising from the replacement of Leu9 by an isoleucine results in an alternate conformation for Leu94, in which the CD2 side chain atom is packed against Leu98. These results demonstrate that conserved or invariant residues do not necessarily carry out their role in an identical manner in different members of a protein family, and that there is flexibility in the formation of their intramolecular interactions. In addition, the intricate interplay between the conserved residue and compensatory changes nearby in the protein environment make difficult the assignment of definitive roles to conserved residues based on the inspection of just one member of the protein family. Nonetheless, the different modes by which a conserved residue can carry out its role provides clues as to the specific function of that residue. C. Oxidation-state dependent conformational differences With the completion of the high resolution structure of reduced yeast iso-1-cytochrome c, there are now available accurate structural data for two cytochromes c in the reduced state (yeast, tuna) and two in the oxidized state (tuna, rice). The conformational differences between tuna 146 ferror and ferricytochromes c have been documented by Takano and Dickeison (1981a,b). The availability of the yeast and rice structures allows for a further assessment of oxidation-state dependent structural changes in cytochrome c. Comparison of the superposed structures of all four proteins shows that the pattern of differences between the reduced and oxidized cytochromes c are similar to those observed considering only the two redox forms of tuna cytochrome c. Overall, the oxidation-state dependent structural changes are very small, with no significant alterations in main chain conformatioa As observed by Takano and Dickerson (1981b), the largest changes occur at the lower left of the heme pocket (see Figure IV.9). These changes appear to be centred around an internal water molecule conserved in yeast, tuna and rice cytochromes c (Watl66 in yeast iso-1-cytochrome c; see Figure HLH and Table JV.7). In the reduced yeast iso-1- and tuna Figure IY.9. Oxidation-state dependent structural differences in cytochrome c. Comparison of the structures of reduced yeast iso-1- and tuna cytochromes c (thick lines) with those of oxidized rice and tuna cytochromes c (thin lines) shows that the most substantial structural changes accompanying oxidation/reduction occur in the vicinity of the buried water molecule located below Met80 in the heme crevice. Significant shifts also occur in the positions of two of the side chains, Tyr67 and Asn52 (Asp in rice cytochrome c), to which this water molecule is hydrogen bonded; and in the position of the side chain of Trp59. 147 cytochrome c structures, this water molecule is positioned -6.5 X from the heme iron atom. In the oxidized forms of tuna and rice cytochromes c, this water molecule has undergone a movement of about 0.9 X and is positioned -0.6 X closer to the heme iron. The side chain of Asn52 (Asp in rice), which is hydrogen bonded to this water molecule, moves by almost 1 X. The side chains of Tyr67 and Trp59 shift toward the rear of the molecule (by about 0.4 X). This series of conformational changes likely occurs in response to, or alternatively in order to stabilize, the increased positive charge centred at the heme iron in the oxidized form of the cytochrome c molecule (Takano and Dickerson, 1981b; and see later discussions). Other smaller shifts observed by Takano and Dickerson (1981b) are not unequivocally evident when the four cytochromes c are considered. At this point, it cannot be established whether such small conformational changes are less evident when yeast and rice cytochromes c are included in the comparisons, due to the greater overall structural dissimilarity arising from amino acid sequence differences; or the differences as observed between the two redox forms of tuna cytochrome c are larger than real, as a result of limitations in the accuracy of the structure determinations and refinement procedures. Work in progress on the high resolution structure of the oxidized form of yeast iso-1-cytochrome c, which crystallizes isomorphously with the reduced form, will provide additional insight on oxidation-state dependent conformational changes. D. Crystal packing Since those eukaryotic cytochromes c whose structures have been determined are structurally similar and all have been crystallized from concentrated ammonium sulfate solutions, the various crystal forms might be expected to exhibit related crystal packing. This has been shown to be the case for the oxidized forms of tuna and horse cytochromes c (Swanson el al., 1977), which have 82% sequence identity. However, between cytochromes c possessing greater sequence divergence, the nature of the intermolecular contacts occurring in the crystalline forms are generally not conserved. A likely explanation for this poor conservation is that the precise packing contacts are in most cases made by the side chains of surface residues, which are frequently variant in both amino acid identity and spatial positioning. One notable aspect of crystal packing interactions that 148 does tend to be conserved in the various crystal forms is the specific regions on the surface of the cytochrome c molecule that participate in forming intermolecular contacts. In all crystal forms of cytochrome c, the segment of polypeptide chain from residues 54 to 60 is involved in tight intermolecular contacts, although the region of the symmetry-related molecule with Which it interacts varies. Other regions of the cytochrome c molecule commonly involved in crystal contacts are centred at residues 8, 26 and 45. E. Internal mobility Crystallographic temperature factors can be used to compare the internal mobility of the yeast iso-1-cytochrome c molecule with that of tuna and rice cytochromes c. Figure IV.10 shows for each of the three cytochromes c the extent to which the B-factors of individual residues along the polypeptide chain differ from the overall average B of the protein molecule. Several observations can be made from a comparison of the three profiles. First, there is good agreement among the three cytochromes c of those regions of the polypeptide chain possessing markedly lower or higher flexibility than that of the adjacent polypeptide chain. The most rigid regions in rice and tuna cytochromes c are identical to those described above for yeast cytochrome c (see Section III.E). In addition, the three molecules have in common several regions of polypeptide chain, centred at residues 23, 38, 43, 55, 73, 83 and 103, which have a high degree of mobility. Nonetheless, differences in flexibility between the three cytochromes c are apparent at a number of locations in the polypeptide backbone. The most significant of these and possible explanations are summarized in Table IV.6. Localized differences in molecular flexibility between the three cytochromes c appear to be caused by two factors: the effects of amino acid substitutions and differences in crystal packing interactions. A comparison of Figures IV.10 and IV.2 also shows that the regions of the polypeptide chain at which the flexibility of yeast iso-1-cytochrome c differs from that of tuna or rice cytochrome c correspond to the regions at which yeast iso-1-cytochrome c differs in conformation from these other proteins. This result indicates that conserved intramolecular interactions are responsible for the observed similarities in molecular flexibility between the three cytochromes c. 149 Residue number Figure IV.10. Comparison of the polypeptide backbone flexibilities of yeast iso-1- ( ), tuna ( ) and rice ( ) cytochromes c The plots represent comparisons of the crystallographic ' temperature factors observed for common residues (1 to 103) in the three proteins. To facilitate comparisons, each protein was treated in the following manner: first, the overall mean, and standard deviation from the mean, of the temperature factors of all main chain atoms were determined; then, the overall mean value was subtracted from the average temperature factor of the main chain atoms of each residue, and these resultant values were divided by the standard deviation. The objective of this analysis is to correct for differences between the three cytochrome c structures in the degree of lattice disorder (Ringe and Petsko, 1985), as well as in the degree of variation in the temperature factor values in each structure, which may be affected by the tightness of restraints used during the respective refinements. The overall means and standard deviations for the main chain temperature factors of yeast iso-1-, tuna, and rice cytochromes c are 13.4 ± 5.3, 15.3 ± 3.9, and 9.6 ± 2.4, respectively. Considering the good agreement between the temperature factor profiles determined for yeast iso-1-, tuna and rice cytochromes c, it is thus also of note that the results pertaining to the internal mobility of the cytochrome c molecule obtained crystallographically are consistent with those obtained using the methods of NMR (see previous discussion, Section III.E) and molecular dynamics. As discussed by Northrup et al. (1980, 1981), the r.m.s. atomic fluctuations of individual 150 Table FV.6. Differences in mobility between the polypeptide backbones of yeast iso-1-, tuna and rice cytochromes c Mole- Residues Diff- Possible explanation cule erence Rice 5-13 high Yeast 23-27 low Tuna 26-28 high Rice 34-39 low Rice 42-44 low Tuna 50-53 low Yeast 55-63 high Rice 64-67 low Rice 88-89 low Tuna 89-90 high Yeast 100-103 low Lacks lattice contacts, centred at residues 5 and 8, present in both yeast iso-1- and tuna cytochromes c. Also, hydrophilic side chains at Glu7 and Lys8 induce greater main chain mobility (Karplus and Schulz, 1985). In yeast iso-1-cytochrome c, rigidity of this helical segment may be further increased by the presence of two intra-helical hydrogen bonds formed by side chains of threonine residues. Pro25 adds rigidity. Also, lattice contact centred at residue 25 present Altered conformation of this region of main chain, which makes few hydrogen bond interactions with rest of molecule. Stabilized by crystal lattice contacts centred at residues 37 to 39. Pro44 adds rigidity. Stabilized by crystal lattice contacts centred at residue 50. Flexibility induced by two pairs of adjacent residues with hydrophilic side chains (Lys54-Lys55, and Asp60-Glu61). Also lacks threonine side chain at position 63, which in tuna and rice cytochromes c, stabilizes the conformation of the start of an a-helix by forming an intrahelical hydrogen bond to the carbonyl group of residue 60. Forms intramolecular interactions with extension at N-terminus of the polypeptide chain. Pro88 adds rigidity. Lys88 and Gly89 induce increased main chain mobility. Position of C-terminus fixed by intramolecular salt bridge to His33 imidazole, and by crystal lattice interactions. residues indicated by molecular dynamics calculations are in good agreement with X-ray diffraction results. Considering that the folds of yeast iso-1-, tuna and rice cytochromes c are very similar, it can be concluded that these results as a whole confirm that the dynamics of internal movements of cytochrome c are inherent in the overall three-dimensional structure of this protein molecule. F. Internal packing efficiency A structural feature notably conserved in yeast iso-1-, tuna and rice cytochromes c is a high packing efficiency in the heme pocket Between these three cytochromes c, a number of 151 examples are observed in which compensating changes occur at a site spatially adjacent to the site of the introduction of a small side chain. These changes involve the substitution of a large side chain, or alternatively the altered conformation of a side chain. In the yeast protein, the shorter Ile35 side chain (leucine in tuna and rice) is compensated for by the longer side chain of Met64 (Leu64 in tuna and rice cytochrome c). In the tuna protein, neighboring the small side chain of Val95 is the internally oriented, hydrophobic side chain of Met65. In contrast, the side chains of Ser65 in yeast iso-1- and Tyr65 in rice cytochrome c are directed more into the external solvent medium, in order to accommodate an isoleucine residue at position 95. Two other examples, involving Arg38 and Leu94, were described earlier. G. Solvent structure 1. Bound water molecules A study was made to determine if the high degree of homology observed between the tertiary structures of yeast iso-1-, tuna and rice cytochromes c is reflected in a correspondingly high degree of homology between their respective solvent structures. Of the water molecules located in the present structure determination of yeast iso-1-cytochrome c, 28 were found to have counterparts in tuna cytochrome c and 25 in rice cytochrome c. However, only nine water molecules were found to occupy sites common to all three structures. Table IV.7 lists these conserved water molecules and the hydrogen bonding interactions formed by each. Table IV.7 also shows that the B- factors of the conserved water molecules are lower than average, undoubtedly reflecting the fact that these water molecules form a greater than average number of hydrogen bonds to the protein. These water molecules are likely to be of particular importance in stabilizing the folded state of the cytochrome c molecule. The unexpectedly poor overall homology in the water structures of yeast iso-1-, tuna and rice cytochromes c prompted an inspection, in each individual protein molecule, of the sites corresponding to those occupied by a water molecule in one or both of the other protein molecules. Particular attention was paid to sites at which a water molecule is hydrogen bonded to a large number of main chain or invariant side chain groups, and to sites occupied by a water 152 Table TV.7. Conserved water molecules in yeast iso-1-, tuna and rice cytochromes c Water B-factor (A2) Protein atoms involved in hydrogen bonding 113 21.7 Ser47 N 121 17.2 39 0, 42 N, Hem 01A, Arg38 guanidino 122 11.1 Lys79 0, 81 N 126 32.8 Glnl6 OE1 160 24.3 Asp93 0D2 166 12.2 Asn(Asp)52 ND2(OD2), Tyr67 OH, Thr78 OG1 172 28.4 Asn70 0D1, Lys(Tml)72 N, Phe82 0 185 29.9 Tyr46 O, Tyr48 N 196 25.3 Phe36 N, 102 O The water molecule designations and the temperature factors listed refer to the yeast iso-1-cytochrome c structure. The hydrogen bond interactions listed are those found to be homologous in all three cytochromes c. (For those residues designated only by residue numbers, the identity of the amino acid is not conserved in all of yeast iso-1-, tuna and rice cytochromes c.) The overall average B factor for these water molecules is 22.6 A 2 . molecule in two of the three cytochromes c. It was found that in the majority of cases, the absence of a water molecule could be attributed to the occlusion of the binding site by either the altered conformation of an adjacent homologous amino acid side chain, or a substitution at a nearby residue in the protein molecule. Only in a few cases was the absence or presence of a water molecule influenced by packing interactions in the crystal lattice. An additional consideration in the low overall homology in solvent structure is the lesser extent to which the solvent structures of tuna and rice cytochromes c were characterized (see Table IV.l). Of the four completely internal water molecules present in yeast iso-1-cytochrome c (see Section III.D.3), only Watl21 and 166 have counterparts in both tuna and rice cytochromes c. In the rice protein, WatllO is absent because the altered conformation of the nearby (3-turn affects the position of the carbonyl group of residue 25, which participates in coordinating this water molecule in yeast and tuna cytochromes c (see Figure IV.5). In tuna cytochrome c, because Arg38 interacts directly with the heme propionic acid group, the bridging Watl68 (see Figure IV.7) is absent The overall average positional deviation of the two homologous internal water molecules is 153 0.49 A. 2. Anion binding site Yeast iso-1-, rice and tuna cytochromes c were all crystallized from concentrated ammonium sulfate solutions, and the start of the N-terminal a-helix in the latter two proteins has a conformation similar to that in yeast iso-1-cytochrome c. Nonetheless, the sulfate binding site observed in yeast iso-1-cytochrome c (see Section III.D.4) is riot occupied by a sulfate ion in either the tuna or rice proteins. Structural explanations for this difference may be the replacement of Ser2 by a negatively charged aspartate in tuna cytochrome c, and the occurrence of a proline at residue 3 in rice cytochrome c which precludes the participation of the amide group of this residue in hydrogen bonding. A further consideration is that hydrogen bonding interactions to the fourth sulfate oxygen atom, which are provided through packing contacts in yeast iso-1-cytochrome c, may be required to sequester a sulfate ion. 154 V. SERINE 82 VARIANT OF YEAST ISO-1-CYTOCHROME c A. Details of the structure determination 1. X-ray diffraction data Diffraction data to 2.8 X resolution, 2959 reflections in total, for the Ser82 variant of iso-1-cytochrome c were collected from a single crystal. Individual backgrounds were used in the processing of diffraction intensities. For this set of measured structure factors, a scale factor of 38.2 was indicated by a linear rescale against all common structure factors from the data set for wild-type iso-1-cytochrome c. The R-factor between the two data sets, [S |FQ(wild-type) -hkl F0(Ser82)|] / 2jF0(wild-type), was 0.286. hkl | 2. Difference map A difference map OTlgure V.l) was calculated using the coefficients F0(wild-type) -FQ(Ser82), and phases derived from a wild-type iso-1-cytochrome c atomic model which had been refined at 2.0 X resolution to an R-factor of 0.199. This difference map confirmed the Figure V.l . Stereo drawing of the FQ(wild-type) - FQ(Ser82) difference map in the vicinity of residue 82. The atomic skeleton of wild-type iso-1-cytochrome c determined at 2.0 X resolution is superimposed on the difference electron density envelopes. Positive density (solid lines) has been contoured at two levels, and negative density (dashed lines) at a single level. 155 replacement of Phe82, as only one large peak was observed, corresponding to a volume of positive density enveloping the position occupied by the phenyl ring of Phe82 in the wild-type molecule. Smaller positive peaks located adjacent to the polypeptide backbone of residues 81 to 84 indicated that in the Ser82 variant, small conformational rearrangements may occur in the vicinity of the substitution site. No other significant positive or negative peaks were evident 3. Refinement of the structure of the Ser82 variant Since the difference map indicated that conformational rearrangements were small and localized to a few specific regions of the iso-1-cytochrome c molecule, an initial model for the Ser82 variant was constructed from the 2.0 A resolution wild-type structure. The phenylalanine side chain at position 82 was replaced with a serine side chain having the same XI torsion angle. Table V.l. Agreement with ideal stereochemistry in the final refined model of the Ser82 variant of yeast iso-1-cytochrome c at 2.8 A resolution Class of restraint R.m.s. deviation from ideality 1-2 bond distance 1-3 angle distance 1-4 planar distance Planar Chiral centre Non-bonded contact3 single torsion multiple torsion possible hydrogen bond Staggered ( ± 6 0 ° , 180°) torsion angle Planar torsion angle (0 or 180°) Temperature factor 1-2 bond (main chain) 1-3 angle (main chain) 1-2 bond (side chain) 1-3 angle (side chain) 0.014 A 0.036 A 0.043 A 0.014 A 0.160 A 3 0.216 A 0.217 A 0.231 A 28.8° 2.8° 0.5 A 2 0.8 A 2 0.4 A 2 0.8 A 2 aThe r.m.s. deviations from ideality for this class of restraint incorporate a reduction of 0.1 A from the radius of each atom involved in a contact 156 The original wild-type iso-1-cytochrome c model included 62 water molecules, which were incorporated into the initial refinement model for the Ser82 variant The Ser82 variant was refined against diffraction data with F > 2a p in the resolution range 5.5 to 2.8 X (1645 reflections in total, representing 75% of the available data). The course of refinement included two rounds of manual adjustments to the atomic model, the identification of an additional 10 water molecules, and 30 cycles of least-squares refinement The manual adjustments required were minor. For the final refined structure of the Ser82 variant of iso-1-cytochrome c, the R-factor is 0.170, and the agreement with ideal stereochemistry is as shown in Table V.l. B. Description of structural changes The substitution of a serine at position 82 is accommodated without any gross conformational rearrangements in the native iso-1-cytochrome c fold. Figure V.2 shows a comparison of the Ser82 variant and the wild-type protein in terms of the average positional difference between main chain atoms and the differences in conformational torsion angles of corresponding residues. The overall r.m.s. difference between corresponding main chain atoms is 0. 28 X; the overall r.m.s. differences between phi and psi angles are 8.1° and 9.2°, respectively. The heme groups of the Ser82 variant and wild-type iso-1-cytochromes c do not differ significantly in either overall positioning or conformation, with the mean difference in atomic positions of the 43 heme atoms being 0.17 X. Figure V.2 shows that significant structural perturbations do occur in the direct vicinity of the amino acid substitution. In addition, the occurrence of a serine residue at position 82 gives rise to subtle conformational changes remote from the substitution site. 1. Vicinity of the substitution site The conformational differences between the wild-type and Ser82 variant iso-1-cytochromes c occurring in the direct vicinity of the substitution site are shown in Figure V.3. The replacement of the large bulky phenylalanine side chain with a smaller serine side chain 157 Residue number Figure V.2. Comparison of the polypeptide backbone conformations of the Ser82 variant and wild-type iso-1-cytochromes c. The lower plot indicates the average deviation observed between the positions of main chain atoms in corresponding residues of the two proteins. The upper plot indicates the deviations in the main chain conformational torsion angles <t> (—) and i/> ( ) of conesponding residues. results in the polypeptide chain at residues 83 and 84, formerly packed against the left face of the phenyl group of Phe82, shifting downward and toward the pocket occupied by this group in the wild-type protein. This shift is mediated largely by alterations of +21° and -26° in the \p angles of Ala81 and Gly84, respectively. The position of the side chain of Argl3 also differs in the two proteins. In wild-type iso-1-cytochrome c, the alkyl portion of this side chain packs against the external edge of the phenyl ring of Phe82, and the guanidinium group is hydrogen bonded to water molecules. In the 158 Figure V.3. Stereo drawing of the region around residue 82 in the Ser82 variant (thick lines) and wild-type (thin lines) iso-1-cytochromes c. The heme groups and the polypeptide chain of residues 13 through 14, 68 through 71, and 79 through 85 of the two proteins are shown superimposed. Two unique structural features in the Ser82 variant, the water molecule 167 hydrogen bonded to Ser82 OG, and the hydrogen bond between Argl3 NH1 and Gly84 O (dashed line), are also shown. Ser82 variant, the guanidinium group of Argl3 is oriented to form a hydrogen bond with the carbonyl group of residue 84. This interaction is made possible by two factors. First, the smaller side chain of Ser82 allows the side chain of Argl3 to adopt a conformation which in the wild-type protein would generate prohibitive steric conflicts with the phenyl ring of Phe82. Second, the inward movement of residues 83 and 84 places the 84 O atom closer to Argl3. Indeed, it is possible that the observed shift in position of Gly84 is due in part to the hydrogen bond interaction formed with Argl3. That the side chain of Argl3 in the Ser82 variant forms an intramolecular interaction is reflected in its better defined appearance in electron density maps, and significantly lower atomic temperature factors (average 18 X2, as compared to 25 X2 in the wild-type protein). 159 2. Solvent accessibility to the heme crevice In the wild-type protein, the phenyl ring of Phe82 plays an important structural role in excluding solvent from the heme pocket Thus, in the Ser82 variant, the occurrence of the smaller serine side chain has created a channel allowing access of solvent down into the heme pocket (Figure V.4). The mouth of the channel is formed by the hydroxyl group of Ser82, the main chain of residues 83 and 84, the side chain of Leu85, and the CBB atom of the heme group, whereas the floor is formed by the side chain of Leu68 and the CE atom of the Met80 heme ligand. Although one water molecule (Watl67), hydrogen bonded to Ser82 OG, is positioned at the entrance to the channel, none are observed within the channel. This is consistent with the apolarity of the groups lining the internal portion of the channel. The exposure of the heme to the solvent medium is greatly increased in the Ser82 variant, with the total surface area directly accessible to solvent being 70.0 X2, as compared to 48.8 X2 in wild-type iso-1-cytochrome c. In the Ser82 variant, the presence of the solvent channel exposes to solvent the CBB atom of the heme, and the side chains Of Leu68 and Met80, three groups which are completely inaccessible to solvent in wild-type iso-1-cytochrome c. It is notable that in the Ser82 variant, these hydrophobic groups have shifted positionally, apparently in order to minimize their contact with solvent The CBB heme atom has moved 0.8 X toward a non-polar region at the rear of the molecule. This movement represents the only significant difference between atomic positions of the heme groups of the Ser82 variant and wild-type iso-1-cytochromes c, and is facilitated primarily by an adjustment in the conformation of the adjacent thidether linkage to Cysl4. At the floor of the solvent channel, the Leu68 CD1 and CD2, and Met80 CE methyl groups have undergone shifts of 0.7, 1.2 and 0.7 X, respectively, further down toward the interior of the iso-1-cytochrome c molecule. The exposure of these normally buried groups also further demonstrates the marked increase in solvent accessibility to the heme pocket that has occurred in the Ser82 variant 160 Figure V.4. Comparison of the molecular surface in the region of residue 82 in wild-type (top) and Ser82 variant (bottom) iso-1-cytochromes c. The dots outline those regions of the surface of the protein molecules which are accessible to solvent, and were calculated (Connolly, 1983) using a probe sphere of radius 1.4 A. The directions of view are oblique to the Met80 face of the heme groups. In the Ser82 variant, a channel extends from the surface of the protein, immediately behind the main chain of residues Gly83 and Gly84, down to the side chains of Leu68 and Met80. 3. Remote from the substitution site A number of conformational differences between the Ser82 variant and wild-type iso-1-cytochromes c occur around Trp59 and Watl66. These groups have positions near the 161 propionyl carboxyl group of the heme pyrrole ring A. This carboxyl group is located at the bottom of the heme pocket, and -13 X from the side chain of Ser82. The hydrogen bond interactions formed by this group in wild-type iso-1-cytochrome c are detailed in Figure 111.11. The position of the Trp59 side chain in the Ser82 variant differs with respect to that in the wild-type molecule by 0.75 X overall, with shifts greater than 1 X occurring for the CZ2, CZ3 and CH2 atoms (see Figure V.5). This difference is particularly notable considering the well-defined electron density for the aromatic rings in both structures, and the relatively small overall average shift (0.2 X) observed for the side chain atoms of the other five aromatic residues occurring in the heme pocket The movement of the Trp59 indole ring arises primarily from a -15° rotation in the Xl torsion angle of this side chain, and results in the loss of the hydrogen bond between the NE1 atom and the 02A propionic acid oxygen (the 02A-Trp59 NE1 distance is increased from 3.0 X in the wild-type protein to 3.7 X in the Ser82 variant). The propionic acid group of heme pyrrole ring A is otherwise unaffected by the shift in Trp59 and retains the positioning and hydrogen bonding interactions occurring in wild-type iso-1-cytochrome c. The movement of Trp59 also appears to induce the concerted movement of two adjacent side chains. The side chain of Met64, which is packed closely against the indole ring of Trp59, is displaced by -0.7 X. And "the phenyl ring of Phe36, which is in turn packed adjacent to the side chain of Met64, undergoes a shift of -0.5 X. It is notable that a perturbation near 280 nm in the UV absorption spectrum of the Ser82 variant also suggests that Trp59 differs in conformation between the wild-type and Ser82 variant iso-1-cytochromes c (Pielak et al., 1985, 1986). The internal water molecule Watl66 and the side chain of Asn52, positioned on the frontward-facing side of the propionic acid group of pyrrole ring A, are also involved in a series of concerted movements (Figure V.5). In the Ser82 variant, Watl66 moves 1.4 X in a direction almost directly toward the heme iron atom, thus decreasing the distance between these groups from 6.4 to 5.2 X. Occurring in concert with this positional shift is the loss of the hydrogen bond between Watl66 and Asn52 ND2, and the movement of the side chain of Asn52 closer to the OlA atom of the heme propionic acid. The overall shift observed for the side chain atoms of 162 Figure V.5. Stereo drawirig showing the structural differences between the Ser82 variant (thick lines) and wild-type (thin lines) iso-1-cytochromes c in the region around the heme propionic acid group of pyrrole ring A. The heme groups, the internal water molecule Watl66, and residues 36, 41, 52, 59, 64, and 80 through 83 of the two proteins are shown superimposed. Those hydrogen bonds which differ between the two proteins in this region of the molecule have been shown as dashed lines. Asn52 is -0.5 A. In wild-type iso-1-cytochrome c, Watl66 forms additional hydrogen bonds to the side chains of Tyr67 and Thr78 (see Figure UI.11). In the Ser82 variant, these hydrogen bonds are retained, and positional shirts are not observed for either of these latter residues. C. Correlation of structural changes with differences in functional properties 1. Solvent accessibility to the heme pocket and polarity of the heme environment a. Reduction potential The reduction potential of the Ser82 variant of iso-1-cytochrome c is observed to be 255 mV, whereas that of the wild-type protein is 290 mV (Rafferty et al., 1990). Structural differences between these proteins provide an explanation for the observed -40 mV decrease in reduction potential of the Ser82 variant The presence of the solvent channel in the Ser82 variant substantially increases the direct exposure of the heme group to solvent ln addition, the polarity of the heme environment of the Ser82 variant would be expected to be significantly increased by the accessibility of solvent to the heme pocket, the presence of a hydrophilic side chain at position 163 82, and the loss of the insulating phenyl group, which in the wild-type molecule shields the heme group from both the guanidinium group of Argl3 and the external solvent medium. Both inaccessibility of the heme group to solvent (Stellwagen, 1978), and non-polarity of the heme environment (Kassner, 1972) have been proposed to play significant roles in establishing a high reduction potential in cytochrome c. These results clearly demonstrate that Phe82 plays a major role in forming the heme environment of cytochrome c. Furthermore, they emphasize the significant influence of the polarity of the heme environment on the reduction potential of cytochrome c. b. Reactivity of iso-1-cytochrome c with small molecule electron transfer reagents Numerous small molecule redox reagents are able to carry out electron transfer reactions with cytochrome c. Experimental evidence indicates that these reactions occur via an outer sphere mechanism, and involve electron transfer occurring directly through the exposed edge of the heme group (reviewed in Ferguson-Miller et al., 1979). Experiments measuring the rate of reaction of variants of iso-1-cytochrome c with the small molecule reductant Fe(EDTA)2" have shown that the Ser82 variant is reduced about twice as fast as the wild-type protein (14.8 X 104 vs. 7.2 X 10" M"1 s"1) (Rafferty et al., 1990). These results are consistent with the increased exposure to the solvent medium observed for the heme group of the Ser82 variant 2. Stability of the heme crevice At alkaline pH, cytochrome c is known to undergo a conformational change in which coordination of Met80 to the heme iron is lost (Pearce el al., 1989). The pH at which this unfolding occurs provides a measure of the stability of the heme crevice (Osheroff et al., 1980). The pK a observed for the Ser82 variant (7.7) is significantly lower than that observed for the wild-type protein (8.5) (Pearce et al., 1989), indicating that the stability of the heme crevice is decreased in the Ser82 variant A decreased stability in the conformation of the polypeptide chain surrounding the heme is also inferred from the similiarity between the Soret CD spectrum of the Ser82 variant and that of oxidized iso-1-cytochrome c in which the integrity of the heme 164 environment has been disrupted by high temperature (Pielak et al., 1986). Pearce et al. (1989) have shown that of the two factors which determine the pK a for the* alkaline transition, it is the dissociation constant of the (unidentified) ionizing group that is most greatly affected by substitutions at Phe82. Somewhat unexpectedly, the equilibrium constant for the conformational rearrangement is little affected, and actually lowered in the case of the Ser82 variant However, it is conceivable that an intramolecular interaction occurring in the native fold of the iso-1-cytochrome c molecule acts to maintain the pK a of the ionizing group. In this case, factors which lower the stability of the native conformation could cause the observed shift in pK a of the sensitive group. In the Ser82 variant, several structural perturbations occur that may effect such a lowering in stability. The replacement of the phenyl ring, which in the wild-type molecule is tightly packed within a hydrophobic pocket (see Section III.H.1), with a solvent channel gives rise to two destabilizing effects: a decrease in packing efficiency, and a disruption of the van der Waals forces maintaining the native conformation of the left wall of the heme pocket In addition, both the exposure to solvent of normally buried, non-polar groups, and the introduction of the polar hydroxyl group of Ser82 into a hydrophobic environment would also be expected to destabilize the Ser82 variant It is notable that these perturbations occur in a region of the molecule that has been proposed to play a role in stabilizing the heme crevice (Osheroff et al., 1980). 3. Electron transfer activity Phe82 has been proposed to play a direct role in the electron transfer reaction between yeast cytochrome c and yeast cytochrome c peroxidase. Liang et al. (1987, 1988) have determined that in the complex between iso-1-cytochrome c and zinc-substituted cytochrome c peroxidase, the rate of reduction of Zn + - cytochrome c peroxidase by cytochrome c is 104 times slower for the Ser82 variant than for the wild-type protein. These authors have attributed this lower electron transfer rate to the lack of an aromatic side chain at position 82. Interactions between the JT-electron system of the aromatic group at this site and that of the heme group are proposed to account for the enhancement of electron 165 transfer occurring in the wild-type molecule. This interpretation is supported by the structural analysis of the Ser82 variant, which shows that structural perturbation at the putative electron transfer site is essentially restricted to a simple replacement of an aromatic group with a solvent channel. It is clear that in travelling from cytochrome c to cytochrome c peroxidase, an electron which might normally encounter the phenyl ring of Phe82 would encounter a substantially different medium in the Ser82 variant, where the intervening space would consist of a polar hydroxyl group, a solvent channel, and likely one or more entrapped solvent molecules (see Figure V.3). Indeed, it is possible that in the Ser82 variant, the altered character of this.pathway results in electron transfer occurring via an entirely different mechanism (Marcus and Sutin, 1985; Liang et al., 1987). Although the lack of the optimal medium for electron movement would appear to be the most obvious explanation for the impaired electron transfer activity of the Ser82 variant, it must also be considered that the other observed conformational differences or a perturbed electron distribution in the delocalized ir-electron system of the heme (see discussion below) may contribute to the lowered ability of this protein to donate an electron to Zn + - cytochrome c peroxidase. An additional note is that the absence of gross conformational differences between the wild-type and Ser82 variant iso-1-cytochromes c in the region of the molecule thought to interface with CCP suggests these two proteins can form a similar complex with CCP (Liang et al., 1987, 1988). This is consistent with the similar rates observed for the photo-initiated electron transfer from 3 Zn-cytochrome c peroxidase to iso-1-cytochrome c for both the Ser82 variant and the wild-type protein (Liang et al., 1987, 1988). D. Possible explanation for remote conformational changes In comparison to wild-type iso-1-cytochrome c, the Ser82 variant has a 50m V lesser reduction potential, which correlates with this protein's increased solvent accessibility to the heme and increased polarity in heme environment The lower reduction potential indicates that the Ser82 variant has a decreased ability to stabilize the reduced state of the heme iron (i.e. a net neutral charge at the heme centre). This would be expected to create in the Ser82 variant, an increased electro-positive character at the heme iron, which may in turn be responsible for the 166 conformational changes occurring remote from the substitution site in this protein. Thus, the shifts observed at the internal water molecule Watl66 and at Asn52 may result from the attraction of Watl66 to the increased positive charge at the heme iron. The positioning of Trp59 may be affected by the electrostatic interaction between the heme iron and the propionic acid group of heme pyrrole ring A (Moore, 1983). In the Ser82 variant, the strengthened interaction between the electronegative carboxyl group and the increased electropositive charge on the heme iron may render the carboxyl group less,able to act as an electron donor in a hydrogen bond with Trp59 NE1. The proposal that the conformational shifts observed in the Ser82 variant occur in response to increased electropositivity at the heme iron is supported by their strong similiarity to shifts observed between tuna ferri- and ferrocytochrome c (see Section IV.C). It can thus also be reasoned that the structural differences between the Ser82 variant and wild-type iso-1-cytochromes c represent the initial conformational changes occurring as reduced iso-1-cytochrome c is oxidized during an electron-transfer event An alternative explanation for the observed position of Trp59 in the Ser82 variant arises from the proposal of Satterlee et al. (1987) that the effects of conformational changes occurring in cytochrome c in the vicinity of Phe82 can be transmitted, via a molecular orbital of the heme group, to the propionic acid group of pyrrole ring A. Shellnutt et al. (1979) have also emphasized the aromatic and electronegative groups occurring in the neighborhood of the heme are important determinants of the distribution of electron density within the heme 7r-orbitals. Thus in the Ser82 variant, it can be argued that the increased solvent accessibility and polarity occurring at the top of the heme pocket leads to a redistribution of electrons within the delocalized it-electron system of the heme. If this redistribution were to lower the electronegativity of the propionic acid group of pyrrole ring A, in a manner similar to that described above it may result in the loss or lengthening of the hydrogen bond to Trp59. Considering that the propionic acid group of pyrrole ring A appears to be central to the conformational shifts occurring between the Ser82 variant and wild-type iso-1-cytochromes c, and that these shifts may represent the initial movements occurring during the oxidation of the 167 iso-1-cytochrome c molecule, it is particularly notable that Moore (1983) has proposed that this propionic acid group, through electrostatic interactions with the heme iron, is involved in mediating the oxidation-state dependent conformational changes in cytochrome c. 168 VI. GLYCINE 82 VARIANT OF YEAST ISO-1-CYTOCHROME c Two proteins containing a glycine at position 82 in iso-1-cytochrome c were studied. In one, the naturally occurring Cysl02 was present, whereas in the other this residue was replaced by a threonine. The two variants will be referred to as Gly82(Cysl02) and Gly82(Thrl02). Of particular significance is that the structure determinations were of the Gly82(Cysl02) variant in its reduced state, and of the Gly82(Thrl02) variant in its oxidized state. A. Details of the structure determination 1. X-ray diffraction data a. Gly82(Cysl02) variant For the Gly82(Cysl02) variant of iso-1-cytochrome c, diffraction data to 2.6 X resolution (3305 reflections in total) were collected from a single crystal. Individual backgrounds were used in the processing of diffraction intensities. The scale factor for the resultant set of structure factors was determined to be 44.6, using a linear rescale against all common structure factors from the data set for wild-type iso-1-cytochrome c. The R-factor between the two data sets was 0.415. b. Gly82(Thrl02) variant Diffraction data for the Gly82(Thrl02) variant were measured from two crystals, with one crystal (B, 8587 reflections) covering the resolution range °° to 2.0 X and the other (C, 10733 reflections) 0 0 to 1.76 X . Individual backgrounds were used in the processing of both sets of diffraction intensities. The scale factors for the two sets of structure factors were determined, using the method of Thiessen and Levy (1973), to be 20.2 for B and 17.0 for C. The R-factor for structure factors in common between the data set for wild-type iso-1-cytochrome c and sets B and C of the Gly82(Thrl02) variant were 0.27 and 0.28, respectively. A complete data set to 1.76 X resolution was obtained by merging the two independent sets of structure factors. The merging R-factor for the 6822 replicately measured reflections in the resolution range • to 2.0 X was 0.105. 169 2. Difference maps For each of the Gly82 variants, difference maps (Figure VI. 1) were calculated using the coefficients FQ(wild- type) - FQ(Gly82), and phases derived from a wild-type iso-1-cytochrome c atomic model which had been refined at L7 X resolution to an R-factor of 0.197. The features in the two maps were similar but not identical. Interpreted with respect to the superimposed structure of wild-type iso-1-cytochrome c, both maps showed numerous significant electron density Figure VL1. Stereo drawings of the FQ(wild-type) - F (Gly82) difference maps in the vicinity of residue 82 for the Gly82(Cysl02) (top) and Gly82(Thrl02) (bottom) variants of iso-1-cytochrome c. The atomic skeleton of wild-type iso-1-cytochrome c determined at 1.7 X resolution is superimposed on the difference electron density envelopes. Positive density has been contoured with solid lines, and negative density with dashed lines. 170 peaks located around residues 82 through 84, in the direct vicinity of the substitution site. a. Gly82(Cysl02) variant In the difference map for the Gly82(Cysl02) variant, most of the phenyl ring of Phe82 was enveloped in positive density, as expected. However, positive density also occurred at the main chain of residues 82, 83 and 84, and there was significant negative density located between the phenyl ring of Phe82 and the backbone of residues 83 and 84. In addition, the Phe82 atoms CB and CG, as well as CD1 and CE1 of the inner edge of the phenyl ring, were associated with neither negative nor positive density. The difference map thus indicated that a conformational rearrangement of residues 82 to 84 occurs in the Gly82(Cysl02) variant, but was not sufficiently clear to allow a refitting of this segment of polypeptide chain. b. Gly82(Thrl02) variant The difference map for the Gly82(Thrl02) variant very clearly indicated a perturbation in the conformation of residues 82 to 84. Enveloped in positive density were the upper portion of the phenyl ring of Phe82, as well as almost the entire stretch of polypeptide backbone from Ala81 O through Gly84 O. Note that a break at the CA atom of Gly83 is consistent with the later determination of a water molecule occurring at this site in the Gly82(Thrl02) variant (see below). Strong peaks of negative density occurred adjacent to the carbonyl group of Ala81, directly above CA and CB of Phe82, and alongside the main chain of glycines 83 and 84. Consistent with the replacement of Cysl02 by Thrl02, the difference map also showed a strong positive peak at the SG atom of Cysl02, and an adjacent negative peak. The high quality of the difference map suggested that a 2F0(Gly82) - F ' map may be sufficiently clear to define the altered conformation of residues 82 to 84 in the Gly82(Thrl02) variant The calculated structure factor magnitudes and phases for this map excluded the contribution of residues 81 through 85, and of several water molecules located in the vicinity of the substitution site. The resultant map was found to be very similar in appearance to both 2FQ - F c and F 0 - F c ' maps calculated later during the course of refinement of the 171 Gly82(Thrl02) variant, and allowed, the unambiguous refitting of the polypeptide chain from residues 81 through 84. In the refitting process, the main chain torsion angles of Met80 through Leu85 were adjusted. A 2FQ - F c ' map was also used to position the side chain of Thrl02. 3. Refinement of the structures of the Gly82 variants a. Gly82(Cysl02) variant The initial model used in the refinement of the Gly82(Cysl02) variant was derived from a 1.7 X resolution wild-type iso-1-cytochrome c structure, which included 98 water molecules and 1 sulfate ion. The atoms of the phenylalanine 82 side chain were deleted, but no other adjustments were made. The initial model was refined against diffraction data for the Gly82(Cysl02) variant consisting of the 1581 structure factors with F > 2a p in the resolution range 6.0 to 2.6 X (corresponding to 55% of the available reflections). Nine cycles of refinement reduced the R-factor from a starting value of 0.288 to 0.206. At this point, the mean shift of all protein atoms from their positions in the initial model was 0.23 X . Although structural refinement did not significantly alter the positions of residues 82 to 84, a 2FQ - F c map calculated at this stage showed that these residues did not reside in electron density. The presence of significant positive electron density located between the heme group and the position then occupied by residues 82 to 84 indicated a possible alternative path for this segment of the polypeptide chain. A residue-deleted F Q - F c ' map, where F c ' were calculated with residues 81 through 86 removed from the model, was consulted in making adjustments to the conformations of residues 81 through 85. Some minor manual adjustments were also made, through inspection of 2FQ - F c maps, to the portion of the atomic model outside of the substitution site. Twelve cycles of refinement with the revised Gly82(Cysl02) variant model then reduced the R-factor to 0.184. At this point, the fit of the refolded segment of polypeptide chain and the solvent structure in the vicinity of the substitution site were further evaluated using another 2FQ - F c map. This led to the deletion of two water molecules hydrogen bonded to main chain atoms of residues 81 to 84 in their original conformations, and the addition of two water molecules which formed hydrogen bonds to these residues in their altered conformation. A final 18 cycles of refinement resulted in a further 172 reduction in R-factor to 0.158. As shown in Table VI.1, the final atomic model has excellent agreement with ideal stereochemistry. b. Gly82(Thrl02) variant The initial model used in the refinement of the Gly82(Thrl02) variant was also derived from a 1.7 X resolution wild-type iso-1-cytochrome c structure. In this case, the preliminary model incorporated a number of adjustments made through inspection of 2FQ - F c ' maps as described above. These included a refitting of the segment of polypeptide chain Ala81-Gly82-Gly83-Gly84-Leu85, the placement of a threonine side chain at residue 102, and the deletion of several water molecules which occurred in the vicinity of the substitution site and which lacked Table VI.1. Agreement with ideal stereochemistry in the final refined models of the Gly82 variants of yeast iso-1-cytochrome c Class of restraint R.m.s. deviation from ideality Gly82(Cysl02) Gly82(Thrl02) 1-2 bond distance 0.011 X 0.024 X 1-3 angle distance 0.028 X 0.044 X 1-4 planar distance 0.033 X 0.060 X Planar 0.013 X 0.020 X Chiral centre 0.155 X 3 0.198 X 3 Non-bonded contact3 single torsion 0.206 X 0.217 X multiple torsion 0.207 X 0.221 X possible hydrogen bond 0.239 X 0.244 X Staggered ( ± 6 0 ° , 180°) torsion angle 23.2° 20.8° Planar torsion angle (0 or 180°) 2.4° 3.4° Temperature factor 1-2 bond (main chain) 0.5 X 2 1.5 X 2 1-3 angle (main chain) 0.8 X 2 2.1 X 2 1-2 bond (side chain) 0.3 X 2 1.8 X 2 1-3 angle (side chain) 0.6 X 2 2.7 X 2 aThe r.m.s. deviations from ideality for this class of restraint incorporate a reduction of 0.1 X from the radius of each atom involved in a contact 173 sufficient electron density. The course of refinement of the structure of the Gly82(Thrl02) variant is summarized in Table VI.2. In general, the manual adjustments required were small, and were restricted to the side chains of amino acid residues. Further substantial manual adjustment to the conformation of the polypeptide chain in the vicinity of the substitution site was not required. The locations of four new water molecules occurring in this region of the molecule were determined. For the final refined structure of the Gly82(Thrl02) variant of iso-1-cytochrome c, the R-factor is 0.199 for diffraction data in the resolution range 6.0-1.76 A, and there is good agreement with ideal stereochemistry (see Table VI.l). B. Description of structural changes The replacement of phenylalanine at residue 82 with a glycine residue causes a substantial, but localized, refolding of the polypeptide chain. In both the Gly82(Cysl02) and Gly82(Thrl02) Table VI.2. Course of refinement of the structure of the Gly82(Thrl02) variant of yeast iso-1- cytochrome c Resolution Sigma Number of Refinement R-factor Inspection of range ( X ) cutoff reflections cycles Initial Final atomic model 1 6.0 - 2.0 3.0 . 5199 .13 . 0.262 0.214 Against 2F Q -F C map and F _ - F ' map for region near Gly82 2 6.0 - 2.0 3.0 5199 6 0.217 0.205 3 6.0 - 1.76 3.0 6176 11 0.221 0.209 4 6.0 - 1.76 3.0 6176 11 0.216 0.203 5 6.0 - 2.0 2.0 6618 8 0.215 0.210 6.0 - 1.76 3.0 6 6.0 - 2.0 2.0 6618 10 0.214 0.204 6.0 - 1.76 3.0 7 6.0 - 2.0 2.0 6618a 8 0.206 0.199 6.0 - 1.76 3.0 Against 2F Q -F C map and F _ - F ' map for region near Gly82 aThe 6618 reflections used in the final refinement represents 69% of the available data in the resolution range 6.0-1.76 X . 174 variants, the segment of polypeptide chain whose conformation is most greatly perturbed spans residues 81 through 85. However, the conformations of these residues in the two Gly82 variants differ largely not only from that in wild-type iso-1-cytochrome c, but also from each other. The highly localized nature of the conformational rearrangement that occurs in the Gly82 variants is evident in Figure VI.2, which shows a comparison of the main chain conformations of the two Gly82 variants with that of wild-type iso-1-cytochrome c. Outside of the immediate Residue number Figure VL2. Comparison of the polypeptide backbone conformations of the Gly82 variant and wild-type iso-1-cytochromes c. Wild-type iso-1-cytochrome c is compared with the Gly82(Cysl02) variant in the panel above, and with the Gly82(Thrl02) variant on the panel on the following page. In each panel, the lower plot indicates the average deviation observed between the positions of main chain atoms in corresponding residues of the Gly82 variant and wild-type iso-1-cytochromes c. And the upper plot indicates the deviations in the main chain conformational torsion angles <f> (—) and \p ( ) of corresponding residues of the two proteins. 175 180- 1 1 1 n 11 11 I n 1 1 1 1 1 n 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 t l 1 1 1 1 1 1 1 1 1 1 1 1 n 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 11 11 1 1 1 1 11 11 i i i 11 11 i I i i i i I i i C g o 0 <a > CD 0 "O 3 -90' a < -180-J c 4 . o d o .1-1 -<-> CO 3.0H > CD 11II11111|Tl11111111111111111111111111111111111111111111111111111111111111111 45 SO 55 60 65 70 75 80 85 90 95 100 Residue n u m b e r i i j i i I n' i i i i i I • I i i i i i « i i . . . . •5 1 5 10 15 20 25 30 35 Figure VL2 (continued). vicinity of the substitution site, the main chain conformations of both Gly82 variants do not significantly differ from that of the wild-type protein. For the comparison of residues - 5 to 80 and 86 to 103 of the wild-type protein with those of the Gly82(Cysl02) variant, the overall r.m.s. positional difference for main chain atoms is 0.29 X and the overall r.m.s. differences for phi and psi angles are 8.6° and 9.8°, respectively. The corresponding values for the comparison between the wild-type and Gly82(Thrl02) variant iso-1-cytochromes c are 0.28 X , 6.9°, and 6.9° respectively. 176 1. Polypeptide chain refolding in the vicinity of Gly82 a. Gly82(Cysl02) variant In the refolding of the polypeptide chain in the Gly82(Cysl02) variant (see Figure VL3), Gly82, Gly83 and Gly84 are the residues most affected, with the main chain atoms of these residues shifting on average 2.7, 4.8 and 1.8 X , respectively, with respect to their positions in the wild-type iso-1-cytochrome c molecule. On either side of the affected region, the large inward movement of residues 82 to 84 is accommodated by adjustments in only a single main chain torsion angle: \p of Ala81 by - 7 8 ° , and 4> of Leu85 by - 4 5 ° . It is notable that residues 82 to 84 do not undergo just a simple translational displacement, as the main chain torsion angles of these residues differ substantially from those in the wild-type protein (see Table VI.3). The effect of the refolding is to pack the apolar portion of the main chain of residues 82 to 83 against the upper left face of the heme group. Van der Waals contacts made between this Figure VL3. Stereo drawing of the region around residue 82 in the Gly82(Cysl02) variant (thick lines) and wild-type (thin lines) iso-1-cytochromes c. The heme groups, the polypeptide chain of residues 13 through 14, 68 through 72, and 79 through 85, and neighboring water molecules of the two proteins are shown superimposed. Hydrogen bonds are represented as dashed lines, and have been labelled according to their occurrence in the wild-type (T) or Gly82(Cysl02) variant ('g') proteins. 177 Table VL3. Comparison of main chain torsion angles3 in the vicinity of residue 82 in wild-type and Gly82 variant iso-1-cytochromes c Residue and Wild- Gly82(Cysl02) Gly82(Thrl02) main chain type :  torsion angle Value Difference Value Difference Met80 <t> -75 -56 + 19 -75 0 4> 106 116 + 10 125 + 19 Ala81 <t> -82 -96 -14 -107 -25 4> 69 -9 -78 137 + 68 Phe82 <S> -136 -105 + 31 57 -167 (Gly82) 4> 125 -170 + 65 16 -109 Gly83 <t> -61 81 + 142 -93 -32 -45 179 136 43 + 88 Gly84 136 110 -26 -107 + 117 166 120 -46 153 -13 Leu85 -113 -158 -45 -144 -31 99 111 + 12 105 + 6 3A11 torsion angles have units of degrees. segment of polypeptide chain and the carbon atoms of the heme group include Gly82 CA to Hem C2C and CMC (3.2 X ) and Gly83 CA to Hem CBB (3.5 X ) . Interestingly, the carbonyl groups of residues 82, 83 and 84, the most polar groups (Burley and Petsko, 1986) in this segment of polypeptide chain, retain orientations similar to those occurring in the wild-type molecule, as they are all directed away from the heme group. It is notable that atoms of residues 82 through 84 have shifted from being over 6 to 8 X removed from atoms of the heme group, to their positioning adjacent to the heme in the Gly82(Cysl02) variant In wild-type iso-1-cytochrome c, the phenyl ring of Phe82 has a similar placement with respect to the heme group. In the Gly82(Cysl02) variant, the position of the polypeptide backbone at about Gly83 C coincides with that of the lower portion (atoms CD1 and CE1) of the Phe82 phenyl ring in the wild-type protein. It should also be noted that the large shift of the polypeptide chain in the Gly82(Cysl02) variant at residues 82 to 84, and the positioning of these residues with respect to the position of the phenyl ring of Phe82 in the wild-type molecule are in good agreement with 178 the the initial FQ( wild-type) - FQ(Gly82) difference map. b. Gly82(Thrl02) variant In the Gly82(Thrl02) variant, refolding of the polypeptide chain most greatly affects the positions of Ala81 through Gly84 (see Figure VI.4). For residues 81, 82, 83 and 84, the average positional differences between corresponding main chain atoms of the Gly82(Thrl02) variant and wild-type iso-1-cytochromes c are 0.9, 2.5, 4.7 and 1.3 X , respectively. As in the Gly82(Cysl02) variant, the large conformational rearrangement of residues in the vicinity of the substitution site perturbs on either side of the affected region only a single main chain torsion angle: \p of Met80 by +19° and <j> of Leu85 by - 3 1 ° (see Table VL3). Similar to the situation in the Gly82(Cysl02) variant, refolding in the Gly82(Thrl02) variant positions the main chain of residues 82 to 83 in the volume of space occupied by the phenyl ring of Phe82 in wild-type iso-1-cytochrome c. The positions of the Gly83 N, CA and C atoms in the Gly82(Thrl02) variant coincide closely with those of Phe82 CG, CD1 and CE1 in the wild-type molecule. In its position adjacent to the heme group, the polypeptide chain at residues Figure VL4. Stereo drawing of the region around residue 82 in the Gly82(Thrl02) variant (thick lines) and wild-type (thin lines) iso-1-cytochromes c The heme groups, the polypeptide chain of residues 13 through 14, 68 through 72, and 79 through 85, and neighboring water molecules in the two proteins are shown superimposed. Hydrogen bonds are represented as dashed lines, and have been labelled according to their occurrence in the wild-type (T) or Gly82(Thrl02) variant ('g') proteins. 179 81 through 83 makes several van der Waals contacts with atoms at the upper edge of this group. These contacts include Ala81 O to HemCBC (3.4 X ) , Gly83 CA to HemCHC (3.5 X ) , and Gly83 CA to HemCBB (3.2 X ) . 2. Solvent structure in the vicinity of the substitution site In the direct vicinity of the substitution site of both Gly82 variants, changes in the positioning of polar atoms of the polypeptide backbone cause the nearby solvent structure to be substantially altered from that in the wild-type protein. a. Gly82(Cysl02) variant A water molecule (Watl72) which in the wild-type structure is hydrogen bonded to the carbonyl oxygens of both residues 82 and 83, as well as to the backbone amide nitrogen of residue 72, is absent in the Gly82(Cysl02) variant Refolding of the polypeptide chain at the substitution site places both carbonyl groups too distant from 72 N to participate with this atom in coordinating a water molecule. A water molecule (Watl65) hydrogen bonded to the amide nitrogen of Gly83 in the wild-type molecule is also absent, since Gly83 N in the Gly82(Cysl02) variant is directed inwards into the heme pocket, rather than upward toward the external solvent The carbonyl groups of residues 81 and 83 at their altered positions in the Gly82(Cysl02) variant hydrogen bond two water molecules (Watl05 and Watl23) which have no counterparts in wild-type iso-1-cytochrome c. b. Gly82(Thrl02) variant A number of water molecules bound to residues 81 to 84 in their refolded conformation in the Gly82(Thrl02) variant are unique to this protein. Watl08 forms hydrogen bonds with both the carbonyl group of Met80 and the amide nitrogen of Gly83, and is notable in that it is positioned within 3.5 X of the Met80 side chain, which ligands the heme iron. Watl20 is hydrogen bonded to the amide nitrogen of Gly84. A further unique water molecule (Watl27) is hydrogen bonded to Watl20. In addition, the inward shift of the carbonyl group of Gly84 in the Gly82(Thrl02) variant causes a corresponding positional shift in Watl07, which is hydrogen bonded 180 ,J ' to this carbonyl group. Interestingly, Watl72 which is absent in the Gly82(Cysl02) variant does occur in the Gly82(Thrl02) variant In the latter protein, Watl20 participates with the amide nitrogen of residue 72 in coordinating Watl72. 3. Other structural differences a. Gly82(Cysl02) variant Occurring nearby to the site of the amino acid substitution in the Gly82(Cysl02) variant are slight alterations in the conformations of the side chain of arginine 13 and of the thioether bridge between Cysl4 and the heme group. A reorientation of the guanidinium group of Argl3, coupled with the more inward positioning of the carbonyl group of Gly84, results in the formation of a hydrogen bond between these two groups. In the wild-type molecule, van der Waals contacts between the phenyl ring of Phe82 and the aliphatic portion of the side chain of Argl3 prevent the guanidinium group from approaching 84 O closely enough to form a hydrogen bond. The CBB methyl group, which is part of the heme vinyl side chain forming a thioether bond to Cysl4, is packed against the phenyl ring of Phe82 in wild-type iso-1-cytochrome c. In the Gly82(Cysl02) variant, movement of this group by 0.8 X further into the interior of the heme pocket occurs to accommodate the positioning of Gly83 adjacent to the heme group (the CBB - Gly83 CA distance is 3.5 X ) . Overall, the heme conformations in the Gly82(Cysl02) variant and wild-type iso-1-cytochromes c are similar, with the mean difference in the positions of all heme atoms being 0.26 X . Aside from the CBB atom, the only other significant positional difference occurs at the aliphatic portion of the propionic acid group of pyrrole ring A. The largest positional shift of 1.1 X occurs at the CBA carbon atom, and is associated with a smaller shift (average 0.4 X ) in the carboxyl group of this propionic acid. Finally, a positional shift is observed in the Gly82(Cysl02) variant at an internal water molecule (Watl66) located within the lower left of the heme pocket (Figure VI.5). In wild-type iso-1-cytochrome c, Watl66 forms hydrogen bonds to the side chains of Asn52, Tyr67 and Thr78. The position of this water molecule in the Gly82(Cysl02) variant differs by 1.2 X from that in 181 Figure VL5. Stereo drawing showing structural differences between the Gly82(Cysl02) variant (thick lines) and wild-type (thin lines) iso-1-cytochromes c in the region around the internal water molecule Watl66. The heme groups, the internal water molecule Watl66, and residues 52, 67, 78 and 79 through 85 of the two proteins are shown superimposed. Hydrogen bonds involving Watl66 are shown as dashed lines, with the Watl66-Asn52 hydrogen bond present only in the wild-type molecule labelled 'f. the wild-type protein. In the Gly82(Cysl02) variant, Watl66 is positioned 0.8 X closer to the heme iron (5.6 X vs. 6.4 X in the wild-type structure) and no longer forms a hydrogen bond to Asn52. b. Gly82(Thrl02) variant Apart from the refolding of the polypeptide chain about Gly82, remarkably little dissimilarity exists between the structures of the Gly82(Thrl02) variant and wild-type iso-1-cytochromes c. The heme groups in these two proteins have essentially identical conformations and positioning, with the mean deviation in the positions of all heme atoms being only 0.15 X . 182 i. Vicinity of the substitution site As in the Gly82(Cysl02) variant, a slight adjustment in the conformation of the side chain of Argl3 occurs in the Gly82(Thrl02) variant, allowing the guanidinium group of Argl3 to form a hydrogen bond to the carbonyl group of Gly84. ii. Oxidation-state dependent structural changes Structural differences between the wild-type and Gly82(Thrl02) variant iso-1-cytochromes c may result from two factors: the phenylalanine to glycine amino acid substitution, and the difference in oxidation states of the two proteins. Due to their strong similarity to differences that occur between the two redox forms of cytochrome c (see Section IV.C), the differences described in this section have been considered to be dependent on the oxidation state of the iso-1-cytochrome c molecule. However, it has already been demonstrated that conformational shifts that have occurred remote from the substitution site in the reduced form of the Ser82 variant resemble those expected as iso-1-cytochrome c is oxidized during an electron transfer event (see Section V.D). Thus, in interpreting structural differences between the wild-type and Gly82(Thrl02) variant iso-1-cytochromes c, the two above-mentioned effects are particularly difficult to differentiate. In the present case, it would seem most likely that both factors contribute to the observed differences. The most substantial positional shifts occur at Watl66, and at the side chain of Asn52 (see Figure VI.6). In the Gly82(Thrl02) variant, Watl66 is displaced by 0.6 A with respect to its position in wild-type iso-1-cytochrome c. This displacement decreases the distance between Watl66 and the heme iron from 6.4 X to 5.9 X , and also appears to induce the upward shift (average deviation 0.8 X ) of the side chain of Asn52, to which Watl66 is hydrogen bonded. The Watl66-Asn52 ND2 hydrogen bond distances in the two structures are similar [2.9 X in the Gly82(Thrl02) variant, and 3.1 X in wild-type iso-1-cytochrome c]. Significant conformational differences between the Gly82(Thr 102) variant and wild-type iso-1-cytochromes c are also observed at two other side chains. In the Gly82(Thrl02) variant, the aromatic rings of Trp59 and Tyr67 have shifted approximately 0.5 X and 0.3 X , respectively, in a direction toward the rear of 183 Figure VL6. Oxidation-state dependent structural differences between the oxidized Gly82(Thrl02) variant (thick lines) and reduced wild-type (thin lines) iso-1-cytochromes c. The heme groups, the internal water molecule Watl66, and residues 52 through 59, 67 through 71, and 75 through 84 of the two proteins are shown superimposed Oxidation-state dependent changes are restricted to the side chains of Trp59, Asn52 and Tyr67 and the water molecule Watl66. Note the strong resemblance to conformational differences observed between reduced yeast and tuna, and oxidized tuna and rice cytochromes c (see Figure IV.9). Hydrogen bonds involving groups whose positions are sensitive to the oxidation state have been drawn as dashed lines. The large rearrangement occurring in the vicinity of the Gly82 substitution site can also be seen in this figure. the iso-1-cytochrome c molecule. iii. Threonine 102 In the Gly82(Thrl02) variant, the replacement of the naturally occurring cysteine at residue 102 with a threonine causes no significant structural perturbation (see Figure VL2b). The side chain of this threonine residue adopts a g" conformation (XI=71°), which is the same as that adopted by Thrl02 in both tuna and rice cytochromes c. In iso-1-cytochrome c, the Thrl02 OG1 atom forms a hydrogen bond to the carbonyl group of Leu98. A homologous hydrogen bond (Cysl02 SG - Leu98 O) occurs in the wild-type protein, but it is notable that the Cysl02 SG and Thrl02 OG1 atoms do not occupy the same position. Instead, the position of the CG2 atom of the Thrl02 side chain in the Gly82(Thrl02) variant coincides with that of the SG atom of 184 Cysl02 in the wild-type protein, which is consistent with the non-polarity of the pocket occupied by these two atoms (see Section II1.G.4). It is also of note that the close proximity (-4.3 A) of the methyl groups of Thrl02 CG2 and Val20 CGI is consistent with NMR studies (Pielak et al^ 1988b), which show a strong NOE between protons of these two groups. 4. Comparison of the refolded conformations in the Gly82(Cysl02) and Gly82(Thrl02) variants The refolding occurring in both the Gly82(Cysl02) and Gly82(Thrl02) variants results in a final conformation of the polypeptide chain which differs between the two proteins (see Figure VI.7). The most notable conformational differences are the opposite orientations of the peptide bonds between residues 81 and 82, and residues 83 and 84. The largest positional discrepancy between the two Gly82 variants occurs at Gly82. In the Gly82(Cysl02) variant, Gly82 is positioned deeper in the heme pocket, and is packed closer to the heme plane; in the Gly82(Thrl02) variant Gly82 has a more external positioning. Figure VI.7. Comparison of the conformations of the polypeptide chain around residue 82 in the Gly82(Cysl02) (thin lines) and Gly82(Thrl02) (thick lines) variant iso-1-cytochromes c The heme groups and the polypeptide chain of residues 13 through 14, 67 through 71, and 79 through 85 of the two proteins are shown superimposed. 185 Unclear are the causes of the differing conformation of the polypeptide chain at residues 81 to 84 in the two Gly82 variants. Two obvious differences between these proteins are their oxidation states and the identity of residue 102. However, it would seem unlikely that these factors are of primary importance. In general, redox-state dependent conformational changes in cytochrome c are observed to be small, and appear to be localized to the lower left of the heme pocket (see Sections I.B.4 and IV.C). ln addition, a preliminary difference map for the reduced Gly82(Thrl02) variant indicates that the conformation of residues 81 to 84 in this protein resembles that in the oxidized Gly82(Thrl02) variant The cysteine to threonine replacement at position 102 has not significantly affected the conformation of the polypeptide chain local to this substitution site, and residue 102 is 18 A removed from the region of the polypeptide chain around residue 82. It may be that the observed conformations for residues 81 to 84 simply represent two relatively stable members of a population of existent conformations. It should be emphasized that despite the differences in the conformation of residues 81 through 84, the two Gly82 variants are similar in that this segment of polypeptide chain has undergone a large inward shift with respect to its position in the wild-type protein. The result is that the degree of exclusion of solvent from the heme pocket is about the same in the two proteins. Also similar is the number of polar groups from the polypeptide chain which are introduced into the heme pocket Therefore, in much of the subsequent discussions, interpretations of altered functional properties of the Gly82 variant in terms of structural changes apply equally to both the Gly82(Cysl02) and Gly82(Thrl02) variants. C. Correlation of structural changes with differences in functional properties 1. Accessibility of the heme pocket to solvent The important role played by the phenyl ring of Phe82 in forming the upper left wall of the heme pocket and in excluding solvent from the heme pocket has been discussed earlier (see Sections III.H.1 and V.C.I). The modelled structure of iso-1-cytochrome c in which the side chain of residue 82 is removed, but the native conformation of the polypeptide backbone is retained, shows that the absence of the bulky phenyl ring causes a large part of the upper left 186 face of the heme group as well as several hydrophobic groups forming the heme pocket (including the Met80 ligand) to become exposed to solvent However, in the Gly82" variants, the repositioning of the main chain of residues 82 to 83 into the space normally occupied by the phenyl ring of Phe82 results in the heme groups having a degree of solvent accessibility approximately the same as that of the heme group in wild-type iso-1-cytochrome c (see Figure VI.8). The solvent accessibilities of the heme group in both the Gly82(Cysl02) and Gly82(Thrl02) variants (44.4 X 2 and 44.5 X 2 , respectively) are actually slightly lower than that in wild-type iso-1-cytochrome c (48.8 X 2 ) . That the Gly82 variant maintains a high degree of exclusion of solvent from the heme crevice is in contrast to the situation observed in the Ser82 variant In that variant, no refolding of the polypeptide chain occurs, and the presence of the smaller serine side chain results in the creation of a channel extending down into the heme pocket (see Section V.C.I) and consequently in a greatly increased solvent accessibility to the heme group (70.0 X 2 ) . The Gly82 variant reacts with the reductant Fe(EDTA) 2" at twice the rate as does wild-type iso-1-cytochrome c (13.7 X 10" vs. 7.2 X 104 M - ' s 1 ) . The Ser82 variant shares a similar two-fold increase in reactivity (14.8 X 10" M ^ s - 1 ) , which can be correlated with the substantially increased exposure to the solvent medium of the heme group in this protein. A simple structural explanation is not apparent for the Gly82 variant in which heme solvent accessibility is about the same as that in the wild-type protein. It may be that the inward folding of residues 81 to 84 permits the closer approach of the Fe(EDTA) 2" reactant to the heme group of cytochrome c, or that the flexibility of this segment of polypeptide chain (see below) permits transient unfolding of this region and thus transiently increased heme exposure. 2. Reduction potential and the polarity of the heme environment The reduction potential of the Gly82 variant is measured to be 247 mV, whereas that of the wild-type protein is 290 mV (Rafferty et al., 1990). The -50 mV decrease in reduction potential observed for this variant is similar to that observed for the Ser82 variant For the Ser82 variant, the lowering in reduction potential can be largely attributed to the increased polarity of 187 Figure VL8. Molecular surface in the region of residue 82 in the Gly82(Cysl02) (top) and Gly82(Thrl02) (bottom) variant iso-1-cytochromes c. The dot surfaces represent the regions of the two protein molecules which are accessible to solvent, and were calculated (Connolly, 1983) using a probe sphere of radius 1.4 X . The directions of view are identical to that in Figure V.4, and thus the illustrated regions of the surfaces of the two Gly82 variants can be directly compared with that of the wild-type iso-1-cytochrome c molecule presented in the earlier figure. the heme pocket arising from the increased accessibility of solvent (see Section V.CLa). For the Gly82 variant, the exposure of the heme group does not differ greatly from that in the wild-type protein, but a different mechanism may effect a similar increase in the polarity of the heme 188 environment: refolding of residues 81 through 84 places a number of polar groups from the polypeptide chain adjacent to the heme group. In the Gly82(Cysl02) variant, the amide nitrogens of residues 81 through 83 and the carbonyl group of residue 82 are directed into the heme pocket In the Gly82(Thrl02) variant, the carbonyl groups of residues 81 and 83 and the amide nitrogen of residue 83 are directed into the heme pocket. It is notable that in the wild-type iso-1-cytochrome c molecule, these groups are well removed from the heme and interact with solvent molecules, and that the corresponding region of the heme pocket is occupied by the non-polar phenyl group of Phe82. An additional factor is that despite the similarity in the degree of exposure to solvent of the heme groups of the Gly82 variant and wild-type iso-1-cytochromes c, the thickness of the protein layer separating the heme from bulk solvent is decreased in the Gly82 variant The inward folding of the main chain of residues 82 through 84 has removed a outward bulge at the "shoulder" of the molecule, and has instead created a depression in the molecular surface to the immediate left of the Met80 ligand (see Figure VI.8). The result is that components of the hydrophobic heme pocket normally buried 6 X below the surface of the molecule have become exposed to the external solvent medium. In particular, Watl08 in the Gly82(Thrl02) variant hydrogen bonded to MetSO O and Gly83 N, is positioned within van der Waals contact of the Met80 ligand (see Figure VI.4). Thus, for the Gly82 variant, the decreased reduction potential would appear to arise from the increased polarity of the heme environment due to the presence of polar protein atoms in the immediate vicinity of the heme group, and from the closer proximity of the external solvent medium. In comparison to its position in wild-type iso-1-cytochrome c, Watl66 in both the Ser82 and Gly82 variants has a position -0.6 X closer to the heme iron. As discussed in Section V.D for the Ser82 variant, the shift of Watl66 apparently occurs in response to an increased electropositivity of the heme iron, which is in turn associated with the lower reduction potential of this protein. A similar effect may be responsible for the movement of Watl66 in the Gly82 variant, which also shows an -50 mV decrease in reduction potential. In fact, that the same shift of the internal water molecule occurs in two proteins in which structural differences are otherwise 189 disparate supports the proposal that the electropositivity at the heme iron affects the positioning of Watl66. 3. Stability of the heme crevice The pK a for the alkaline isomerization of the Gly82 variant is observed to be 7.7, 0.8 pH units below that of wild-type iso-1-cytochrome c. As discussed for the Ser82 variant, the decreased pK a indicates that the stability of the heme crevice is reduced in the Gly82 variant Several structural properties of the Gly82 variant may contribute to this lowering in stability. The presence in the Gly82 variants of a number of polar groups (amide nitrogens and carbonyl groups) which are directed into the non-polar heme pocket gives rise to a destabilizing effect in itself, and in addition generates a number of unsatisfied hydrogen bonding groups. In addition, the refolding of the polypeptide chain in the vicinity of the substitution site disrupts a network of hydrogen bonds which involves the water molecule Watl72 and which may have a role in stabilizing the native conformation of this region of the iso-1-cytochrome c molecule. It is notable that Watl72 is conserved in four cytochrome c structures (yeast, rice and both reduced and oxidized tuna), and can thus be considered an integral part of the cytochrome c molecule (see Section IV.G.l). Another factor of likely importance is the particularly high conformational entropy (Matthews et al., 1987) of the unfolded state of the Gly82 variant The occurrence of three consecutive glycine residues at positions 82 through 84 provide this region of the polypeptide chain considerable flexibility, which would be lost if a single fixed conformation were to be adopted. In fact, that two distinct conformations are observed for this segment of polypeptide chain can be taken as a direct indication of the flexibility of this region of the Gly82 variant molecule. 4. Electron transfer activity In comparison to wild-type iso-1-cytochrome c, the Gly82 variant has a considerably reduced ability to carry out electron transfer with cytochrome c peroxidase. For the Gly82 variant, the steady state activity for oxidation by cytochrome c peroxidase is only 20% that for the wild-type protein (Pielak et al., 1985). Furthermore, in the complex between iso-1-cytochrome c 190 and zinc-substituted cytochrome c peroxidase, the rate of reduction of Zn+-cytochrome c peroxidase by cytochrome c is 104 times slower for the Gly82 variant than for the wild-type protein. A similar decrease in activity with Zn+-cytochrome c peroxidase is observed for the Ser82 variant For this latter variant, because no substantial conformational rearrangements occur in the vicinity of the substitution site, the cause of the lower reaction rate appears to be the altered nature of the medium encountered by the electron being transferred, and in particular the lack of a ir- electron system coupled to that of the heme (see Section V.C.3). For the Gly82 variant, a similar explanation also seems appropriate. In this variant, the volume of space corresponding to that occupied by the aromatic side chain of Phe82 in the wild-type molecule is filled by the more polar atoms of the main chain of residues 82 and 83. The polypeptide chain backbone would lack the ability to interact directly with the ir-electron system of the heme group, and may also result in the inclusion of bound water molecules at the interface between the cytochrome c and cytochrome c peroxidase molecules. The altered character of the polypeptide chain groups in contact with the heme group would also be expected to affect the distribution of electrons within the 7r-orbitals of the heme (Shellnutt et al., 1981, 1979). In the series of position 82 variants, the Gly82 variant is anomalous in having a very low reduction rate in the photo-initiated electron transfer from 3 Zn-cytochrome c peroxidase to iso-1-cytochrome c (13 s_1 as compared to -200 s_1 for the wild-type protein) (Liang et al., 1987, 1988). Since this rate is dependent on the distance separating the redox centres, Liang et al. have inferred that the Gly82 variant forms a perturbed complex with zinc-substituted cytochrome c peroxidase. That a large conformational rearrangement in the vicinity of the substitution site occurs in this variant provides support for this interpretation. Modelling of the complex between cytochrome c and cytochrome c peroxidase (Poulos and Kraut, 1981; Lum et al., 1987) indicates that the region of the iso-1-cytochrome c molecule about Phe82 participates in forming the interprotein contact interface. Comparison of the structures of the Gly82 variant and wild-type iso-1-cytochromes c in the vicinity of residue 82 indicates at least two ways by which polypeptide chain refolding in this region of the protein could affect complexation interactions with 191 cytochrome c peroxidase. First, there is an altered disposition of non-polar and polar groups, with the non-polar phenyl ring of Phe82 being replaced by more polar atoms of the polypeptide chain. backbone (see Figures VI.3 and VI.4). Secondly, the inward movement of residues 82 through 84 changes the topography of the surface of the cytochrome c molecule, and in particular reduces the surface area available to interface the cytochrome c peroxidase molecule (Figures VI.8 and V.5). The end result of these changes is an interaction surface that is likely to be less compatible with the complementary surface of cytochrome c peroxidase. The proposal that for the Gly82 variant, these conformational rearrangements are responsible for the perturbed complex formed with cytochrome c peroxidase is supported by the structural analysis of the Ser82 variant This protein also has a small side chain at position 82, but undergoes no substantial polypeptide chain rearrangements. For the Ser82 variant reduction by 3 Zn-cytochrome c peroxidase occurs at a near normal rate. The extreme sensitivity of the rate of reaction between 3 Zn-cytochrome c peroxidase and ferricytochrome c to optimal complex formation is further indicated by studies using horse and tuna cytochrome c. These proteins are highly homologous to yeast iso-1-cytochrome c, but have a lower affinity for yeast cytochrome c peroxidase (Kang et al., 1977). Compared to yeast iso-1-cytochrome c, both horse and tuna cytochromes c are reduced by 3Zn-cytochrome c peroxidase at a decreased rate (Ho et al., 1985; Liang et al., 1986) which is similar to that observed for the reduction of the Gly82 variant Thus it would appear that for the Gly82 variant, the abberant electron transfer properties observed can be explained by structural changes which occur about the substitution site and which in turn lead to non-optimal complexation with cytochrome c peroxidase. D. Discussion of the polypeptide chain refolding It is well established that due to hydrophobic interactions, globular proteins have a native fold in which non-polar groups are positioned in the interior of the protein molecule, sequestered from contact with the solvent medium (Schulz and Schirmer, 1979). As described earlier, if removal of the phenyl ring of Phe82 were to occur unaccompanied by adjustment of the conformation of the main chain in this region of the molecule, several hydrophobic groups internal 192 to the heme pocket would become exposed to the solvent Exposure of these non-polar groups would be energetically unfavorable. . It is notable that in both Gly82 variants, a high degree of exclusion of solvent from the heme crevice is maintained. It would thus seem likely that in the Gly82 variant, polypeptide chain refolding occurs in order to bury that portion of the hydrophobic heme pocket which would otherwise be rendered accessible to solvent In comparison to amino acids having a |3- carbon, glycine is considerably less restricted in the backbone conformations which it can adopt (Richardson, 1981). In the Gly82 variant, the introduction of Gly82 creates a sequence which contains three consecutive glycine residues. Thus, clearly a factor in the substantial refolding that occurs about residues 82 to 84 is the high flexibility of this region of the polypeptide chain. In the Gly82(Cysl02) variant, both Gly83 (0 = 81 , <//=T79°) and Gly84 (0 = 110°,> = 120 ) adopt main chain conformational torsion angles that are disallowed for residues bearing a side chain. The same is true for Gly82 (0 = 57°, \p = 16°) in the Gly82(Thrl02) variant The occurrence of three consecutive glycine residues facilitates in an additional manner the polypeptide chain refolding which packs residues 82 to 83 against the heme group. For the polypeptide chain conformation observed in both Gly82 variants, a CB carbon atom on either residue 82 or 83 would project directly into the heme pocket and form prohibitive steric conflicts with atoms of the heme and of the Met80 ligand. These observations suggest that replacements at residue 82 with amino acids other than glycine would result in overall retention of the native conformation of the polypeptide chain about this site. As discussed above and also later, this is supported by the observed structures of the Ser82, Tyr82, and Ile82 variant proteins. The Gly82 variant of iso-1-cytochrome c demonstrates that a single amino acid replacement can lead to a substantial refolding of the polypeptide chain. Structural studies of other mutated proteins have shown that in general single-site amino acid replacements are accommodated without gross rearrangements from the native conformation (Alber et al., 1987, 1988; Howell et al., 1986). Clearly replacement of an amino acid residue with a glycine residue effects fairly drastic steric and entropic changes, as a void is created at the site of the original side chain, 193 and an increase in flexibility of the polypeptide backbone is induced. Nonetheless, with two glycine substitutions in T4 lysozyme, only slight changes in polypeptide chain conformation have been observed to occur at the substitution site. In a proline to glycine substitution occurring within an a-helix, the space originally occupied by the proline side chain is filled by adjacent groups of the protein molecule which have undergone slight positional shifts (Alber et al., 1988). In a threonine to glycine substitution within a surface loop of the protein, the vacated space is filled by a water molecule (Alber et al., 1987). In iso-1-cytochrome c, the environment of residue 82 which allows the substantial refolding to occur is unique in several respects. Because of the large volume of the phenylalanine side chain, a glycine substitution creates a particularly sizeable void. Also, since the phenyl ring of Phe82 occupies a non-polar pocket in the surface of the molecule, adjacent to the rigid planar heme group (see Section III.H.l), two means used in T4 lysozyme to fill vacated space are unavailable. The apolarity of the surrounding protein atoms is unfavorable for binding solvent molecules, and there are no other protein groups which can adjust their conformations to fill the vacated space. In addition, two factors provide the polypeptide chain around the substitution site considerable flexibility. The first is, as described above, the occurrence of three consecutive glycine residues. Second, this strand of polypeptide chain has an extended conformation, and thus there are no intrastrand hydrogen bonds to confer rigidity. In summary, the ability of the segment of polypeptide chain spanning residues 81 to 84 to access a large number of conformations, coupled with the inavailability of alternative means of filling the space vacated by the Phe82 phenyl ring, likely accounts for the substantial refolding that is observed in the Gly82 variant The occurrence of substantial refolding of the polypeptide chain of the Gly82 variant suggests an interesting speculation regarding the protein- folding pathway of cytochrome c. If folding occurs via a unique pathway (see Kim and Baldwin, 1982), then either Phe82 is not important as a determinant of the overall conformation, or the conformation of Phe82 is fixed late in the folding process. The latter supposition is supported by experimental data from two sources. First, ligation of the nearby Met80 to the heme iron has been shown to occur during the final 194 stage of protein folding (Ridge et al., 1981). Second, a qualitative description of the folding pathway of cytochrome c has been obtained using hydrogen exchange labelling in combination with NMR spectroscopy (Roder et al., 1988). The indicated pathway shows that the N- and C-terminal a-helices form early during protein folding, whereas the 60's and 70's helices at the Met80 side of the molecule are formed later. 195 VIL TYROSINE 82 VARIANT OF YEAST ISO-1-CYTOCHROME c A. Details of the structuxe determination 1. X-ray diffraction data Diffraction data to 1.97 X , 7319 reflections in total, for the Tyr82 variant of iso-1-cytochrome c were collected from a single crystal. Background averaging was used in the processing of diffraction intensities. For the resultant set of structure factors, a scale factor of 23.2 was indicated by a linear rescale against common reflections in the resolution range °= to 2.2 X from the data set for wild-type iso-1- cytochrome c. The R-factor between the two data sets, considering all common structure factors, was 0.25. 2. Difference maps A difference map (Figure VII.1) was calculated using the coefficients F0(Tyr82) -F0(wild-type), and phases derived from a wild-type iso-1-cytochrome c atomic model which had been refined at 1.7 X resolution to an R-factor of 0.197. Consistent with the presence of an Figure VHl. Stereo drawing of the F_(Tyr82) - FQ(wild-type) difference map in the vicinity of residue 82. The atomic skeleton of wild-type iso-1-cytochrome c determined at 1.7 X resolution is superimposed on the difference electron density envelopes. Positive density (solid lines) has been contoured at two levels, and negative density (dashed lines) at a single level. 196 extra hydroxyl group on the phenolic ring of residue 82 in the Tyr82 variant, the difference map showed a significant peak of positive electron density adjacent to the position occupied by the CZ atom of Phe82 in the wild-type molecule. However, negative density enveloping the lower portion of the phenyl ring, and additional positive density adjacent to the upper edge indicated that this ring occupies a more external positioning in the Tyr82 variant than in the wild-type protein. In addition, a series of paired positive and negative peaks occurring adjacent to the main chain of residues 82 to 85 indicated that these residues in the Tyr82 variant have undergone a slight inward and upward shift in position. Also, the replacement of Cysl02 by Thrl02 was indicated by a strong negative peak at the SG atom of Cysl02, and an adjacent positive peak. A 2FD(Tyr82) -F c* map, in which the calculated structure factor magnitudes and phases excluded the contribution of residues 81 through 85, was consulted in positioning the side chain of Tyr82, and in adjusting slightly the polypeptide backbone conformation of residues 81 through 85. A 2F 0 - F c ' map was also used to position the side chain of Thrl02. 3. Refinement of the structure of the Tyr82 variant The initial model used in the refinement of the Tyr82 variant was derived from a 1.7 X resolution wild-type iso-1-cytochrome c structure, which included 98 water molecules and 1 sulfate ion. The preliminary model incorporated adjustments made through inspection of 2FQ - F c ' maps, as described above. The amount of diffraction data included in the refinement was increased in three stages. Initially, 14 cycles of refinement against data with F > 3a p in the resolution range 6.0 - 2.1 X (3466 reflections) yielded a reduction in R-factor from 0.230 to 0.187. Next, 4057 reflections with F > 3a p in the resolution range 6.0 - 1.97 X were included, and 4 cycles of refinement resulted in an atomic model with an R-factor of 0.176. In the final phase, 15 refinement cycles were carried out, using data with F > 2a p in the resolution range 6.0 - 1.97 X (4546 reflections, corresponding to 70% of the available reflections). At various intervals, the atomic model was adjusted against 2FQ - F c or F Q - F c ' electron density maps. The manual adjustments required were small, and were restricted to the side chains of amino acid residues. An additional 21 water molecules were incorporated into the atomic model. For the final refined 197 Table VD..1. Agreement with ideal stereochemistry in the final refined model of the Tyr82 variant of yeast iso-1-cytochrome c at 1.97 A resolution Class of restraint R.m.s. deviation from ideality 1-2 bond distance 0.018 A 1-3 angle distance 0.037 A 1-4 planar distance 0.047 A Planar 0.016 A Chiral centre 0.184 A 3 Non-bonded contact3 single torsion 0.209 A multiple torsion 0.193 A possible hydrogen bond 0.233 A Staggered (+ 60°, 180°) torsion angle 21.4° Planar torsion angle (0 or 180°) 2.9° Temperature factor 1-2 bond (main chain) 1.0 A 2 1-3 angle (main chain) 1.6 A 2 1-2 bond (side chain) 1.3 A 2 1-3 angle (side chain) 2.1 A 2 aThe r.m.s. deviations from ideality for this class of restraint incorporate a reduction of 0.1 A from the radius of each atom involved in a contact structure of the Tyr82 variant of iso-1-cytochrome c, the R- factor is 0.183 and the agreement with ideal stereochemistry is very good (see Table VII.1). B. Structural differences between the Tyr82 variant and wild-type iso-1-cytochrome c molecules The replacement of the phenylalanine at position 82 with a tyrosine has little effect on the conformation of the iso-1-cytochrome c molecule. Figure VII.2 shows a comparison of the Tyr82 variant and the wild-type protein in terms of the average positional difference between main chain atoms, and the differences in conformational torsion angles of corresponding residues. The overall r.m.s. difference between positions of corresponding main chain atoms is 0.19 A , and the overall r.m.s. differences between phi and psi angles are 6.2° and 6.3°, respectively. The heme groups of 198 Residue number Figure VIL2. Comparison of the polypeptide backbone conformations of the Tyr82 variant and wild-type iso-1-cytochromes c. The lower plot indicates the average deviations observed between the positions of main chain atoms in corresponding residues of the two proteins. The upper plot indicates the deviations in the main chain conformational torsion angles <j> (—) and </> ( ) of corresponding residues. the Tyr82 variant and wild-type iso-1-cytochromes c do not differ significantly in either overall positioning or conformation, as the mean difference in atomic positions of the 43 heme atoms is only 0.13 X. The side chain of Tyr82 adopts a conformation (XI = 164°, X2=-107° ) very similar to that of Phe82 in the wild-type iso-1-cytochrome c molecule (Xl = 174°, X2=-110° ; see Section III.H.1). However, the phenolic ring of the Tyr82 side chain is positioned -0.7 X further out of the heme pocket than the phenyl ring of Phe82 (see Figure VII.3). The shift of the phenyl ring 199 toward the surface of the molecule in the Tyr82 variant is likely the result of two factors. First, the additional hydroxyl group cannot be accommodated with the positioning of the phenyl ring present in the wild-type protein, as it would sterically conflict with the side chain of Leu85. Secondly, the positioning observed for the side chain of Tyr82 directs the hydroxyl group toward the external solvent medium, and allows this group to form a hydrogen bond with the nearby guanidinium group of Argl3. It is notable that in adopting a more external positioning, the phenolic ring of Tyr82 is also able to pack against the heme group with a greater degree of parallelism (the interplanar angle is 8 ° , as compared to 23° for Phe82 in wild-type iso-1-cytochrome c). Significant differences between the Tyr82 variant and wild-type iso-1-cytochromes c do occur in the conformation of the polypeptide backbone of residues 82 through 85. The set of shifts observed apparently serves to accommodate the more external positioning of the side chain of Tyr82. The atoms of the main chain of residue 82 have shifted on average 0.27 X in an upward direction (0.34 X at the a-carbon). However, due to a 16° rotation in the <f> main chain torsion angle of the preceding residue (Ala81), the upward shift in the position of the side chain Figure VEL3. Stereo drawing of the region around residue 82 in the Tyr82 variant (thick lines) and wild-type (thin lines) iso-1-cytochromes c. The heme groups and the polypeptide chain of residues 13 through 14, 68 through 71, and 79 through 85 of the two proteins are shown superimposed. Hydrogen bonds between the side chain of Argl3 and the hydroxyl group of the Tyr82 tyrosyl ring are shown as thin dashed lines. 200 CB atom of Tyr82 is 0.68 X, about the same as that of the phenolic ring overall. Also observed are the main chain movements, primarily in an inward direction, of Gly83, Gly84, and Leu85 by 0.31, 0.36, and 0.26 X (on average), respectively. The positional shifts of residues 81 through 84 are accommodated by small adjustments in the main chain torsion angles within this region, most notably <j> of Ala81 by 16°, and ii of Gly84 by - 1 2 ° . The positioning of the side chain of Argl3 and of Watl07, which are both located in the vicinity of the substitution site, are also perturbed in the Tyr82 variant. The more external positioning of the side chain of Tyr82 causes an upward shift of the alkyl portion of the Argl3 side chain. In addition, an adjustment in the orientation of the guanidinium group of Argl3 allows the NH1 and NE atoms to form hydrogen bond interactions with the hydroxyl group of Tyr82. The inward shift of the main chain atoms of Gly84 appears to induce a similar, shift in Watl07, which is hydrogen bonded to the carbonyl group of Gly84. No other significant differences are observed between the Tyr82 variant and wild-type iso-1-cytochromes c in the positions of either protein groups or bound solvent molecules. Pielak et al. (1988a) have studied using NMR spectroscopy the structural differences between the Tyr82 variant and wild-type iso-1-cytochromes c. They have shown that in the Tyr82 variant, changes in chemical shifts occur only at groups located within ~5 X of the site of the amino acid substitution. This result is consistent with the absence of significant differences between the crystal structures of the two proteins, aside from the more external positioning of the Tyr82 side chain. However, the NMR and crystallographic studies do not agree on the details of the minor conformational rearrangements occurring in the vicinity of Tyr82. Both the magnitude of the heme-induced diamagnetic shifts experienced by the protons of the aromatic side chain of residue 82, and the strength of the NOE's between these protons and protons of adjacent internal groups (Leu68 CD1 and CD2; Met80 CE; and Hem CMC and CBB) are similar in the two proteins. Thus, Pielak et al. infer that the side chains of Tyr82 and Phe82 occupy identical positions in their respective proteins, and attribute the observed changes in the chemical shifts of proton resonances of groups in the vicinity of Tyr82 to the decreased ring current shift factor of 201 the phenolic side chain. Between the Tyr82 variant and wild-type iso-1-cytochromes c, the most significant differences in the NOE's involving residue 82 occur for the side chain of Leu85, which is thus inferred to adopt a substantially different conformation in the Tyr82 variant These interpretations are not supported by the crystallographic results. Comparison of the crystal structures of the Tyr82 variant and wild-type proteins shows that the positioning of the Tyr82 and Phe82 aromatic rings differ significantly, whereas the conformation of the Leu85 side chain is very similar in.the two proteins [(XI, X2) are ( -98° , - 7 0 ° ) and (-99°, - 8 1 ° ) , respectively]. The origin of the discrepancy between the results from the two methods is unclear. It should be noted, however, that the crystallographically observed structural changes give rise to only very small differences in interatomic distances between Tyr82 CD1.CE1 and adjacent internal methyl groups (of Met80 CE, Hem CBB and CMC, and Leu 68 CD1), for which the corresponding NOE's have been observed to be little affected. In addition, that the conformation of the Leu85 side chain differs in the two proteins is inconsistent with the absence of significant perturbations both in the chemical shifts of the protons of this group, and in the NOE's between this group and adjacent groups in the heme pocket other than the side chain of residue 82 (Pielak et al., 1988a). C. Correlation of structural changes with differences in functional properties 1. Accessibility of the heme crevice and polarity of the heme environment Despite the more external positioning and slightly altered orientation of the TyT82 phenolic ring with respect to the plane of the heme group, the degree of exclusion of solvent from the upper left portion of the heme crevice in the Tyr82 variant differs little from that in wild-type iso-1-cytochrome c (see Figure VII.4). The solvent accessibility of the heme group in the Tyr82 variant (46.8 X2) is actually decreased slightly from that in the wild-type protein (48.8 X2). These results are consistent with the slightly reduced reactivity of the Tyr82 variant with Fe(EDTA)2" (6.2 X 10' M^s"1 as compared to 7.2 X 104 M^s - 1 for wild-type iso-1-cytochrome c). A comparison of the heme pockets of the Tyr82 variant and wild-type iso-1-cytochromes c shows that the most notable difference is the presence of a polar hydroxyl group on the side chain of Tyr82. The reduction potential of the Tyr82 variant is observed to be 202 Figure VBL4. Molecular surface in the region of residue 82 in the Tyr82 variant iso-1-cytochrome c. The dot surface represents the region of the protein molecule which is accessible to solvent, and was calculated (Connolly, 1983) using a probe sphere of radius 1.4 A. The direction of view is identical to that in Figure V.4, and thus the illustrated region of the surface of Tyr82 variant can be directly compared with that of the wild-type iso-1-cytochrome c molecule presented in the earlier figure. slightly lower than that of wild-type iso-1-cytochrome c (280 mV vs. 290 mV). The 10 mV drop is the smallest perturbation in reduction potential observed for any of the position 82 variants studied thus far, and is in agreement with the similarity in the heme environments of the Tyr82 variant and wild-type iso-1-cytochromes c. The small drop in reduction potential may arise from the slight increase in the polarity of the heme pocket effected by the Tyr82 hydroxyl group. Notably, Watl66, whose positioning appears to be affected by the reduction potential of the iso-1-cytochrome c protein, occupies a position in the Tyr82 variant not significantly different from that of Watl66 in the wild-type molecule. In contrast, in the Ser82 and Gly82 variants, which have reduction potentials -50mV below that of wild-type iso-1-cytochrome c, Watl66 has undergone a significant shift toward the heme iron (see Sections V.B.3 and VI.B.3). 2. Stability of the heme crevice The pK a for .the alkaline isomerization of the Tyr82 variant is observed to be 8.4, only 0.1 pH units below that of wild-type iso-1-cytochrome c. Thus, it can be inferred that the stability 203 of the heme crevice of the Tyr82 variant is not significantly different from that of the wild-type protein. Nonetheless, comparison of the structures of the Tyr82 variant and wild-type iso-1-cytochromes c in the vicinity of residue 82 does suggest at least two structural features which would be expected to destabilize the folded state of the Tyr82 variant First, the more external positioning of the phenolic ring of Tyr82 would be expected to perturb the packing interactions formed between the side chain of residue 82 and the surrounding hydrophobic groups of the heme crevice (see Section III.H.l) and to lower the packing efficiency in this region of the iso-1-cytochrome c molecule. Secondly, in the conformation adopted by the side chain of Tyr82, the polar hydroxyl group makes a repulsive van der Waals contact with the side chain of Leu85 (the Tyr82 OH - Leu85 CG distance is 3.01 X). A comparison of atomic temperature factors does give a direct indication of greater mobility (and thus by inference, a less stable conformation) of this region of the Tyr82 variant The average B-factor for the phenyl ring of Phe82 in the wild-type molecule is 15.1 X2, whereas that for the phenolic ring of Tyr82 is 18.5 X2. 3. Electron transfer activity Of the position 82 variants studied thus far, the Tyr82 variant is the only one that is oxidized by Zn+-cytochrome c peroxidase in the preformed complex between these two proteins at a rate comparable to that observed for wild-type iso-1-cytochrome c (1.5 X 104 s_1 vs. 1.9 X 10" s~\ respectively) (Liang et al., 1987, 1988). The interpretation of these results is that within the cytochrome c molecule, coupling of the ir-electron systems of an aromatic group at position 82 and the heme group functions to facilitate electron transfer between Zn*-cytochrome c peroxidase and iso-1-cytochrome c (Liang et al., 1987, 1988). This proposal is supported by structural comparison of the Tyr82 variant and wild-type iso-1-cytochromes c, which shows that the phenolic ring of Tyr82 and the phenyl ring of Phe82 have an analogous positioning parallel to the heme group of the iso-1-cytochrome c molecule. Although the Tyr82 variant has a normal reactivity with both 3 Zn- and Zn+-cytochrome c peroxidase, its steady state activity with native cytochrome c peroxidase is decreased to 30% of that observed for wild-type iso-1-cytochrome c. Because the capacity of the Tyr82 variant to transfer 204 an election to cytochrome c peroxidase is apparently normal, the decreased steady state activity would appear to result from an alteration in some other aspect of the bimolecular reaction. One possibility is perturbed complexation. In the modelled complex between cytochrome c and cytochrome c peroxidase, the side chain of Phe82 forms important hydrophobic interactions at the interface between the two protein molecules, and the side chain of Argl3 is involved in an intermolecular salt bridge with an aspartate side chain (Lum et al., 1987; Poulos and Kraut, 1981). Consideration of the proposed model suggests two factors which may inhibit the optimal association of the Tyr82 variant with cytochrome c peroxidase. First, the more external positioning of the side chain of Tyr82 may interfere sterically with complex formation. Secondly, because the side chain of Argl3 is involved in intramolecular hydrogen bonding with the side chain of Tyr82, it would be less available for participation in an intermolecular salt bridge. It should be noted that the rate of electron transfer from 3Zn-cytochrome c peroxidase to iso-1-cytochrome c, which is affected by the distance separating the redox centres, is normal for the Tyr82 variant This suggests that the iron-zinc distance in the preformed complex between the Tyr82 variant and Zn-cytochrome c peroxidase is not greatly perturbed. Therefore, if the structural differences between the Tyr82 variant and wild-type iso-1-cytochrome c are responsible for the observed decrease in steady state activity of the Tyr82 variant in reducing cytochrome c peroxidase, their effects are in slowing the rate of complex formation, or alternatively in inhibiting conformational rearrangements that occur in the cytochrome c molecule after the electron transfer has taken place (Liang et al., mi, 1988; Hoffman and Ratner, 1987). 205 VHL ISOLEUCINE 82 VARIANT OF YEAST ISO-1-CYTOCHROME c A. Details of the structure determination 1. X-ray diffraction data The set of diffraction intensities to 2.3 X resolution, 4375 reflections in total, for the Ile82 variant of iso-1-cytochrome c was measured from a single crystal, and was obtained from Dr. W. Hutcheon. Background averaging was used in the processing of the diffraction data. For the resultant set of structure factors, a scale factor of 38.2 was indicated by a linear rescale against common structure factors in the resolution range » to 2.6 X from the data set for wild-type iso-1-cytochrome c. The R-factor between the two data sets was 0.256 (considering only the reflections included in the linear rescaling). 2. Difference maps A difference map (Figure VILLI) was calculated using the coefficients FQ( wild-type) -F0(Ile82), and phases derived from a wild-type iso-1-cytochrome c atomic model which had been Figure VHL1. Stereo drawing of the FQ(wild-type) - F0(Ile82) difference map in the vicinity of residue 82. The atomic skeleton of iso-1-cytochrome c determined at 1.23 X resolution is superimposed on the difference electron density envelopes. Positive density (solid lines) has been contoured at two levels, and negative density (dashed lines) at a single level. 206 refined at 1.23 X resolution to an R-factor of 0.192 (see Section III). The most significant features of this map, as interpreted with respect to the superimposed structure of the wild-type protein, occurred in the vicinity of Phe82 and Cysl02. Positive density enveloped the upper edge of the phenyl ring of Phe82 and also portions of the main chain atoms of residues 82 through 84. A diffuse negative peak occurred adjacent to Phe82 CB. The difference electron density peaks near Phe82 thus confirmed the amino acid replacement at this site, but could not clearly define the positioning of the substituted isoleucine side chain. This was more clearly indicated by a 2F0(Ile82) - F c ' map, for which the calculated structure factors excluded the contribution of residues 81 through 85 of the wild-type protein. This map was also consulted in adjusting slightly the conformation of the polypeptide backbone at residues 81 through 85. The positive difference electron density peak centred at the position of Cysl02 SG and an adjacent negative peak were identical to those observed in difference maps for the Thrl02-containing Gly82 and Tyr82 variants. 3. Refinement of the structure of the Ile82 variant The initial model used in the refinement of the Ile82 variant was derived from the 1.23 X resolution wild-type iso-1-cytochrome c structure. It incorporated adjustments to residues 81 through 85 based on the difference maps discussed above, as well as the sulfate ion and 73 water molecules having temperature factors less than 40 X 2 from the wild-type model. The amount of diffraction data included in the refinement was increased in three stages. Initially, 5 cycles of refinement against data with F > 3a p in the resolution range 6.0 - 2.6 X (1600 reflections) yielded a reduction in R-factor from 0.211 to 0.163. Next, 1848 reflections with F >. 3ap in the resolution range 6.0 - 2.3 X were included, and 11 cycles of refinement resulted in an atomic model with an R-factor of 0.162. In the final stage, 4 refinement cycles were carried out, using data with F > 2a p in the resolution range 6.0 - 2.3 X (2460 reflections, corresponding to 58% of the available reflections). At various intervals, minor manual adjustments to the atomic model were made through inspection of 2FQ - F c or F Q - F c ' difference electron density maps. The final refined structure of the Tle82 variant of iso-1-cytochrome c has an R-factor of 0.182 and has very good agreement with ideal stereochemistry (see Table VTII.l). Table VHI.1. Agreement with ideal stereochemistry in the final refined model of the Ile82 variant of yeast iso-1-cytochrome c at 2.3 X resolution Class of restraint R.m.s. deviation from ideality 1-2 bond distance 0.012 X 1-3 angle distance 0.028 X 1-4 planar distance 0.034 X Planar 0.012 X Chiral centre 0.151 X 3 Non-bonded contact3 single torsion 0.203 X multiple torsion 0.167 X possible hydrogen bond 0.211 X Staggered (±60°, 180°) torsion angle 20.6° Planar torsion angle (0 or 180°) 2.3° Temperature factor 1-2 bond (main chain) 1.0 X 2 1-3 angle (main chain) 1.6 X 2 1-2 bond (side chain) 1.8 X 2 1-3 angle (side chain) 3.0 X 2 aThe r.m.s. deviations from ideality for this class of restraint incorporate a reduction of 0.1 X from the radius of each atom involved in a contact B. Structural comparison of the Ile82 variant and wild-type iso-1-cytochromes c The replacement of Phe82 by isoleucine causes a slight rearrangement in the conformation of the polypeptide backbone at residues 81 through 85. However, the overall conformation of the iso-1-cytochrome c molecule is little affected. A residue-by-residue comparison of the main chain atomic positions and of conformational torsion angles in the Ile82 variant and wild-type iso-1-cytochromes c is shown in Figure VIII.2. The overall r.m.s. difference between positions of corresponding main chain atoms is 0.20 X , and the overall r.m.s. differences between phi and psi angles are 7.3° and 6.5°, respectively. The heme groups of the Ile82 variant and wild-type iso-1-cytochromes c do not differ significantly in either overall positioning or conformation, as the mean difference in atomic positions of the 43 heme atoms is only 0.15 X . The side chain of 208 Residue number Figure Vm.2. Comparison of the polypeptide backbone conformations of the Ile82 variant and wild-type iso-1-cytochromes c. The lower plot indicates the average deviations observed between the positions of main chain atoms in corresponding residues of the two proteins. The upper plot indicates the deviations in the main chain conformational torsion angles <p (—) and ^ ( ) of corresponding residues. Ile82 adopts a tg+ conformation (XI = 169°, X 2 = - 9 7 ° ) such that the smaller of the two branches emanating from CB is directed downward toward the Met80 ligand. The CG2 atom (see Figure VIII.3) makes van der Waals contacts with both the Met80 CG (interatomic distance 3.2 X ) and CE (3.3 X ) carbon atoms. The observed adjustments in the conformation of the polypeptide backbone in the vicinity of Ile82 likely occur in order to relieve these steric conflicts. In the Ile82 variant, the main chain of residue 82 has shifted -0.6 X upward with respect to its position in the wild-type molecule. Accompanying shifts of Gly83 and Gly84 by 0.4 X also occur. These 209 Figure VIIL3. Stereo drawing of the region around residue 82 in the Ile82 variant (thick lines) and wild-type (thin lines) iso-1- cytochromes c. The heme groups and the polypeptide chain of residues 13 through 14, 68 through 71, and 79 through 85 of the two proteins are shown superimposed. movements are accommodated by small adjustments in main chain torsion angles within this region, most notably i// of Ala81 by -21°, and <j> of Leu85 by -21°. With the observed positioning of the Ile82 side chain, the positions of the CGI and CD1 atoms coincide roughly with those of the Phe82 CD2 and CE1 atoms in the wild-type molecule. The vacated space formerly occupied by CE2 and CZ of Phe82 allows the side chain of Argl3 to adopt a positioning closer to the body of the molecule and to form a hydrogen bond to the carbonyl group of Gly84. The occurrence at residue 82 of a side chain branched at the 0- carbon appears to induce considerable steric strain. As described above, the conformation adopted by the De82 side chain projects the CG2 atom directly at the Met80 ligand. However, a search for other possible orientations for the Ile82 side chain related by a rotation about the CA-CB bond clearly demonstrates that only the average conformation observed in the final refined atomic model is sterically permissible. Due to its branching at the CB atom, an isoleucine side chain typically strongly prefers a conformation which places its CG atoms gauche to both the N and C main chain atoms (McGregor et al., 1987). Adoption of the g~ conformation would rotate the longer 210 arm of the Ile82 side chain downward into the heme pocket, and is thus prohibited by close contacts between the CD1 atom and the Met80 side chain. Rotation in the opposite direction (toward the exterior of the molecule) would generate the most commonly favored g* conformation for an He side chain, but is prevented by conflicts between the CGI atom and the carbonyl group of Ala81. Thus the environment of Ile82 requires that this side chain adopt the least preferred t conformation [observed in less than 15% of isoleucines surveyed in various protein structures (McGregor et al., 1987; Ponder and Richards, 1987)]. However, some disorder in the positioning of the Ile82 side chain is apparent from the diffuse electron density observed for this group in -electron density maps. It is notable that despite the poor accommodation of the Ile82 side chain, no substantial refolding of the polypeptide backbone occurs, thus indicating that the main chain of residues 81 through 85 may be constrained to adopt a native-like conformation. As discussed earlier, an important determinant of this conformation in the wild-type molecule appears to be favorable packing interactions formed by the phenyl ring of Phe82. As these interactions are clearly disrupted in the Ile82 variant, it seems likely that in the Ile82 variant the presence of a side chain at residue 82 limits the conformational flexibility of the adjacent region of polypeptide chain. (Recall that in the Gly82 variant, it is the adoption by Gly82 of conformational torsion angles permissible only for a residue without a side chain that allows the substantial localized refolding.) In addition, restrictions on the conformations accessible to the main chain about residue 82 may be imposed by the requirement to exclude polar protein groups and solvent from the hydrophobic pocket located below the side chain of residue 82, or by stabilizing hydrogen bond interactions formed between polar main chain groups and water molecules (in particular Watl72, see Section VI.C.3). C. Correlation of structural changes with differences in functional properties . 1. Accessibility of the heme crevice and polarity of the heme environment The reduction potential of the Ile82 variant is -20 mV lower than that of wild-type iso-1- cytochrome c (273 mV vs. 290 mV). A structural explanation for this drop in reduction 211 potential is not readily apparent The side chain of Ile82 in the Ile82 variant occupies the same hydrophobic cavity in the heme pocket as the phenyl ring of Phe82 in the wild-type protein, although the smaller volume and shorter length of the isoleucine side chain means that this cavity is less completely filled in the former protein. This results in a small indentation in the surface of the Ile82 variant molecule, located between the Ile82 CD1 and Leu85 CG atoms (see Figure V1II.4). However, because this perturbation in packing occurs directly below the aliphatic portion of the side chain of Argl3, the heme group of the Ile82 variant is not rendered more accessible to solvent (the total solvent accessibility is 46.6 A \ as compared to 48.8 A 2 in the wild-type protein). The polarity of the heme pocket in the Ile82 variant would also not be expected to altered greatly by the occurrence of the non-polar isoleucine side chain. Considering the absence of obvious differences between the Ile82 variant and wild-type iso-1-cytochromes c in heme pocket polarity and solvent acessibility, one can speculate on the Figure Vm.4. Molecular surface in the region of residue 82 in the Ile82 variant iso-1-cytochrome c The dot surface represents the region of the protein molecule which is accessible to a probe sphere of radius 1.4 A (Connolly, 1983). Note the occurrence of a cavity beneath the external (solvent accessible) surface of the Ile82 variant molecule. This cavity is formed by the side chains of Leu68, Ile82 and Leu85, and the main chain of residues Gly83 and Gly84. The direction of view is identical to that in Figure V.4, and thus the illustrated region of the surface of Ile82 variant can be directly compared with that of the wild-type iso-1-cytochrome c molecule presented in the earlier figure. 212 cause of the decreased reduction potential of the Ile82 variant One possible explanation is that the phenyl group of the Phe82 exerts a specific inductive effect on the it-electron system of the heme group. Wallace et al. (1989) have proposed that such an effect accounts for the drop in reduction potential arising from a Phe substitution at Tyr67. An alternative explanation is that steric contacts involving the Ue82 side chain may destabilize the conformation of the polypeptide backbone about residue 82, and thus cause transient unfolding of this segment of the polypeptide chain. Such transient unfolding may be reflected in the diffuse electron density apparent for the main chain of residues 82 and 83, and also in the decreased stability of the heme crevice in the Ile82 variant (see below), and would be expected to increase the effective accessibility of solvent to the heme group in this protein. This proposal may also explain the increased exposure of the heme group as indicated by the slightly elevated reactivity of the Ile82 variant with Fe(EDTA)2" (9.4 x 10" M^s"1 as compared to 7.2 x 10" M^s"1 for wild-type iso-1-cytochrome c). As previously discussed, the position of the buried water molecule Wat 166 at the lower left of the heme crevice appears to be sensitive to the reduction potential of the heme iron. Interestingly, the position of Watl66 in the Ile82 variant is intermediate to those occurring in the Tyr82 variant or wild-type protein (which have normal reduction potentials) and the Ser82 or Gly82 variants (which have 50mV lower reduction potentials). Thus, in this series of position 82 variants, the magnitude of the positional shift of Watl66 appears to be correlated with the size of the drop in reduction potential. 2. Stability of the heme crevice Of the position 82 variants studied thus far, the Ile82 variant has the most greatly perturbed pK a for alkaline isomerization, 7.2 as compared to 8.5 for wild-type iso-1-cytochrome c. The decrease in pK a indicates that the stability of the heme crevice is considerably reduced in this variant The most important factor in the reduced stability is likely the destabilization of the native conformation of the polypeptide backbone about Ile82 induced by steric contacts between the Ile82 side chain and adjacent groups in the heme crevice. As shown in Figure VIII.4, a small void is created in the heme crevice adjacent to the Ile82 side chain. Thus, a disruption of the 213 packing interactions normally formed by the phenyl ring within its hydrophobic cavity may also contribute to the lowered stability of the Ile82 variant 3. Electron transfer activity The Ser82, Gly82 and Ile82 variants all show a decrease by a factor of TO 4 in reaction rate with Zn+-cytochrome c peroxidase. As discussed earlier, this decreased reactivity is attributed to the lack of an aromatic side chain at position 82, which apparently functions to facilitate electron transfer by interacting with the it-electron system of the heme group. Consistent with this proposal is that in the Ile82 variant protein, the volume of space filled by the phenyl ring of Phe82 in the wild-type protein is now occupied by the aliphatic side chain of Ile82 and empty space. The Ile82 variant also has a significantly lowered reduction rate for the photo-initiated electron transfer from 3 Zn-cytochrome c peroxidase. This result indicates that the Ile82 variant may interact with Zn-cytochrome c peroxidase to form a perturbed complex, in which the distance separating the redox centres is longer than normal. Such a perturbation may be caused by the fairly substantial (~0.7 A) displacement, in an upward direction, of the polypeptide backbone in the vicinity of Ile82. 214 IX. ALANINE 38 VARIANT OF YEAST ISO-1 - CYTOCHROME c A. Details of the structure determination 1. X-ray diffraction data Diffraction data to 2.0 X (7050 reflections in total), for the Ala38 variant of iso-1-cytochrome c were collected from a single crystal. Background averaging was used in the processing of diffraction intensities. For the resultant set of structure factors, a scale factor of 43.6 was indicated by a linear rescale against common structure factors in the resolution range °° to 2.6 X from the data set for wild-type iso-1-cytochrome c. The R-factor between the two data sets was 0.27 (for the reflections included in scaling). 2. Difference map A difference map (Figure LX.1) was calculated using the coefficients F0(wild-type) -F0(Ala38), and phases derived from a wild-type iso-1-cytochrome c atomic model which had been refined at 1.7 X resolution to an R-factor of 0.197. This map was interpreted with respect to the Figure DLL Stereo drawing of the F0(wild- type) - F0(Ala38) difference map in the vicinity of residue 38. The atomic skeleton of iso-1-cytochrome c determined at 1.7 X resolution is superimposed on the difference electron density envelopes. Positive density (solid lines) has been contoured at two levels, and negative density (dashed lines) at a single level. 215 superimposed structure of the wild-type protein, and confirmed the replacement of Arg38. Positive electron density enveloped the entire Arg38 side chain, with the exception of the CB atom. No other significant positive or negative peaks were observed in the vicinity of the amino acid substitution site. The replacement of Cysl02 by Thrl02 in the Ala38 variant was evidenced by a strong positive peak at the SG atom of Cysl02, and an adjacent negative peak. 3. Refinement of the structure of the Ala38 variant The difference map indicated that structural changes occurring in the Ala38 variant were essentially limited to a deletion of the terminal 6 atoms (CG onwards) of the Arg38 side chain. Therefore, an initial model for the Ala38 variant was constructed from the 1.7 X resolution wild-type iso-1-cytochrome c structure. For residue 38, only the CB carbon atom was retained; and for residue 102, a threonine side chain having a g~ conformation [as observed in the structures of the Gly82(Thrl02) and Tyr82 variants] was appended to the a-carbon. Of the 98 water molecules and 1 sulfate ion present in the original wild-type iso-1-cytochrome c model, all were retained except for three water molecules (Watl08, 121 and 168) which form hydrogen bonds to the guanidinium group of Arg38. The amount of diffraction data included in the refinement of the Ala38 variant was increased in three stages. The initial model was refined against data with F > 2.5a p in the resolution range 6.0 - 2.5 X (1664 reflections). Nine cycles lowered the R-factor from 0.226 to 0.167. Next, 2083 reflections with F > 2.5a p in the resolution range 6.0 - 2.0 X were included, and 4 cycles of refinement resulted in an atomic model with an R-factor of 0.198. In the final stage, 11 refinement cycles were carried out, using data with F > 2a p in the resolution range 6.0 - 2.5 X and F > 2.5aF in the range 2.5 - 2.0 X (2356 reflections in total, corresponding to 36% of the available reflections in the 6.0-2.0 X range). At various intervals, the atomic model was inspected against 2FQ - F c or F 0 - F c ' electron density maps. Slight adjustments to the conformation of the polypeptide chain of residues 35 through 40 were made after the first stage of refinement No other substantial manual adjustments to the protein molecule were required. However, a number of changes were made to the solvent structure in the vicinity of the 216 Table DLL Agreement with ideal stereochemistry in the final refined model of the Ala38 variant of yeast iso-1-cytochrome c at 2.0 X resolution Glass of restraint R.m.s. deviation from ideality 1-2 bond distance 0.012 X 1-3 angle distance 0.028 X 1-4 planar distance 0.033 X Planar 0.012 X Chiral centre 0.147 X 3 Non-bonded contact3 single torsion 0.201 X multiple torsion 0.189 X possible hydrogen bond 0.203 X Staggered (±60°. 180°) torsion angle 23.7° Planar torsion angle (0 or 180°) 2.3° Temperature factor 1-2 bond (main chain) 0.6 X 2 1-3 angle (main chain) 1.0 X 2 1-2 bond (side chain) 0.5 X 2 1-3 angle (side chain) 0.9 X 2 aThe r.m.s. deviations from ideality for this class of restraint incorporate a reduction of 0.1 X from the radius of each atom involved in a contact substitution site, including the reincorporation of Watl21 and Watl68 (see below). The final refined structure of the Ala38 variant of iso-1-cytochrome c has an R-factor of 0.187 and good agreement with ideal stereochemistry (see Table IX.l). B. Structural comparison of the Ala38 variant and wild-type iso-1-cytochromes c 1. Polypeptide chain conformation The replacement of an arginine residue at position 38 with an alanine has very little effect on the overall conformation of the iso-1-cytochrome c molecule. Figure IX.2 shows a comparison of the Ala38 variant and the wild-type protein in terms of the average positional difference between main chain atoms and the differences in conformational torsion angles of corresponding 217 Residue number Figure BL2. Comparison of the polypeptide backbone conformations of the Ala38 variant and wild-type iso-1-cytochromes c. The lower plot indicates the average deviations observed between the positions of main chain atoms in corresponding residues of the wild-type and Ala38 variant iso-1-cytochromes c. The upper plot indicates the deviations in the main chain conformational torsion angles 4> (—) or \p ( ) of corresponding residues of the two proteins. residues. The overall r.m.s. difference between positions of corresponding main chain atoms is 0.20 X, and the overall r.ras. differences between phi and psi angles are 6.2 and 7.2 . respectively. The most notable positional shifts observed in the vicinity of the substitution site are associated with rearrangements within the network of hydrogen bonds formed by the surrounding polypeptide chain (see Figure IX.3). Wat 121, an internal water molecule formerly hydrogen bonded to the guandinium group of Arg38, and the side chain of Tyr48 shift closer together to 218 Figure DL3. Stereo drawing of the region around residue 38 in the Ala38 variant (thick lines) and wild-type (thin lines) iso-1-cytochromes c. The heme groups and the polypeptide chain of residues 30 through 48 and 56 through 59 of the two proteins are shown superimposed. Also shown are the water molecules Watl21 and 168 in both proteins; and Watl64 and 199 in the Ala38 variant, which fill the space vacated by the side chain of Arg38. Hydrogen bond interactions are shown as thin dashed lines, with those unique to either the Ala38 variant ('a') or the wild-type protein (V) labelled. allow the formation of a Tyr48 OH-Watl21 hydrogen bond. An adjustment in the geometry of the nearby /3-turn (residues 43 to 46) is also observed. In the wild-type molecule, this turn is distorted as a bridging water molecules mediates the interaction between Ala43 N and Tyr46 O, whereas a direct hydrogen bond between these groups occurs in the Ala38 variant It was proposed earlier that packing of the side chain of Tyr46 against Pro30 is partly responsible for the distortion of this /3-turn in the wild-type protein (see Section HI.B.3). The observation of Moore and Williams (1980b) that the spatially adjacent aromatic rings of Tyr46 and Tyr48 interact conformationally suggests that the adjustment in the /3-turn is brought about by the movement of the tyrosyl ring of Tyr48, which in turn influences the conformation of Tyr46. The observed adjustments in the hydrogen bonding pattern suggest that there is significant flexibility in the formation of the hydrogen bonding interactions within the bottom loop of the molecule. This flexibility is also evident in the variations in conformation observed for the side chain of Arg38 itself in yeast iso-1-, tuna and rice cytochromes c (see Section IV.B.2 and Figure IV.7). Wallace's group (Proudfoot et al., 1986; also see Table 1.2) has shown that amino acid replacements at Arg38 lower the overall stability of the cytochrome c molecule. Based on the 219 observation that the side chain of Arg38 extends upward from the bottom loop of the polypeptide chain to form hydrogen bonds with groups in the main body of the molecule, Proudfoot and Wallace (1987) have suggested that the role of this residue is in conformational stabilization of this bottom loop. Replacement of Arg38 might therefore be expected to perturb the structure of this loop (residues 36 to 59). However, apart from the localized deviations described above, the overall folding of these residues does not differ significantly between the Ala38 variant and wild-type iso-1-cytochromes c (see Figure IX.2). Nor is there any substantial dissimilarity between the two proteins in the flexibility of this loop of polypeptide chain (as assessed by atomic temperature factors). Thus comparison of the crystal structures of the Ala38 variant and wild-type iso-1-cytochromes c gives no obvious indication that Arg38 directly influences the conformational properties of the bottom loop. It should be noted, however, that structural destabilization effected by replacement of Arg38 may arise from an increased frequency of transient unfolding. This possibility cannot be assessed in a crystallographic study, which cannot provide information on such high frequency processes (Ringe and Petsko, 1985). 2. Propionic acid group of heme pyrrole ring A The heme groups of the Ala38 variant and wild-type iso-1-cytochromes c do not differ significantly in either overall positioning or conformation. The mean difference in position of the 43 heme atoms is only 0.18 X, and of the 5 atoms of the rear propionic acid group is 0.26 X. Thus, the positioning of this propionic acid group of the heme is not significantly affected by the absence of the interaction between this group and the guanidinium group of Arg38. This result is in agreement with NMR studies which show tha