UBC Theses and Dissertations

UBC Theses Logo

UBC Theses and Dissertations

The bacterial production of antimicrobial, cationic peptides and their effects on the outer membranes.. Piers, Kevin Lee 1993-12-31

You don't seem to have a PDF reader installed, try download the pdf

Item Metadata

Download

Media
ubc_1994-89430x.pdf [ 3.52MB ]
Metadata
JSON: 1.0099224.json
JSON-LD: 1.0099224+ld.json
RDF/XML (Pretty): 1.0099224.xml
RDF/JSON: 1.0099224+rdf.json
Turtle: 1.0099224+rdf-turtle.txt
N-Triples: 1.0099224+rdf-ntriples.txt
Original Record: 1.0099224 +original-record.json
Full Text
1.0099224.txt
Citation
1.0099224.ris

Full Text

THE BACTERIAL PRODUCTION OF ANTIMICROBIAL, CATIONIC PEPTIDES AND THEIR EFFECTS ON THE OUTER MEMBRANES OF’ GRAM-NEGATWE  BACTERIA  by  KEVIN LEE PIERS B.Sc. (Hons., Genetics), The University of Alberta, 1987  A THESIS SUBMITTED IN PARI’IAL FULFILLMENT OF THE REQUIREMENTS FOR THE DEGREE OF DOCTOR OF PHILOSOPHY in THE FACULTY OF GRADUATE STUDIES (GENETICS PROGRAM)  We accept this thesis as conforming  THE UNIVERSITY OF BRITISH COLUMBIA December, 1993 © Kevin Lee Piers, 1993  In presenting this thesis  in  partial fulfilment of the requirements for an advanced degree at the University of British Columbia, I agree that the Library shall make it freely available for reference and study. I further agree that permission for extensive copying of this thesis for scholarly purposes may be granted by the head of my department or by his or her representatives. It is understood that copying or publication of this thesis for financial gain shall not be allowed without my written permission.  (Signature)  Department of Microbiology and Immunology The University of British Columbia Vancouver, Canada Date December 20, 1993  DE.6 (2/88)  ABSTRACT  Natural polycationic antibiotic peptides have been found in many different species of animals and insects and shown to have broad antimicrobial activity.  To permit further studies on these peptides, bacterial expression  systems were developed. Attempts to express these peptides with an N-terminal signal sequence were unsuccessful due to the lability of the basic peptides. Therefore, different fusion protein systems were tested, including fusions to glutathione-S-transferase (GST) and Staphylococcus aureus protein A. For GST, fusions to the defensin, human neutrophil peptide 1 (HNP- 1), or a synthetic cecropin/melittin hybrid (CEME) were generally unstable if found in the soluble fraction of lysed cells, but were stable if found as insoluble inclusion bodies. In the course of these studies, we developed a novel method of purilring inclusion bodies, using the detergent octyl-polyoxyethylene, as well as establishing methods for preventing fusion protein proteolytic breakdown. Cationic peptides could be successfully released from the GST carrier protein with high efficiency by chemical means (cyanogen bromide digestion) and with low efficiency by enzymatic cleavage (using factor Xa). Fusions of protein A to cationic peptides were expressed in the culture supernatant of S. aureus clones and after affinity purification, CNBr digestion and column chromatography, pure cationic peptide was obtained.  CEME produced by this procedure had the same amino acid  content, amino acid sequence, gel electrophoretic mobility and antibacterial activity as CEME produced by protein chemical procedures. Three catiorilc peptides, CEME, CEMA and melittin, were all found to have a broad range of antibacterial activity at concentrations that were comparable to conventional antibiotics. All three were found to permeabiize the outer membrane of Pseudomorias aeruginosa and Enterobacter cloacae to  lysozynie and the hydrophobic probe l-N-phenylnaphthylamine.  CEMA  II  permeabiized membranes at concentrations 2- to 5-fold lower than CEME and 20-fold lower than melittin. In some cases, it disrupted membranes better than polymyxin B, a known potent permeabilizer.  CEMA also had the highest  binding affinity for purified P. aeruginosa LPS and whole cells, although CEME and melittin also bound strongly. These data are discussed with special reference to the mechanism by which these peptides cross the outer membrane of Gram-negative bacteria. It is proposed that they utilize the self-promoted uptake pathway which has been suggested previously for other cationic antibiotics. As well, the potential for the use of cationic peptides as therapeutic antibiotics is discussed.  III  TABLE OF CONTENTS ABSTRACT  ii  TABLE OF CONTENTS  iv  LIST OF FIGURES  vifi  LIST OF TABLES  x  LIST OF ABBREVIATIONS  xi  ACKNOWLEDGMENTS  xifl  DEDICATION  xiv 1  INTRODUCTION  A.  B.  C.  Pseudomonas aeruginosa  1  1.  Clinical Considerations  1  2.  Outer Membrane Structure  2  3.  Outer Membrane Permeabffity and Antibiotic Uptake  6  4.  Self-Promoted Uptake of Antibiotics  9  Cationic Peptides  11  1.  Introduction  11  2.  Defensins  11  3.  Cecropins  18  4.  Melittin  22  5.  Synthetic and Hybrid Peptides  26  Fusion Protein Technology  30  1.  Introduction  30  2.  Glutathione-S-transferase  34  3.  Protein A  35  4.  Inclusion Body Formation and Protein Degradation  36  5.  Expression of Cationic Peptides  38  D. Aims of This Study  40  MATERIALS AND METHODS  42  A.  Strains, Plasmids and Growth Conditions  42  B.  Genetic Manipulations  42  1.  General DNA Techniques  42  2.  DNA Fragment Isolation  48  3.  DNA Sequencing  48  4.  Polymerase Chain Reaction  49  5.  Transformation and Electroporation  49  iv  6. C.  D.  E.  F.  G.  H.  Oligonucleotide Pufication  Vector Construction  .  50 51  1.  Direct Expression Vectors  51  2.  GST Expression Vectors  57  3.  Protein A Expression Vectors  58  Immunological Techniques  59  1.  Production and Purification of Antibodies  59  2.  Western Blotting  59  Electrophoresis  60  1.  SDS-PAGE  60  2.  AU-PAGE  60  Protein Expression  60  1.  Direct Expression  60  2.  GST Fusions  61  3.  Protein A Fusions  61  Fusion Protein Purification  62  1.  GST Fusion Proteins  62  2.  Protein A Fusion Proteins  63  Peptide Release  64  1.  Factor Xa  64  2.  Cyanogen Bromide  64  I.  Peptide Purification  65  J.  Gel Overlay Assay  65  K.  Peptide Analysis  66  L.  1.  Preparation of Samples  66  2.  Amino Acid Sequencing and Analysis  66 67  Assays 1.  Protein Concentration Estimation  67  a.  Lowry  67  b.  Dinitrophenylation  67  2.  Killing Assay  68  3.  Lysozyme Lysis  68  4.  1-N-phenylnaphthylamine Uptake  69  5.  Dansyl Polymyxin B Displacement  69  a.  Lipopolysaccharide Isolation  69  b.  Dansyl Polymyxin B Synthesis  70  V  c. 6.  Assay. 70  Minimum Inhibitory Concentration  71 73  RESULTS CHAPTER ONE. The Production of Cationic Peptides as GST Fusion  73  Proteins  A.  Introduction: Why Fusion Proteins Are Necessary  73  B.  Construction of the pGEX-KP Vector  74  C.  The Production and Purification of GST/HNP-1  74  D.  Factor Xa Cleavage of GST/HNP-1  85  E.  The Production of GST/proHNP- 1  91  F.  The Production of GST/CEME  94  G. The Production and Purification of GST/pr0CEME  96  H. The Release of CEME From GST/proCEME Using CNBr  98  I.  99  Summary  CHAPTER TWO: The Production of Cationic Peptides as Protein A Fusion Proteins  102  A.  Introduction  102  B.  Construction of the Vectors  102  C.  Expression of pPA-CEME in .E. coiL  104  D.  Expression and Purification of Protein A/Cationic Peptide Fusion Proteins in S. aureus  104  E.  Release and Purification of CEME  106  F.  Purification of Other Cationic Peptides  110  G. Summary CHAPTER THREE: Antimicrobial Activity of Cationic Peptides  113 114  A.  Introduction  114  B.  Killing of P. aerugthosaHl87byCEME  115  C.  Minimum Inhibitory Concentrations  115  D. The Effect of Cations on the MIC of Cationic Peptides  120  E.  Synergy Studies with Cationic Peptides and Other Antibiotics  121  F.  Summary  125  CHAPTER FOUR: Membrane Permeabilizing Activities of Cationic 126  Peptides  A.  Introduction  126  B.  Lysozyme Lysis Assays  126  C.  1-N-phenylnaphthylamine Uptake Assay  130  vi  D.  Dansyl Polymyxin B Displacement Assays  E.  Summary  .  DISCUSSION  134 136  140  A.  General  140  B.  Direct Expression  141  C.  Comparison of Different Fusion Protein Systems  142  D. A New Strategy for Solubiizing Inclusion Bodies  148  E.  Comparison of Fusion Protein Cleavage Methods  150  F.  Do Cationic Peptides Cross the Outer Membrane via the Self  G.  Promoted Uptake Pathway 9  152  Catiornc Peptides As Therapeutic Agents  156  REFERENCES  160  VII  LIST OF FIGURES  Schematic representation of the outer membrane and peptidoglycan of P. aeruginosa  4  Figure 2:  Schematic diagram of the self-promoted uptake model  10  Figure 3:  Amino acid sequences of selected cationic peptides  14  Figure 4:  Schematic diagram of mammalian defensin structure  16  Figure 5:  Schematic diagram of cecropin A structure  20  Figure 6:  Schematic diagram of melittin structure  24  Figure 7:  Schematic representation of the strategy used to anneal the six oligonucleotides that encoded the HNP-1 gene  55  Figure 8:  Construction of pKP19O and pKP 160  56  Figure 9:  Construction of pGEX-KP  75  Figure 10:  Construction of GST/cationic peptide fusion proteins  76  Figure 11:  Production of GST/HNP- 1  77  Figure 12:  Schematic diagram of GST fusion protein affinity purification  79  Figure 13:  Affinity purification of GST/HNP-1  80  Figure 14:  Purification of GST/HNP- 1 inclusion bodies  84  Figure 15:  Factor Xa cleavage of GST/HNP1  86  Figure 16:  Optimal factor Xa cleavage of GST/HNP- 1  87  Figure 17:  Amino acid sequence of GST  89  Figure 18:  Cleavage of denatured/renatured GST by factor Xa  90  Figure 19:  Production and affinity purification of GST/proHNP-1  93  Figure 20:  Production and affinity purification of GST/CEME  95  Figure 21:  Production and purification of soluble and insoluble GST/proCEME  97  Figure 1:  Figure 22:  CNBr release of active CEME from GST/pr0CEME  100  Figure 23:  Construction of protein A/cationic peptide fusion proteins  103  Figure 24:  Production of protein A/cationic peptide fusion proteins  105  VIII  Figure 25:  Bio-Gel P100 chromatography of CNBr-digested PA/CEME  108  Figure 26:  Reverse phase chromatography of CEME  109  Figure 27:  Antibacterial activity of CEME  112  Figure 28:  Killing of P. aerugirtosa H187 by recombinant CEME  116  Figure 29:  Peptide-mediated lysozyme lysis of P. aerugiriosa H309  128  Figure 30:  Peptide-mediated lysozyme lysis of E. cloacae 218R1  129  Figure 31:  Peptide-mediated NPN uptake in P. aeruginosa H309  132  Figure 32:  Peptide-mediated NPN uptake in E. cloacae 218R1  133  Figure 33:  Inhibition of dansyl polymyxin B binding to P. aeruginosa H103 LPS by various compounds  135  Inhibition of dansyl polymyxin B binding to P. aeruginosa H309 whole cells by various compounds  138  Figure 34:  ix  LIST OF TABLES Table I:  Cationic Peptides  12  Table II:  Commonly Used Affinity Tags  31  Table III:  Methods for the Site-Specific Cleavage of Fusion Proteins  33  Table 1V:  Strains  43  Table V:  Plasmids  45  Table VI:  Oligonucleotides  52  Table VII:  Summary of Strains Used to Prevent Proteolytic Degradation of GST/HNP- 1  82  Table VIII:  Percent Yield of CEME from a 601 Fermentor Run  111  Table IX:  MIC Values of Various Antimicrobial Agents  117  Table X:  Effects of Mg 2 and Na Cations on the MICs of Cationic Peptides Against P. aeruginosa H309  122  Effects of Sub-MIC Levels of Cationic Peptides on the MICs of Common Antibiotics  123  Values for Various Compounds Against P. aeruginosa LPS and Whole Cells  137  Table XI: Table XII:  x  LIST OF ABBREVIATIONS  Ap  ampicfflin  AU  acid urea  bp  base pair  CEMA  CEME analogue  CEME  cecropin/melittin hybrid peptide (CA1-8M1-18)  CFU  colony forming unit  Cm  chioramphenicol  CNBr  cyanogen bromide  DEAE  diethylaminoethyl  EDTA  ethylenediamine tetraacetic acid  FPLC  fast protein liquid chromatography  GST  glutathione-S-transferase  HEPES  -2-ethanesulfonic acid) sodium salt t (N-2-hydroxyethylpiperazine-N  HNP  human neutrophil peptide  IGF-I  human insulin-like growth factor I  IgG  immunoglobulin G  IPTG  isopropyl-f3-D-thiogalactoside  Kan  kanamycin  kb  kilobase pair  kDA  kilodalton  KCN  potassium cyanide  LB-S  Luria-Bertani, no salt broth  LBNS  Luria-Bertani, normal salt broth  LPS  lipopolysaccharide  MCP  macrophage cationic peptide  MIC  minimum inhibitory concentration  xi  MTPBS  mouse tonicity phosphate-buffered saline  NMR  nuclear magnetic resonance  NPN  1 -N-phenylnaphthylamine  OD  optical density  0-POE  octyl-polyoxyethylene  PA  truncated S. aureus protein A  PAGE  polyacrylamide gel electrophoresis  PCR  polymerase chain reaction  PEG  polyethylene glycol  PMBN  polymyxin B nonapeptide  PMSF  phenylmethylsulfonyl fluoride  RP  reverse phase  rpm  revolutions per minute  SDS  sodium dodecyl sulfate  Tet  tetracycline  TFA  trifluoroacetic acid  TLCK  Na-p-tosyl-L-lysine chloromethyl ketone  TPCK  N-tosyl-L-phenylalanine chloromethyl ketone  TSS  transformation and storage solution  TST  50 mM Tris-HC1 pH 7.6, 150 mM NaC1, 0.05% Tween 20  UV  ultra violet  WCLB  whole cell lysing buffer  Z  synthetic IgG binding domain  XII  ACKNOWLEDGMENTS  The financial support of the Medical Research Council of Canada is gratefully acknowledged. I would like to thank Dr. Bob Hancock for his enthusiastic guidance throughout this work. I would also like to thank all the members of his lab over the duration of my stay for providing a more than pleasant working environment. Specifically, I would like to say a special thank you to the following people: -  the 233 gang (Eileen, Rebecca and Anand) for all the laughs and the stimulating discussions (some of them even about science!)  -  -  Nancy, Susan and Manjeet for all their help my fellow hockey poolers, especially the “core” members Terry, Loverne and Mo: thanks for the money!  -  Doug Kilburn for the “timely suggestion” and George Spiegelman for critically reading this thesis  Finally, I would like to thank my parents, Ed and Shirley, who always encouraged me in my studies and provided me with the opportunities to pursue them.  XIII  DEDICATION  Throughout the duration of these studies, my wife, Gloria, has been the one person to share every up and down.  Whether I needed a shoulder for  sympathy, an ear for my frustrations or a smile of encouragement, she always had them just at the right time. This thesis, therefore, is not only a reflection of my work, it is a testimony to the love, patience and dedication that she has shown to me over these last years.  Gloria, it is to you that I dedicate this  thesis.  xiv  INTRODUCTION  A.  Pseudomonas aeruginosa..  1.  Clinical Considerations.  Pseudomonas aeruginosa is a Gram-negative, rod-shaped organism that  can grow with limited minerals on a large number of carbon and energy sources. These minimal growth requirements enable P. aerugirtosa to exist in very diverse environments, including soil, standing water and sediments.  It  also has other properties such as slime layers and adhesins that make it difficult to remove from colonized sites by mechanical means. P. aerugirtosa is not usually a pathogen for healthy human beings, since it is unable to penetrate the host’s first defense barrier, namely the skin and mucosa. However if that physical barrier is compromised and host defenses are weak, P. aeruginosa becomes prevalent in human infections of bums, eye injuries, and sites of major surgery and medical interventions involving instruments such as catheters or shunts.  Another occurrence of P. aeruginosa infections is in  patients whose non specific defense or immune systems are under duress, such as premature infants, patients with cystic fibrosis or neoplasia, and patients who are undergoing immunosuppressive drug treatment or whole body irradiation treatment.  P. aeruginosa can therefore be categorized as a  nosocomial opportunistic human pathogen. Many different toxins which are produced by P. aeruginosa have been described (Doring et al., 1987) and it has been suggested that these may all contribute variably in different P. aeruginosa infections (Nicas and Iglewski, 1985). Given this multifactorial virulence, it is not suprising that P. aerugiriosa is able to cause a wide variety of different medical problems such as  1  bacteremia, urinary tract infections, endocarditis and gastrointestinal infections (Pollack, 1990). The clinical significance of this pathogen has been increasing steadily. During the period between 1975 and 1984, the relative frequency of P. cterugiriosa in nosocomial infections (expressed as a percentage of all isolates) increased from 6.3% to 11.4%, making it second only to E. coil as the most frequently acquired hospital pathogen. Not only is the increase in P. aeruglnosa infections a cause for concern, but also the fact that these infections are associated with a high mortality rate (Young, 1984; Hancock and Bell, 1989). The increase in the incidence of P. aeruginosa infections is largely a testimony of its resistance to many forms of antimicrobial therapy (Bryan, 1979). Antibiotics that have been used to treat P. aeruginosa in the past, such as streptomycin, carbenicihin, tetracycline, chloramphenicol and trimethoprim, have become ineffective due to the emergence of resistant strains (Bryan, 1979). One of the characteristics of P. aeruginosa that confers such intrinsic resistance is the low permeability of its outer membrane (Angus et al., 1982). Although the outer membrane of P. aeruginosa is not remarkably different to those of other Gram-negative organisms, its permeability has been estimated to be twelve-fold (Nicas and Hancock, 1983b) to 100-fold (Yoshimura and Nikaido, 1982) lower than that of the E. coil outer membrane.  2.  Outer Membrane Structure.  The envelope of P. aeruginosa is made up of three distinct components: the cytoplasmic or inner membrane, the periplasmic space and the outer membrane. The cytoplasmic membrane is a phospholipid bilayer membrane that is studded with as many as one hundred different proteins (Cronan et al.,  2  1987). The periplasm can be dissected into inner and outer periplasmic spaces. The former is relatively un-crosslinked and therefore appears as a gelatinus structure (Hobot et al., 1984). The latter, conversely, is highly crosslinked and plays a large role in the structural integrity of the cell (Oliver, 1987). It contains peptidoglycan (murein) which is a macromolecular combination of polysaccharides and peptide (Park, 1987). In addition to these components, the periplasm is filled with an array of proteins that carry out binding, scavenging and detoxifying functions (Oliver, 1987). The outer membrane of P. aeruginosa, unlike the uniform cytoplasmic membrane, is an asymmetric lipid bilayer (Figure 1). The inner leaflet consists of the chloroform-methanol extractable phospholipids that include phosphatidylethanolamine, phosphatidylglycerol, diphosphatidyiglycerol (cardiolipin), and some other unknown phospholipids (Nikaido and Hancock, 1986).  In all cases, these phospholipids possess two fatty acid chains that  extend from the polar head group. Interspersed among the phospholipids are lipoproteins such as OprL and OprI. The latter, which is the Pseudornonas equivalent of the E. coli Braun Lipoprotein (Mizuno, 1979), is covalently attached to the peptidoglycan (Mizuno and Kageyama, 1979) thus providing an “anchor” for the outer membrane. In addition to these lipoproteins, there are many other different outer membrane proteins in P. aeruginosa (for reviews, see Nikaido and Hancock, 1986; Hancock et al., 1990). The component of the Gram-negative outer membrane that distinguishes it from the cytoplasmic membrane is the lipopolysaccharide (LPS), which is found only in the outer leaflet (Smit et al., 1975). It is an amphipathic molecule consisting of three domains:  a) the hydrophific 0-antigen side chain that  extends outward from the cell, b) a core polysaccharide region consisting of various conserved components, and c) the hydrophobic lipid A tail which  3  Figure 1: Schematic representation of the outer membrane and peptidoglycan of P. aerugiriosa.  4  anchors the molecule into the membrane.  Lipid A consists of a 4-  phosphoglucosaminyl- (1-6) -glucosamine- 1-phosphate backbone (Wilkinson, 1983) to which four to six saturated fatty acids are either ester or amide linked (Karunaratne et al., 1992). These linkages can be either directly on the sugar backbone, or through the hydroxyl groups of other fatty acid chains (Kropinski et at, 1985). include  The fatty acid composition of the lipid A has been found to  3-hydroxydodecanoic  acid,  2-hydroxydodecanoic  acid,  3-  hydroxydecanoic acid, and decanoic acid (Kropinski et al., 1985) as well as minor amounts of others (Pier et at, 1981). The core region of LPS consists of D-glucose, D-galactosamine, L-rhaninose, L-glycero-D- mannoheptose and 2keto-3-deoxyoctulosonic acid (KDO) (Rowe and Meadow, 1983; Wilkinson, 1983; Kropinski et at, 1985).  Besides these saccharide components, the core also  contains L-alanine, ethanolamine and phosphate (Rowe and Meadow, 1983; Wilkinson, 1983). Although the core constituents remain the same in different P. aerugirtosa strains, variations in sugar ratios, sugar arrangement and  phosphate composition have been found (Kropinski et at, 1985; Rivera et al., 1988a). The 0-antigen side chain, conversely, varies greatly between strains. This highly immunogenic component of LPS is composed of unbranched tn- or tetra-saccharide repeat units (Kropinski et al., 1985) which are rich in N acetylated sugars and whose repeat number varies from strain to strain. The 0-antigen side chain structures of all P. aeruginosa serotypes have now been elucidated (Yu et al., 1988). Another key feature of the outer membrane is the interaction between LPS molecules.  The presence of negatively charged groups on or near the  disaccharide backbone of LPS, combined with the juxtaposition of the LPS molecules in the outer membrane, suggest that a strong electrostatic repulsion would exist thus causing a destabilization of the membrane (Nikaido and Vaara,  5  1985).  It has been found that neighboring LPS molecules are stabilized by  divalent cation bridges (Schindler and Osbom, 1979). The importance of these cations, such as Mg 2 and Ca , is shown by treating intact cells with the 2 divalent cation chelator ethylenediaminetetraacetate (EDTA) which disrupts the cells and results in the loss of LPS molecules (Leive, 1965). The combination of LPS and divalent cations results in a stable hydrophilic barrier that is virtually impermeable to many hydrophobic molecules (see below).  In addition to  divalent cations there are protein-LPS interactions that are also crucial to maintaining outer membrane integrity. An example is P. aerugthosa protein Hi which is induced in low Mg 2 conditions and results in increased resistance to polymyxin B, gentamicin, and EDTA (Nicas and Hancock, 1980). It has been hypothesized that since OprH has a putative p1 of 8.6 and therefore is positively charged at physiological pH, it will interact with the negatively charged LPS in limiting divalent cation conditions (Bell et al., 1991), resulting in a stable outer membrane.  3.  Outer Membrane Permeability and Antibiotic Uptake.  The outer membrane of P. aeruginosa has been shown to contribute significantly to the intrinsic resistance of this organism to antibiotics by forming an effective permeability barrier. In addition to antibiotics, this barrier restricts the access of many hydrophobic and large hydrophiic compounds (for reviews, see Nikaido and Vaara, 1985; Nikaido and Hancock, 1986). There is a group of compounds able to disrupt the organization of the outer membrane and allow the uptake of normally impenetrable molecules.  This group is collectively  known. as outer membrane permeabifizers.  6  The antibiotic polymyxin B is one of the most well studied permeabilizers.  Its structure consists of a polycationic decapeptide ‘head’  region (in which seven of the amino acids form a cyclic structure) and a fatty acyl tail. The fatty acyl tail has been implicated in the association with, and subsequent lysis of, the cytoplasmic membrane (Teuber and Bader, 1976), since polymyxin B nonapeptide (PMBN), a polymyxin B derivative that lacks this fatty acyl chain, shows very weak killing activity (Vaara and Vaara, 1983).  Both  polymyxin B and PMBN exhibit potent membrane permeabiizing activity on the outer membranes of enteric bacteria as evidenced by their enhancement of hydrophobic antibiotic uptake (Vaara and Vaara, 1983). Polymyxin B was also shown to permeabilize the outer membrane of P. aeruginosa to the protein lysozyme, the hydrophobic fluorescent probe 1-N-phenylnaphthylamine (NPN) and the chromogenic -1actam nitrocefin (Hancock and Wong, 1984).  This  permeabiization could be antagonized by the addition of Mg , indicating that 2 polymyxin B must initially associate with the negatively charged sites on the LPS molecules that are normally occupied by Mg . Evidence supporting this 2 association came from the observation that dansylated polymyxin B had a strong (0.4 riM) affinity for purified LPS and that Mg 2 could competitively displace the dansyl polymyxin from the LPS (Moore et al., 1986). Studies with bacteria that are resistant or sensitive to polymyxin B or other polycations seem to corroborate the theory that polycationic compounds  initially interact with the negatively charged sites on LPS. A P. aeruglnosa tolA mutant that was susceptible to aminoglycosides was shown to have altered LPS that resulted in an increased affinity for polymyxin B (Rivera et al., 1988b). Conversely, poiymyxin resistant (pmr) mutants of S. typhimurium (Makelä et al., 1978) and E. coil (Meyers et al., 1974) have been isolated and shown to have increased esterification of their LPS molecules (Vaara et al., 1981; Peterson et  7  at, 1987). The esterification results in a less acidic LPS and consequently in a decreased binding affinity for polymyxin B and other cationic compounds. Antibiotics are taken up through a number of different pathways. Many 13-lactams are believed to cross the outer membrane by diffusing through the small water filled channels of porin proteins (Zimmermann and Rosselet, 1977). Much of the evidence supporting this hypothesis comes from the fact that some 3-1actam MIC values for porin-deficient mutants are much higher than their isogenic wild type strains (Hancock and Bell, 1989). Some of these mutants, however,  still  demonstrate residual uptake of antibiotics  such  as  chioramphenicol and tetracycline, suggesting that there may be other alternative pathways (Hancock and Bell, 1989). In some cases, porins involved in substrate-specific uptake may become an uptake pathway for an antibiotic that mimics the structure of the substrate.  For example, the 13-lactam  imipenem is taken up through the basic amino acid-specific channel OprD in P.  aerugirtosa (Trias and Nikaido, 1990a; Trias and Nikaido, 1990b). A second pathway, the partitioning of hydrophobic antibiotics into the outer membrane, is virtually non existent in wild type P. aeruginosa, as indicated by high MIC values for these hydrophobic antibiotics (Nikaido and Hancock, 1986) and the inability of NPN to penetrate the outer membrane (Loh et al., 1984). The uptake of these compounds can occur in deep rough mutants (Hancock and Bell, 1989) or be enhanced by membrane-disrupting compounds such as EDTA (Loh et at, 1984), suggesting that the stabifized LPS interactions on the surface of the outer membrane, serve as a barrier to this group of antibiotics.  8  4.  Self-Promoted Uptake of Antibiotics.  Mutant P. aeruginosa cells that overproduce the Hi protein (OprH) and cells grown in limited Mg 2 conditions (which induce OprH production) were found to be resistant to polymyxin B and gentamicin (Nicas and Hancock, 1980) but had no change in the susceptibility of to other antibiotics such as f3-lactams and tetracyclines (Nicas and Hancock, i983a).  From these data it was  hypothesized that OprH blocked an uptake pathway that was utilized by cationic compounds.  Given the membrane permeabilizing activities (Hancock  and Wong, 1984) and LPS binding capabilities (Moore et al., 1986) of these cationic compounds, a third antibiotic uptake pathway, called self-promoted uptake, was proposed (Figure 2; Hancock et al., 1981). This pathway involves 2 ions from the LPS crossthree steps: (1) the initial displacement of the Mg bridges by the cationic antibiotic (Figure 2B); (2) the subsequent disruption of the outer membrane structure which can permeabiize it to other, normally excluded compounds (Figure 2C); and (3) the eventual uptake of the compound itself into the periplasmic space (Figure 2D). The nature of the final uptake process is not well understood, but its efficacy is undoubtedly related to both the structure of the disrupted membrane and the conformation of the compound once it has bound to the LPS. Recently, Sawyer et al. (1988) were able to show that the interactions of antimicrobial rabbit macrophage defensins (see below) with the outer membrane of P. aeruginosa were consistent with the self-promoted uptake hypothesis (discussed below).  9  B  A  •Mg.  C  Nitrocefin -  D  NPN  Figure 2: Schematic diagram of the self-promoted uptake model. 2 A, Typical Gram-negative bacterial outer membrane with a Mg crossbridge (outer membrane proteins are omitted for simplicity); B, 2 by a cationic antibiotic (polymyxin B, Px, is used as an Displacement of Mg example) and the initial perturbations of the lipid bilayer; C, Further disruption of the outer membrane resulting in the uptake of normally excluded compounds; D, Uptake of the antibiotic across the outer membrane.  10  B.  Cationic Peptides.  1.  Introduction.  Antibiotics produced by microorganisms have long been used to fight many infectious diseases. Within the past several decades, however, a new breed of antimicrobial agents, termed “peptide antibiotics”, has been discovered. Zeya and Spitznagel (1966) were the first to describe such peptides in mammalian polymorphonuclear leukocytes and noted that they tended to be cationic in nature. Since then, further investigation has led to the discovery of many different peptides from a wide range of organisms (examples in Table I). Considering the location of some of these peptides in the organisms, it is not certain that their primary role is host defense. Nonetheless, they all show a broad range of antimicrobial activity and therefore are potentially useful in antibiotic therapy.  2.  Defensins.  The term “defensins” was originally used to describe a family of antimicrobial and cytotoxic peptides from mammalian neutrophils that ranged from 29-35 amino acids in length (for reviews, see Ganz et al., 1990; Lehrer et aL, 1990; Lehrer et at, 1993). They are invariably cationic, containing between four and ten arginine residues, and include six conserved cysteine residues that form three disulfide bonds (Figure 3). The first, N-terminal cysteine forms a disulfide bond with the last, C-terminal cysteine, resulting in an effectively cyclic peptide (Seisted and Harwig, 1989). Defensins constitute 5-7% of the total cellular protein in neutrophils and 30-50% of the total protein in the neutrophil’s primary granules (Rice et at, 1987). They are actually synthesized  11  r\)  Casteels, et at, 1989  Undetermined he1 he1 13-sheet f3-sheet 13-sheet  13-sheet he 13-sheet  18 23 26 29-30 3334 31 29-32 46 31 35 3537  Apis me11fera gut  Xenopus laevis skin Apis me11fera venom  Human Rabbit Guinea Pig Rat Equine Pig small intestine Mouse Paneth cells  Hyalophora cecropia  Apidaecins  Magainins  Melittin  Defensins  Cecropin P1  Cryptdin  Cecropins  a-helix  13-sheet  Seisted, et at, 1992  Undetermined  13  Bovine neutrophils  Indolicidin  Steiner, et al., 1981 con’t...  Eisenhauer, et at, 1992  Lee, et at, 1989  Couto, et at, 1992  Eisenhauer, et al., 1989  Seisted and Harwig, 1987  Seisted, et at, 1984  GaflZ, et al., 1985  Habermann and Jentsch, 1967  Zasloff, 1987  Reference  Structureb  Sizea  Origin  Peptide  Table I: Cationic Peptides.  C,)  37 38-42  39 40  Scorpion venom Bovine neutrophils  Sarcophaga peregrina Phonnia terrartovae Sarcophaga peregrirta  Charybdotoxin  Sarcotoxins  Phormicins  Sapecin  Seminalpiasmin  Matsuyama and Natori, 1988 Theil and Scheit, 1983 Frank, et al., 1990 Dimarcq, et al., 1988 Casteels, et al., 1993 Huitmark, et al., 1983  Mixed a-helix Undetermined Undetermined Undetermined Undetermined  40 48 42 82 93 187-188  Bovine semen Bovine neutrophils  Phorniia terranovae Apis mellfera gut  Hyalophora cecropia  Bactenecins  Diptericin  Hymenoptaecin  Attacins  a, number of amino acid residues b, predominant secondary structure found in the peptide  Lambert, et al., 1989  Mixed  Selsted, et al., 1993  Miller, et aL, 1985  Reference  Okada and Natori, 1983  Undetermined  p-sheet  Structureb  a-helix  13-defensins  Sizea  Origin  Peptide  Table I: Cationic Peptides (cont).  HNP- 1  Ii  I  II  ACYCRIPACIAGRRYGTCIYQGRLWAFCC  Cecropin A KWKLFKKIEKVGQNIRjGIIKAGPAVAVVGQATQ1AK Melittin GIGAVLKVLTTGLPALISWIKRKRQQ CEME KWKLFKKIGIGAVLKVLTPGLPALIS CEMA KWKLFKKIGIGAVLKVL’ITGLPALKLTK defensin pre pro region pre:  MRTLAILAAILLVALQAQA  pro:  Figure 3: Amino acid sequences of selected cationic peptides. Designations include: HNP-1, human neutrophil peptide 1; CEME, cecropin/melittin hybrid (CA(1-8)M(1-18)); CEMA, a frameshift analogue of CEME. Positively charged amino, acids are in bold and negatively charged amino acids are underlined. The disuffide bond array for mammalian defensins is demonstrated for HNP- 1.  14  as 94-95 amino acid prepropeptides. The negatively charged residues in the pro region (Figure 3) virtually balance the positively charged residues in the defensin sequence, which led to speculation that the pro region was necessary for host protection prior to processing and packaging of the mature defensin into the granules (Michailson et at, 1992). From the granules, the peptides are released into the microbe-containing phagosome through degranulation where they exert their microbiocidal activity. The importance of defensins to the host defense system is evidenced by the high infection rate that occurs in patients whose granular components are defective or missing (Ganz et at, 1988). Defensins  show a broad range of antimicrobial activity.  At  concentrations of 10-100 jig/mL, they are able to kill Gram-negative and Grampositive bacteria, although the are generally more active against the latter (Lehrer et al., 1993).  For Gram-negative bacteria, rough strains are more  sensitive to defensin activity than their isogenic smooth strains (Ganz et al., 1990).  In addition to bacteria, various defensins have been shown to kill  Candida albicans (Selsted et al., 1985), Treponema paUidum (Borenstein et al., 1991), and some enveloped viruses such as herpes simplex virus (Lehrer et al., 1985). The first information concerning the 3-dimensional structure of defensins came with the elucidation of the solution structure of rabbit neutrophil defensin NP-S (Pardi et at, 1988). The basic structural backbone of the defensin molecule was a triple-stranded antiparallel 13-sheet (Figure 4A),  with the charged amino acids at one end of the molecule and the hydrophobic ones at the other end.  This basic structure was confirmed by the crystal  structure of HNP-3 (Hill et al., 1991) which showed the human defensin as an elongated ellipsoid. The HNP-3 crystallized as a basket-shaped dimer (Figure 4B) which, due to the monomer’s amphipathicity, had an apolar base and a  15  A  0  B  Figure 4: Model of the mammalian defensin structure. A, The triple-stranded anti-parallel 13-sheet structure of an HNP-3 monomer. The disuffide bonds are represented by lightening bolts. B, An HNP 3 dimer with a poiar top and an apolar bottom. Both figures were reproduced by copyright permission from Hifi, et al. (1991) © American Association for the Advancement of Science.  16  polar top. The invariant Gly’ 8 in the defensin amino acid sequence was found at the dimer interface, suggesting that dimerization is required for activity. This is further supported by the fact that upon dimerization, a water-filled channel is formed. These observations led to the speculation that HNP-3 monomers wedge their hydrophobic base into lipid membranes, and eventually form dimer-pores or multimer-pores (Hill et al., 1991). This is consistent with the data from Kagan et al. (1990) who showed that rabbit defensins can form voltage dependent ion-permeable channels in planar lipid bilayers. These structural data, however, do not provide any information on how these peptides cross the asymmetric outer membrane in Gram-negative bacteria. Sawyer et al. (1988) showed that rabbit MCP-i and MCP-2 (equivalent to NP-i and NP-2) were able to bind to and permeabilize the outer membrane of P. aemginosa and that these defensins could bind purified LPS. These data  resulted in the proposal that defensins are taken up across the outer membrane by the self-promoted uptake pathway.  Human defensins were also shown,  albeit only at bactericidal or bacteriostatic concentrations, to perrneabiize the outer membrane of various Gram-negative bacteria to rifampicin and Triton X 100 (Viljanen et al., 1988).  A detailed examination of HNP-i-mediated  bactericidal activity against E. coU revealed that the defensin caused sequential permeabiization of the outer and inner membranes, and that it was likely that the latter event that resulted in cell death (Lehrer et al., 1989). This study also showed that HNP- 1 was a relatively poor permeabiizer of the outer membrane since it required up to 50 jig/mL for 20 mm  before outer membrane  permeabiization was detected. Another group of defensins was isolated from a number of different insects such as Phormia terranovae (Lambert et al., 1989), Sarcophaga peregrina (Matsuyama and Natori, 1988), and others (for a review, see  17  Hoffmann and Hetru, 1990)(Table I). These peptides were initially called insect defensins since they were small, cationic and contained six cysteine residues. Upon further investigation, however, the positions of these cysteine residues in the amino acid sequence, and even the disulfide array were different from those of mammalian defensins (Seisted and Harwig, 1989; Lepage et al., 1991). The insect defensins are also slightly longer (38-43 residues) and less cationic (p1 8.0-8.5)(Hoffmann and Hetru, 1990) than their mammalian counterparts. The biggest differences between these two groups of peptides are in their 3dimensional structures. While the mammalian defensins are dominated by [3sheet structures (Hifi et al., 1991), the insect defensins have a loop, x-helix, and 13-sheet structures (Hoffmann and Hetru, 1990).  Therefore, while these two  groups share similarities in name, size, charge and antibacterial activity, they cannot be considered structural homologues.  3.  Cecropins.  Along with defensins, insects produce another family of cationic antimicrobial peptides in response to a bacterial challenge.  This group is  collectively called cecropins, after the moth Hyalophora cecropia in which they were first discovered (Hultmark et al., 1980). Cecropin-like peptides have now been found in many different insects (for reviews, see Boman and Hultmark, 1987; Boman et at, 1991; Huitmark, 1993), as well as in mammalian cells (Lee et al., 1989)(Table I). The peptides are 35-39 amino acids in length and have net positive charges that range from +3 to +8. Unlike the defensins, they do not contain cysteine residues (Figure 3) and therefore adopt a completely different tertiary structure (see below). A number of residues are conserved throughout , 23 , Gly 22 , Gly’ 9 , Arg’ 2 , Ala 6 , Phe 2 , Glu 6 , Lys 5 the cecropin family, including Trp  18  , Ala 24 Pro , and Ala 25 . The role of these residues remains unclear; however, 32 they may be involved in inter-protein contacts in oligomeric structures (Durell et at, 1992). The necessity of Trp 2 was demonstrated since upon its deletion, the lytic activity of the peptide decreased dramatically (Steiner et at, 1988). In response to an infection, H. cecropia produces three major cecropins, A and B (Huitmark et al., 1980) and D (Huitmark et aL, 1982). The genes for these peptides have been cloned and sequenced (Xanthopoulos et al., 1988; Gudmundsson et at, 1991) revealing that, like defensins, they were produced as prepropeptides.  The amino acid sequence was analyzed for potential  secondary structures which led Steiner (1982) to propose that the peptide consisted of two a—helices joined by a hinge region (Figure 5A). This was later confirmed by the two-dimensional NMR structure determination of cecropin A (Holak et al., 1988). The strongly basic N-terminal a-helix is almost perfectly amphipathic, while the more hydrophobic C-terminal a-helix is less so. These  two regions are joined by the flexible hinge region encoded by Ala-Gly-Pro-Ala, which is conserved in most cecropins.  The design of cecropin-like model  peptides and cecropin analogs demonstrated that all three structural features were required for full antibacterial activity (Steiner et al., 1988; Fink et al., 1989). Cecropins have a broad spectrum of antibacterial activity against Grampositive and Gram-negative bacteria as determined by zone inhibition assays (Boman et al., 1991). Cecropins A and B have a much broader range of activity than cecropin D which may reflect the high positive charge densities of their Nterminal a-helices as compared to cecropin D. None of the cecropins are able to lyse eukaryotic cells (Steiner et al., 1981; Wade et al., 1990) in contrast to defensins, which possess potent cytotoxic activity (Lehrer et at, 1993). Like the defensins, however, cecropins were able to form voltage dependent ion channels  19  A  KWKLFKKIEKVGQNIRDGjIKAGpAyyvGQATQIAK  cecA 1-37  B N-terminal helices  Figure 5: Model of the structure of cecropin A. A, Cecropin A primary and secondary structures showing its helix-hingehelix nature. The charged residues are shown to indicate the arnphipathic nature of the N-terminal a-helix. Reproduced by copyright permission from Steiner, et al. (1988). B, Antiparallel dimer of cecropin A in a membrane bilayer. The N-terminal a-helices are embedded into the lipid head-group layer and the C-terminal a-hellces traverse the hydrophobic phase of the membrane. Selected residues are highlighted. Reproduced by copyright permission from Durell, et al. (1992) © Biophysical Society.  20  A 2 CQNH  B  ‘U Figure 6: Model of the structure of melittin. A, Monomeric, membrane-bound melittin showing the helix-hinge-helix structure and the C-terminal random coil motif. Circles denote positively charged amino acids. B, Tetrameric melittin associated with a lipid membrane. The shaded spheres represent the non-helical C-terminal residues, and the cylinders represent the x-helices with the hydrophobic sides (white) facing the membrane and the hydrophilic sides (shaded) facing each other, thus forming a channel. Both figures were reproduced by copyright permission from Vogel and Jahnig (1986) © Biophysical Society.  24  in planar lipid membranes (Christensen et aL, 1988). By studying a number of synthetic analogs, these researchers were able to determine that the flexible hinge region separating the two amphipathic x-helices was required for poreforming activity. The observed correlation between the peptides’ bactericidal and pore-forming activities led to the conclusion that the lethal effect of cecropins on bacterial cells was the formation of large pores in the cytoplasmic membrane which led to cell lysis (Christensen et al., 1988).  Although ion  channel formation has not been demonstrated for the porcine cecropin P1, it was shown to kill E. coil bacteria by cell lysis (Boman et al., 1993) which suggests that all cecropins have a similar mechanism of activity. Lipid bilayers which had either a positive surface charge or included cholesterol were highly resistant to the pore-forming action of cecropins.  The latter result was  consistent with the insensitivity of eukaryotic cells to lysis by cecropins, and the former suggested that the positively charged cecropins required a negatively charged membrane to initiate bactericidal activity.  Although required, this  binding was not sufficient for killing, since bacteria that were resistant to cecropin activity, were still found to bind large amounts of the peptide (Steiner etal., 1988). The observations on cecropin binding and lysis led to the formulation of a three step mechanism of cecropin activity on lipid membranes (Christensen et a!., 1988).  The first step involved the electrostatic adsorption of cecropin  oligomers to the negatively charged surface of the membrane. In the second step, the hydrophobic C-terminal os-helix would insert into the membrane while the amphipathic N-terminal x-helix would remain at its interfacial position. This step could only occur with peptides that possessed the flexible hinge between the two helices. Finally, an applied voltage (positive to negative going into the membrane) would drive the N-terminal ce-helix into the membrane, with  21  its hydrophilic residues forming a water-filled channel.  This model was  expanded by Durell et al. (1992) who, using atomic-scale computer models, proposed that cecropins form antiparallel dimers whose C-terminal x-helices can span the membrane (Figure 5B). These dimers would then aggregate into a hexagonal geometry (based on pore dimensions from Christensen et aT., 1988), resulting in a small ion channel formed by six adjacent C-terminal a-helices. This “type I” channel would further undergo a conformational change in which the hydrophilic residues of the N-terminal cx-helices would move from the membrane surface to the pore lining, creating a larger (“type II”) channel. Although these proposals may accurately describe the mechanism of cecropin action on the cytoplasmic membrane, they cannot be applied to the more complex, asymmetric outer membrane of Gram-negative bacteria.  It is  interesting to note that despite their high potency against Gram-negative bacteria, the effects of cecropins on outer membranes have never been studied directly.  4.  Melittin.  The venom of the honey bee Apis me11fera contains, as its major protein component, a 26 amino acid peptide that is highly cationic (Figure 3; Habermann and Jentsch, 1967) and possesses strong antibacterial and potent hemolyuc activities (for a review, see Dempsey, 1990). Many investigators have studied the structure/function relationship of melittin, particularly with respect to its interaction with membranes. This has resulted in some conflicting ideas on how this peptide antibiotic exerts its mechanism of activity. Melittin adopts different structures depending on its environment. In water, or in other low ionic strength environments, it exists as a monomer that  22  has no detectable secondary structure.  In higher ionic strength buffers, or  other environments that promote self association, the peptide forms a tetramer consisting of monomeric subunits that are predominantly in a helical conformation (Dempsey, 1990). Residues 1-21 of melittin form a hydrophobic a-helix that is bent in the middle at a glycine residue (Figure 6A).  The C-  terminal portion of the peptide is very hydrophilic and is not believed to form an a-helix. This structure differs from the a-helical peptide cecropin A in a few ways.  First the polarity of the peptides is reversed, with the N-terminus of  cecropin A and the C-terminus of melittin being hydrophilic, while the Cterminus of cecropin A and N-terminus of melittin are hydrophobic. Secondly, the bend in the peptides is found in a different position. In melittin, the bend is in the middle of the N-terminal hydrophobic a-helix, while in the cecropins, it separates the hydrophilic and hydrophobic a-helical segments.  These  differences have ramifications for hybrid peptides created from melittin and cecropin A (see below). The amphipathicity of the N-terminal a-helix of melitthi suggests that the monomers must aggregate when interacting with lipid membranes. Figure 6B shows a schematic model of tetrameric melittin in a membrane.  The  hydrophilic faces of the four a-helices face the inside of the tetramer and probably form a pore (see below).  Although the antibacterial properties of  melittin have been documented (Boman et al., 1989a), it is the hemolytic activity that continues to be the focus of intense research. Melittin has been shown to cause cell lysis at concentrations of greater than 1 ig/mL (DeGrado et al., 1982; Hider et al., 1983).  It is also able to form voltage-dependent ion  permeable channels in lipid bilayers (Tosteson and Tosteson, 1981).  The  conductance of these channels was shown to change with the fourth power of melittin concentration indicating that tetrameric association of the monomers  23  forms the channel (Tosteson and Tosteson, 1981). This conclusion seemed to be inconsistent with the observation that melittin could form multi-state pores, indicating that there was heterogeneity in the pore structures (Hanke et aL, 1983). This is in contrast to the cecropins which showed discreet channel sizes (Christensen et al., 1988). The structure of melittin has been examined to determine what features are responsible for its channel-forming and hemolytic activities. Blondelle and Houghten (1991) created a series of 24 individual omission analogues of melittin to determine which residues were necessary for hemolytic activity. Their results showed that the deletion of any residue in the hydrophobic a-helix resulted in a marked decrease in the hemolytic activity, while the omission of any C-terminal residues had no effect. This was in contrast to Werkmeister et al. (1993) who found that either the incubation of melittin with a C-terminal specific monoclonal antibody or the deletion of one of the two Lys-Arg motifs in the C-terminus significantly reduced the hemolytic activity of the peptide. This suggested that the C-terminus was necessary for hemolysis, and that the deletion of one residue from that sequence (Blondelle and Houghten, 1991) was not sufficient to reduce that activity. This was supported by the fact that a melittin analogue that was missing the last four amino acids (and therefore one Lys-Arg motif) had a 30% weaker affinity for phospholipid membranes and a much lower lytic activity compared to native melittin (Otoda et al., 1992). Interestingly, this shortened melittin analogue could still form voltagedependent ion channels in lipid bilayers (Otoda et al., 1992). This indicated that membrane binding and cell lysis were not directly related to ion channel formation. Therefore, one can only conclude that the actions of meittin on lipid membranes are varied and complex. At low concentrations, melittin will form heterogeneously sized ion channels, probably consisting of melittin aggregates  25  that do not significantly perturb the membrane, while at higher concentrations, it will cause cell lysis. Other activities of melittin have been studied and recently reviewed (Dempsey, 1990; Fletcher and Jiang, 1993). Again, since the focus of melittin research has been its interaction with phospholipid membranes, virtually no research on the peptide’s interaction with the outer membrane has been done. One study, however, showed that melittin bound strongly to purified Salmonella typhimurium LPS (David et at, 1992), suggesting that melittin may be taken up by the self-promoted uptake pathway since the first step in this pathway is the binding of the compound to LPS.  5.  Synthetic and Hybrid Peptides.  The discovery of cationic peptides and their potent antimicrobial activities has led to attempts to improve this activity. Most of this research has focused on the a-helical peptides since their structural features are relatively simple (compared to those of defensins) and their basic functional domains have been identified (see above). Early studies in the field of synthetic and hybrid peptides focused on the creation of peptides that were predicted to have amphipathic a-helix structure. Lee et al. (1989) synthesized a number of peptides that contained varying numbers of repeated tn-, tetra-, or pentapeptide fragments that would give rise to an a-helical structure. They tested these peptides for activity against six organisms and found a direct correlation between the peptide’s ability to form a stable, amphipathic a-helix and its antibacterial activity against Gram-positive bacteria. (It is interesting to note that these synthetic peptides were inactive against Gram-negative bacteria, suggesting that cationicity and cc-helicity are  26  not sufficient to cross the outer membrane). The peptide that possessed the highest bactericidal activity 3 -NHCH also had the (Ac-(Leu-Ala-Arg-Leu) ) highest a-helix content in a lipid environment (Lee et al., 1989). This peptide was also the best facilitator at forming ion channels in lipid membranes at bactericidal concentrations (Anzai et al., 1991).  The conductance of these  channels ranged from 2-750 pS which indicated a heterogeneity in the conformation or assembly of the channels, as was demonstrated for melittin (Hanke et al., 1983). The requirement for amphipathic and a-helical structure was supported by Blondelle and Houghten (1992) who showed that both these features were necessary for bacterial cell lysis. In addition to creating new peptides, analogues of some naturally occurring peptides have been synthesized in an attempt to augment their activity. One example is the magainins, a small group of peptides from the skin of the African frog Xenopus laevts (Table I), which are 23 amino acids in length and possess broad spectrum antimicrobial activity (Zasloff, 1987). Synthetic magainin analogues with enhanced a-helical structure were shown to have a 50-fold increase in their antimicrobial activity (Chen et al., 1988). The addition of groups of ten or more arginine or lysine residues to the N- or C-terminal ends of magainin-2 resulted in MIC reductions of 5- to 10-fold (Bessalle et al., 1992). The peptide with positive chain extension at the C-terminal end had no increase in hemolytic activity. This was in contrast to melittin whose positively charged C-terminus was shown to be necessary for hemolytic activity (Otoda et al., 1992; Werkmeister et al., 1993). As described above, two other naturally occurring peptides, cecropin A  and melittin, have been altered to enhance their activity. In addition to changes in the parent peptides, much work has gone into hybrid peptides that contain sequences from both cecropin A and melittin. Boman et al. (1989a) described  27  the first hybrid peptides which were the same size as melittin, and contained different combinations of the hydrophobic and hydrophiic regions of cecropin A  and melittin. In this process, they synthesized a peptide consisting of the first 13 amino acids of cecropin A followed by the first 13 amino acids of melittin (CA(1-13)M(1-13)). This peptide was 100-fold more active against S. aureus than cecropin A and had antimalarial activity that was 10-fold better than cecropin B (Boman et al., 1989a). Unlike melittin, however, this cecropin-like peptide possessed no hemolytic activity.  The two-dimensional structure of  CA(1-13)M(1-13) revealed that it still consisted of a helix-hinge-helix structure, but that the hydrophobic C-terminal a-helix came from the N-terminal sequence of melittin (Sipos et al., 1991). The conclusion from this work was that hemolytic activity was dependent on a specific design and location of the basic “head” region, while antibacterial activity was not sequence specific (Boman et al., 1989a). Wade et al. (1990) investigated whether or not these peptides interacted with chiral membrane components to initiate antibacterial activity.  They  synthesized D-enantiomers of melittin, cecropin A, magainin-2 (all normally found in the L-form) and a few cecropin-melittin hybrids, and found that these peptides showed the same antibacterial and ion channel forming activities as their corresponding L-forms. They concluded that these peptides do not require specific interaction with chiral receptors or enzymes for antibacterial activity but rather an appropriate hydrophobic environment (Wade et al., 1990). During these studies, a new hybrid peptide was constructed [CA(1-8)M(1-18), hereafter referred to as CEME; Figure 3], which had even better antimicrobial activity and lower hemolytic activity than CA(1-13)M(1-13). Although the two dimensional structure for CEME has not been elucidated, its amino acid sequence indicates that it may have two hinge regions, one from the G-I-G-A  28  domain of melittin (which is the domain responsible for the hinge in CA( 113)M(1- 13)), and another from the G-L-P domain of the melittin sequence which provides the only bend in native melittin (Figure 6A).  The presence of two  flexible hinge regions would predict an overall reduction of the a-helical content of CEME, which was demonstrated by circular dichroism analysis (Wade et al., 1990).  Confirmation of this double-hinge structure and its ramifications for  antibacterial activity requires further investigation. Using CEME as a parent peptide, a number of truncated peptides were synthesized to determine how short the peptide could be made without compromising its bactericidal activity (Andreu et al., 1992).  C-terminal  deletions brought the peptide size down to 18 amino acids with no apparent loss of activity as compared to CEME. A series of 15-mers was created by combining the first 7 amino acids of cecropin A with different 8 amino acid segments from the N-terminal sequence of melittin. Although most of these peptides showed good activity, they all had slightly higher lethal concentrations than CEME, and in some cases were only weakly active against specific bacteria (Andreu et aL, 1992). The most active of these 15-mers were peptides that had a disrupted G-I-G-A domain and therefore no bend in the a-helix.  This  suggested that shorter peptides required a full length a-helix to disrupt membranes, but the mechanism of action of these shorter hybrid peptides was not explored further. A recent, ambitious study used 30 chimeric peptides to define further the structural requirements for antibacterial activity (Wade et al., 1992).  The  results confirmed that the general structural requirements were an amphipathic N-terminal a-helix, a flexible hinge region, and a hydrophobic C terminal a-helix, but no new requirements were discovered.  None of the  29  peptides tested in this study improved on the potent, broad host range activity of CEME.  C.  Fusion Protein Technology.  1.  Introduction.  Recent advances in the area of gene cloning and expression have placed new demands on the field of protein purification. It is now commonplace to take a cloned gene, whether it is prokaryotic or eukaryotic, and express it in a prokaryotic host such as E. coiL This process has resulted in the purification of many different proteins in quantities that would have been unattainable if purifying them from original sources. However, while providing larger amounts of starting material, this procedure did not simplify the tedious process of purifying the desired protein from a complex array of cellular components. The development of affinity tag fusion protein technology (reviewed in Sassenfeld, 1990; Uhlén and Moks, 1990) was a way to simplify the purification procedure. In one example of this technology, the gene encoding the protein of interest is fused to a gene encoding a protein that has a strong binding affinity to a specific ligand. The heterologous protein produced from such a gene fusion can be purified by affinity chromatography on a matrix to which the ligand is bound. In other examples, the affinity tag is a short, poly-amino acid “tail” that is added on to the protein, increasing its charge density or hydrophobicity and enabling its purification by ion exchange or hydrophobic chromatography. Examples of these two types of affinity tags are found in Table II. This technology provides several advantages for producing foreign proteins in a host such as E. coiL  Many heterologous proteins produced by  direct expression of a cloned gene are proteolytically degraded or insoluble.  30  c)  0.1 M glycine pH 3.0 or 2-5 Hopp, et al., 1988 mM EDTA Smith and Johnson, 1988 Mama, et al., 1988 Sassenfeld, 1984  Uhlén, et al., 1983 Moks, et al., 1987a  5 mM reduced glutathione 10 mM maltose NaC1 gradient low pH or imidazole  0.5 M acetic acid pH 3.4 0.5 M acetic acid pH 3.4  TM antibody Anti-Flag  Glutathione agarose Crosslinked amylose Cationic exchange  Nitrolotriacetic acid Sepharose (Ni ) 2 IgG-Sepharose IgG-Sepharose  F1agTM  Glutathione-S-transferase  Maltose binding protein  Polyarginine  Polyhistidine  Protein A  Synthetic IgG-binding domain  Hochuli, et al., 1988  Ong, et al., 1989  water  Cellulose  Cellulose-binding domain  3-ga1actosidase  250 mM  U]lman, 1984  0.1 Mborate  TPEG-Sepharose  Reference  Elution Conditions  Affinity Tag  Binding Matrix  Table II: Commonly Used Affinity Tags.  There aie several examples of proteins that, when produced as fusion proteins, had decreased susceptibilities to proteolysis and increased solubiity, compared to when they were produced directly (Marston, 1986). Another consideration of fusion protein production is the localization of the gene product.  Use of a  secretory system can have many advantages, such as the proper formation of disulfide bonds in the oxidative environment outside the cell, increased stabifity by the avoidance of intracellular proteases, increased solubility, the enhancement of purification procedures and, in some cases, the avoidance of host toxicity from the heterologous protein. Unfortunately, not all proteins are compatible with the secretory requirement of membrane translocation. The major obstacle of fusion protein technology is how to obtain the target protein free of the fusion partner with no extra amino acids on the N- or C-terminal ends.  One advantage of the technology is the ability to cleave  specifically the protein in vitro, as opposed to relying on the in vivo removal of the formylmethionine residue or the signal sequence which can result in heterogeneous N-terminal ends. In order to utilize this advantage, site-specific cleavage sites must be engineered in the fusion protein to allow the removal of all extraneous amino acids from the target protein. There are many different cleavage methods which are divided into chemical and enzymatic methods (Table III). Chemical methods tend to be quite efficient but are not feasible with larger target proteins which usually contain the low specificity recognition sequences internally. The cleavage conditions for these methods are also quite harsh and could be detrimental to the protein. In contrast, most enzymatic methods, especially the enclopeptidases, are very specific but can be expensive to scale up and are sometimes quite inefficient due to the inaccessibility of the recognition site to the enzyme. Therefore, the method best used to cleave the  32  CA)  CA)  -x-w-.I.-x-x-N-L-G-x-  BNPS-skatole  Hydroxylamine  or  -X-K-L-X-  -X-L-v-P-R-L-G-S-X-  Thrombin  -x-R-L-x-,  -x-I-E-G-R-i--x-  Factor Xa  Trypsin  -X-D-D-D-K-.L-X-  Enterokinase  Shine, et aL, 1980  Smith and Johnson, 1988  Nagai and Thøgersen, 1987  Maroux, et al., 1971  Germino and Bastia, 1984  -x-p-x-.L-G-p-x-  Sassenfeld, 1984  Collegenase  -X-L-K  Dahiman, et al., 1989  -X--R or  Carboxypeptidase B  Hochuli, et al., 1988  Moks, et al., 1987b  Knott, et al., 1988  Itakura, et al., 1977  Szoka, et al., 1986  Reference  Chymotrypsin  1 -x4-x  Carboxypeptidase A  1 R or K x  -X-M-J-X-  CNBr  Enzymatic  xD4p.x.  Recognition Sequence/Cleavage Site  Acid  Chemical  Method  Table III: Methods for the Sit&Specffic Cleavage of Fusion Proteins.  fusion protein will vary on an individual basis and depend on a number of factors including protein size and lability.  2.  Glutathione-S-transferase.  One commonly used affinity tag is glutathione-S-transferase (GST), which was originally identified in Schistosomajaponicum (Smith et al., 1986)  and can be expressed as an active, soluble protein in E. coil (Smith et al., 1988). This protein was the basis for a number of fusion protein vectors which were initially used to purify over 30 eukaryotic polypeptides (Smith and Johnson, 1988).  Since then, this system has been used in the purification of many  different proteins such as the murine leukemia inhibitory factor (Gearing et al., 1989), the Plasmodium faiciparum antigen Pf155/RESA (Stahl et al., 1990), epidermal growth factor receptor sequences (Koland et al.,  1990), rat  interleukin-6 (Frorath et al., 1992), Poa plX grass pollen allergens (Olsen and Mohapatra, 1992), the transactivation domain of Vmw65 from herpes simplex virus type 1 (Donaldson and Capone, 1992), mouse mammary tumor virus protease (Menéndez-Ariau et al., 1992), and human cellular retinoic acid binding protein II (Redfern and Wilson, 1993). The affinity of GST for reduced glutathione allows the purification of soluble GST fusion proteins by adsorption to glutathione agarose beads and subsequent desorption using free reduced glutathione (Smith and Johnson, 1988). The GST moiety of the purified fusion proteins can be released by specific proteolytic cleavage using thrombin or factor Xa (Smith and Johnson, 1988).  In several instances, the GST fusion  proteins were found to be partially degraded (Koland et al., 1990; Olsen and Mohapatra, 1992), although there does not appear to be a correlation between the amino acid sequence of the target protein and the lability of the fusion  34  protein. Another potential problem with this system occurs when the fusion proteins form insoluble inclusion bodies (Smith and Johnson, 1988; discussed in detail below) which require harsh purification techniques that are incompatible with that of affinity chromatography. This problem was recently addressed by Hartman et al. (1992) who described conditions which enabled the conversion of insoluble fusion protein aggregates to a soluble form amenable to glutathione agarose affinity purification.  3.  Protein A.  Another affinity tag that has been used extensively is the IgG-binding domain of S. aureus protein A (Nilsson and Abrahmsén, 1990). The gene was originally isolated by LOfdahl et at (1983) and its complete sequence confirmed earlier suggestions that it consisted of two functional domains (Uhlén et al., 1984). The N-terminal region has a 58 amino acid unit which is repeated 5 times and is believed to be responsible for IgG binding. The C-terminal region has an 8 amino acid unit which is repeated 12 times and is thought to be involved in the binding of the protein to the cell wall. The former region was used as the basis for a number of fusion protein vectors that had a truncated protein A gene (Uhlén et al., 1983). These vectors were first used to create protein A/[3-galactosidase fusion proteins that could be purified by adsorption to IgG-Sepharose and desorption using either a glycine buffer pH 3.0 (Lofdahl et al., 1983) or excess pure protein A (Uhlén et al., 1983) depending on the pH stabffity of the target protein. The original vectors were improved to give ones that were temperature inducible (pRIT2) or allowed for efficient secretion of the fusion protein to the E. coil periplasm or the S. aureus extracellular medium (pRITS)(Nilsson et al., 1985a). These vectors have since been used to produce  35  fusion proteins to alkaline phosphatase (Nilsson et al., 1985a), human insulinlike growth factor I (Moks et al., 1987a), human apoA-1 protein (Monaco et at, 1987), a transactivation domain of the herpes simplex virion protein VP16 (Stringer et at, 1990), yeast calmodulin (Stirling et al., 1992), and a tyrosine kinase domain of the c-src protein (Saya et al., 1993). A new series of fusion protein vectors was constructed using different multiplicities of a synthetic DNA fragment that encoded a small IgG-binding domain (designated “Z”).  This Z  region lacked asparagine-glycine dipeptide sequences as well as methionine residues which rendered it resistant to hydroxylamine and CNBr treatments respectively.  This allowed the specific release of a target protein that also  lacked these residues, by engineering one of these chemical cleavage sites at the junction of the fusion protein.  This was already demonstrated with the  production of IGF-I (Moks et al., 1987a). The ZZ-IGF-I protein was purified by IgG-Sepharose affinity chromatography, cleaved with hydroxylamine to release IGF-I, and passed over the affinity matrix a second time to obtain pure IGF-I in the flow through. This process was scaled up to a 1000 L which led to the production of large quantities of IGF-I (Moks et al., 198Th).  4.  Inclusion Body Formation and Protein Degradation.  The use of affinity tags for the production and purification of foreign proteins in E. coil is not without problems. Many foreign proteins produced either directly or as fusion proteins in E. coli are found to form insoluble, electron dense aggregates (reviewed in Marston, 1986; Kane and Hartley, 1988; Fischer et al., 1993). It has been, and continues to be, a mystery as to why some heterologous proteins form inclusion bodies while others do not. Early hypotheses suggested that solubifity limitations, the size of the protein, the type  36  of promoter, the extent of expression and the formation of incorrect intra- and inter-chain disuffide formation played key roles in inclusion body formation. However, upon comparing different insoluble and soluble fusion proteins with respect to these parameters, no correlation could be determined (Kane and Hartley, 1988; Schein, 1989). It should be noted that with a complex process such as inclusion body formation, the lack of any such correlations does not necessarily mean that these factors are not important for any specific protein. For example although not all cysteine-containing proteins form inclusion bodies, improper disulfide bond formation may contribute to the stabifity of the inclusion bodies in ones that do (Mitraki and King, 1989). One parameter that is consistently observed to affect inclusion body formation is growth temperature, with lower temperatures (30°C or lower) favoring soluble protein production (Schein and Noteborn, 1988). Mitraki and King (1989) suggested that inclusion bodies were formed by the aggregation of specific, partially folded intermediates and that this was dependent on temperature and pH. This would explain why some heterologous proteins are insoluble and others are not since each has its own specific folding pathways. This hypothesis was supported by a study in which the soluble production of a protein A/3-ga1actosidase fusion protein was dependent on specific temperature and pH conditions (Strandberg and Enfors, 1991). In addition, they showed that changing the amino acid sequence around the junction between the two proteins abolished inclusion body formation, perhaps as a result of alterations in the abffity of the fusion proteiii.to fold properly. The formation of inclusion bodies results in advantages and disadvantages with respect to fusion protein purification.  Substantial  purification of the protein by the removal of cytoplasmic contaminants can be obtained by differential solubilization of the inclusion bodies and has resulted  37  in protein that was used for crystallography (Nagai et al., 1988). As well, some proteins have been shown to be protected from proteolysis when produced as inclusion bodies (Cheng et al., 1981).  One major disadvantage of inclusion  bodies is that one must denature them with high concentrations of a chaotropic agent, such as urea or guanidine-HC1, to solubilLze them (Marston, 1986). In the case of disulfide-containing proteins, a sulfhydryl reducing agent is also required (for a review, see Fischer et al., 1993). This denaturation necessitates the refolding of the heterologous protein to recover its biological activity. This process comes with its own set of problems and complications which have to be solved for each individual protein, although recent advances in protein refolding have improved the efficacy of this procedure (reviewed in Schein, 1990). Another problem associated with fusion protein production is that of proteolytic degradation. There are believed to be 8 proteases in E. coil, 5 of which are found in the cytoplasm (Swamy and Goldberg, 1981), where most heterologous proteins accumulate. There are a few different ways to prevent this potential problem. One is to use a cocktail of protease inhibitors such as PMSF, EDTA, pepstatin A and leupeptin which inhibit serine, metallo, acid and thiol proteases respectively (Deutscher, 1990). Another alternative is to use E. coil hosts that are defective in one or more protease genes such as ion and htpR (Goff et al., 1984) or ompT (Elish et al., 1988).  One conclusion that can be  drawn from all this work is that each heterologous protein is different, thus making it difficult to predict their solubility and stability characteristics in a specific recombinant production system.  5.  Expression of Cationic Peptides.  38  The study of cationic peptides such as cecropins and defensins has been somewhat limited by the paucity of the material and the complexity of their purification schemes. Although chemical synthesis has been used to make small peptides like NP-i (Rao et al., i992) and cecropin A (Boman et al., i989b), for larger peptides and those with complex disuffide arrays this is not economically feasible. Therefore, there have been several attempts to establish expression systems in which to produce these peptides. The first successful attempts at producing cecropin A from H. cecropia were accomplished in a baculovirus system. Hellers et al. (i991) cloned a eDNA fragment encoding the preprocecropin A gene into a baculovirus which was used to infect insect hosts. The cecropin A peptide was properly processed to a mature, active form and secreted into the hemolvmph of the insects, although only 70% of the peptide was properly amidated at the C-terminus (Hellers et al., i99 1).  This recombinant construct, however, was not able to produce any  peptide in cultured insect cells. When the cecropin A gene was fused to a synthetic IgG-binding domain of S. aureus protein A (ZZ; Nilsson et al., i987) and placed in a baculovirus system, pure fusion protein was obtained from both cultured insect cells and larvae hosts (Andersons et al., i99i). Active cecropin A was obtained by CNBr cleavage of the fusion protein.  Although the  baculovirus system could be used to produce biologically active cecropin A, it is not a system that lends itself well to scale up. Saccharomyces  cerevisiae has also been used as a host for the  production of cationic peptides. The insect defensin A gene from P. terranovae was fused to the gene encoding a leader sequence from the yeast pheromone mating factor a (MFcci) and expressed in yeast (Reichhart et al., i992). The protein expressed from this gene was processed and secreted, resulting in active defensin A in the culture supernatant.  39  A scorpion insectotoxin, 1 A, was expressed in yeast, F. coil, and tobacco 5 plants (Pang et al., 1992). The peptide, which is 35 amino acids in length and contains 4 disulfide bonds, was secreted from both bacterial and yeast cells, and produced in the cytoplasm of the tobacco plant cells. Although the peptide could be purified from each host, no biological activity was detected.  The  peptides produced in yeast and bacteria were both found to contain extra amino acid residues at their N-termini, which may have had a detrimental effect on their activity. This work confirmed that producing cationic peptides by direct expression in bacteria was not very feasible. In fact, producing these peptides by fusion protein technology has been equally unsuccessful.  Fusions of  mammalian defensins to f3-galactosidase (T. Ganz, personal communication) and cecropin A to the ZZ domain (Andersons et al., 1991) were found to be highly susceptible to proteolysis when produced in bacterial expression systems. There has been only one known report of successful production of a cationic peptide in bacteria, that being the disulfide-containing peptide charybdotoxin (Park et al., 1991). This peptide was produced in F. coil as a fusion protein to the gene 9 protein of the T7 phage.  The peptide was  successfully released from the gene 9 protein by factor Xa and refolded to give a peptide that was shown to have biological activity. It is unknown if this system has been attempted for the production of other cationic peptides.  D. Aims of This Study.  The goals of this thesis were (1) to establish a bacterial expression system for cationic peptides in order to purify large quantities for further study, (2) to study the outer membrane permeabiizing activity and the bactericidal activity of selected peptides, and (3) to search for evidence that would support  40  the hypothesis that these peptides cross the outer membrane via the self promoted uptake pathway. HNP- 1 and CEME were the peptides chosen for this study due to their documented, strong activity against P. aeruginosa. In addition, CEMA, a C-terminal variant of CEME that contains two extra positive charges, and melittin were also studied.  41  MATERIALS AND METHODS  A.  Strains, Plasmids and Growth Conditions.  All strains used in this study are listed in Table 1V, and all plasmids used are found in Table V.  Most strains were grown on Luria Broth (1% (w/v)  tryptone, 0.5% (w/v) yeast extract) supplemented with 0.5% (w/v) NaC1 (LBNS) and 1.5% (w/v) agar.  Plasmids were maintained using antibiotics such as  ampicillin (75 jig/mL for E. coil), kanamycin (25 jig/mL for E. coil) and chioramphenicol (10 ig/mL for S. aureus).  For membrane permeabilization  studies such as lysozyrne lysis assays and NPN uptake assays the bacteria were grown in LB without any salt supplement (LB-S).  Bacteria used in dansyl  polymyxin displacement assays and minimum inhibitory concentration (MIC) assays were also grown in LB-S. All medium components were obtained from Difco Laboratories, Detroit, Michigan.  B.  Genetic Manipulations.  1.  General DNA Techniques.  All general DNA techniques such as DNA isolation, agarose gel  electrophoresis, radioactive labeling of oligonucleotides, colony blotting and Southern and Northern blotting were performed as described in Ausubel et al. (1987) and Sambrook et al. (1989). Other methods used included RNA isolation (von Gabain et al., 1983), and slot lysis gel electrophoresis (Sekar, 1987). DNA restriction and modifying enzymes (Bethesda Research Laboratories (BRL), Burlington, Canada; Boehringer Mannheim, Mannheim, Germany; Pharmacia,  42  0)  Goff, et aL, 1984 Goff, et al., 1984 Goff, et al., 1984 Richmond, et al., 1976 Richmond, et al., 1976 Meyers, et aL, 1974 Meyers, et al., 1974  ompT protease mutant  lac(am) trp(arn) pho(am) ,nal(am) supds rpsL SC 122 ion SC122 htpRl65-TnlO Parent for DC2  Antibiotic supersusceptible mutant Parent for 5C9252  Polymyxin B resistant  UT5600  C474 (SC 122)  C475  C476  UB1005  DC2  SC9251  SC9252  cont...  Elish, et aL, 1988  HfrC  K38  Russel and Model, 1984  Studier and Moffatt, 1986  F- hsds recA rtj’ non suppressing host (rjç mKj  HMS 174  R)  Studier and Moffatt, 1986  F- hsds gal non suppressing host (rB mBj  DH5cx  BL21  Reference/Source  Hanahan, 1983  Description  supE44 hsdRl7 recAl endAl gyrA96 thi-1 rel.A1  E. coil  Strain  Table IV: Strains.  .  T. Chow, UBC  Methicfflin resistant, clinical isolate  SAPOO17  Hancock and Wong, 1984 Angus, et al., 1982 Angus, et al., 1982  H 103 containing plasmid RP 1 Wildtype isolate; parent for Z61 Antibiotic supersusceptible mutant  H309  K799 (or H187)  Z61 (orHl88)  Clinical isolate and parent of 2 18R1 13-lactamase overproducing strain  218S  218R1  Marchou, et al., 1987  Marchou, et al., 1987  Fields, et al., 1989  phoP/phoQ mutant; defensin sensitive  C590 (MS7953s)  E. cloacae  Fields, et al., 1989  Parent of C590  C587 (14028s)  S. typhimurium  Hancock and Carey, 1979  PAO 1 prototroph  H 103  P. aeruginosa  Kreiswirth, et al., 1983  Reference/Source  Transformation recipient and expression host, methicihin sensitive  Description  RN4220  S. aureus  Strain  Table IV: Strains (con’t).  01  Pharmacia This study  Tabor and Richardson, 1985 This study Tabor and Richardson, 1985 This study  This study  This study  pTZ19R containing a 196 bp SmaJ fragment encoding a ribosome binding site, the E. coli alkaline phosphatase signal sequence and the HNP- 1 gene 1 17 RNA polymerase expression vector, Ap  p17-5 containing a 190 bp SstI/HindIII fragment from pKP 196 17 RNA polymerase expression vector that contains the ribosome binding site from 17 gene 10, ApR p17-7 containing a 160 bp NdeI/HirtdIII fragment from pKP 196 which lacks the ribosome binding site  Tabor and A P15A based plasmid that encodes the 17 RNA polymerase under Richardson, 1985 KanR control of the PL promotor. It also contains the repressor cI-857, Pharmacia  general cloning vector, ApR  glutathione-S-transferase fusion protein expression vector, ApR pTZ19R containing the 500 bp BctI/EcoRI fragment that had been changed by PCR pGEX-3X derivative with an SphI/HirtdIII/EcoRI multiple cloning site  pTZ19R  pKP 196  pT7-5  pKP 190  p17-7  pKP 160  pGP1-2  pGEX-3X  pPCR  pGEX-KP  con’t...  Reference/Source  Description  Plasmid  Table V: Plasmids.  0)  This study This study  This study  This study This study  This study  This study  pGEX-HNP- 1 with a 207 bp SphI fragment encoding the HNP- 1 pre pro region  pGEX-KP with a 110 bp SphI/HindIII fragment encoding the CEMA gene This study This study  pGEX-KP with a 97 bp SphI/HindIII fragment encoding the HNP-1 gene  pGEX-CEMA with a 25 bp NaeI/EcoRI fragment replaced with oligonucleotides K and L correcting the 2 bp deletion pGEX-CEME with a 207 bp SphI fragment encoding the HNP-1 pre pro region pGEX-CEME with adaptors at the 5’ and 3’ ends that create a CEME Sail fragment pGEX-CEMA with adaptors at the 5’ and 3’ ends that create a CEMA Sail fragment pGEX-HNP1 with adaptors at the 5’ and 3’ ends that create an HNP-1 BamHI fragment pGEX-proHNPl with adaptors at the 5’ and 3’ ends that create a proHNP- 1 BamHI fragment  pGEX-HNP-1  pGEX-proHNP- 1  pGEX-CEMA  pGEX-CEME  pGEX—pr0CEME  pGEX-CEME-S  pGEX-CEMA-S  pGEX-HNP1-B  pGEX-proHNPl-B  con’t...  Reference/Source  Description  Plasniid  Table V: Plasmids (con’t).  Reference/Source Pharrnacia  This study This study This study This study  Nicas and Hancock, 1983b  Description protein A based fusion protein expression vector for use in E. coil or S. aureus, j\mpR, CmR pRIT5 with a 136 bp Sail fragment encoding the CEME gene pRIT5 with a 142 bp Sail fragment encoding the CEMA gene pRIT5 with a 112 bp BamHI fragment encoding the HNP- 1 gene pRIT5 with a 295 bp BamHI fragment from pGEX-proHNP- 1 encoding the proHNP- 1 gene broad host range plasmid encoding the TEM-2 13-lactamase; NeoR KanR Tet’Amp’  Plasmid  pRIT5  pPA-CEME  pPA-CEMA  pPA-HNP- 1  pPA-proHNP- 1  RP1  Table V: Plasmids (con’t).  Uppsala, Sweden) and DNA ligase (BRL) were used according to the manufacturers method.  2.  DNA Fragment Isolation.  Specific DNA fragments were isolated by the band intercept technique (Winberg and HammarskjOrd, 1980) using DEAE paper and manufacturer’s method (Schleicher and Schuell Inc., Keene, N.H.). Alternatively, a method of isolating DNA fragments directly from agarose plugs was used. Briefly, a piece of agarose containing the fragment of interest was cut from a gel and placed in a 1.5 mL eppendorf tube containing siiconized glass wool. A small hole was poked in the bottom of this tube which was then placed in another 1.5 mL eppendorf tube.  Upon spinning these tubes at 5000 g for 10 mm  in a  microfuge, the liquid and DNA contained in the agarose plug was collected in the bottom tube. The DNA was extracted once with water-saturated N-butanol and ethanol precipitated.  3.  DNA Sequencing.  Plasmid DNA for sequencing was isolated using Qiagen columns (Qiagen Inc., Chatsworth, California) following the manufacturer’s protocol. Sequencing reactions were set up according to the manufacturer’s method, containing 1 ig of template DNA, 3.2 pmol of primer and components from an Applied Biosystems Inc. (ABI; Foster City, California) Taq DyeDeoxy Terminator Cycle Sequencing Kit.  Sequencing reactions were carried out using an Ericomp  thermocycler (98°C for 1 see, 50°C for 15 see, 60°C for 4 mm; 25 cycles), run on  48  an ABI 370A automated DNA sequencer, and analyzed using ABI 373A Data Collection and Analysis programs for the Macintosh computer.  4.  Polymerase Chain Reaction.  Reactions were set up to include 1 ng of template DNA, 20 pmoles of each oligonucleotide primer, 0.8 mM dNTPs, and 1 unit of DNA Taq polymerase 2 and 0.01% gelatin. (BRL) in 10 mM Tris-HC1 pH 8.2, 50 mM KC1, 0.8 mM MgC1 Reactions were covered with mineral oil and placed in an Ericomp thermocycler for 35 cycles of 94°C for 1 mm, 50°C for 1 mm  and 72°C for 1 mm, with a final  step of 72°C for 10 miii to complete all chain extensions. The entire contents of the reaction tube were placed on a piece of paraflim and rolled around to remove the mineral oil. Samples were then diluted and analyzed by agarose gel electrophoresis.  5.  Transformation and Electroporation.  Although some transformations of E. colt cells with plasmid DNA were 2 (Sambrook et al., 1989), most were done using the done using 0.1 M CaCl method of Chung et al. (1989). Briefly, cells to be transformed were grown to an 600 of 0.3-0.4 in LBNS. For each transformation, 1 mL of these cells were 0D pelleted in a 1.5 mL microcentrifuge tube for 1 mm  and resuspended in 100 jiL  of TSS solution (LBNS broth containing 10% (w/v) PEG 8000, 5% (v/v) dimethyl , pH 6.5). DNA ( 1 ng) was added to the cells and the 2 sulfoxide, 25 mM MgCl mixture was placed on ice. After 30 mm, 0.9 mL of LBNS was added to the cells which were then incubated at 37°C for 1 hr to allow the expression of the  49  plasmid’s antibiotic resistance gene.  Aliquots of the cells were plated on  selective medium and grown overnight at 37°C. The method for electroporation of S. aureus cells was similar to that of Compagnone-Post et al. (1991).  Cells were grown in 200 mL of LBNS to an  600 of 0.4-0.6 before being chilled and harvested. Cells were washed twice 0D with 80 mLs of cold electroporation buffer (7 mlvi HEPES pH 7.2, 272 mM sucrose) and finally resuspended in 2.4 mL of the same buffer. Between 10 and 100 ng of plasmid DNA was added to 160 iL of cells and stored on ice for a few minutes.  Electroporation was carried out in 0.1 cm electroporation cuvettes  using a Bio-Rad (Mississauga, Canada) Gene Pulser set to 200 ohms, 25 jiF and 1.8 kV.  Immediately following electroporation, 1 mL of SMMP medium (2.8%  (w/v) Bacto Pennassay Broth with 275 mM sucrose, 11 mM maleic acid, 11 mM 2 and 0.25% (w/v) BSA) was added. The cells were incubated for 90 mm MgC1 at 37°C before plating for transformants on LBNS plates containing 10 jig/mL of chioramphenicol.  6.  Oligonucleotide Purification.  Oligonucleotides were obtained from T. Atkinson (Department of Biochemistry, University of British Columbia). Oligonucleotides longer than 50 bases were gel purified according to the method of Atkinson and Smith (1984) using 8% polyacrylamide gels.  The oligonucleotides were visualized by UV  shadowing and cut out of the gel with a sterile scalpel.  To elute the  oligonucleotides, the polyacrylarnide gel slices were placed in 1.5 mL Eppendorf tubes containing 1 mL of 0.5 M ammonium acetate and incubated overnight at 37°C.  18 SEP-PAK The eluted oligonucleotides were further purified on C  cartridges (Waters, Milford, Massachusetts) as described by Atkinson and Smith  50  (1984). The 0.5 M ammonium acetate solution containing the oligonucleotides was loaded onto a prepared C 18 SEP-PAK column, washed with water and eluted with 40% acetonitrile. The oligonucleotides were either lyophilized or ethanol precipitated before quantification by A 260 absorbance. In the case of oligonucleotides of  <  50 bases, these were dissolved in 0.5 M ammonium  18 SEP-PAK columns using 20% acetonitrile as acetate and purified directly on C the eluting solution.  C.  Vector Construction.  1.  Direct Expression Vectors.  Six overlapping, complementary oligonucleotides (Table VI, A-F) encoding the gene for HNP- 1 (with E. coil biased nucleotides at the wobble position of each codon), preceded by the alkaline phosphatase signal sequence and a ribosome binding site, were annealed together (heated for 3 mm  at 90°C and  cooled slowly to room temperature) and ligated into pTZ19R that was previously cleaved with SmaI to form pKP196 (Figure 7).  From this plasmid, a 190 bp  SstI/HindIII fragment containing the HNP- 1 gene was cloned into pT7-5 to create pKP 190 (Figure 8).  This plasmid was transformed into K38 (pGP1-2)  which possessed a plasmid-encoded 17 RNA polymerase gene under the control of the temperature inducible ? Pj promoter and would allow HNP- 1 expression from the 17 RNA polymerase promoter. A 160 bp NdeI/HirtdIII fragment from pKP196 that no longer contained the ribosome binding site was inserted into p17-7 to make pKP 160 (Figure 8). This was also transformed into K38 (pGP1-2) for HNP- 1 expression.  51  F’)  01  CAGGCCGGTATACGGCAGTAGCATGCGGCITITGTCAC 64 mer used in construction of HNP- 1 gene AGGGGTAAACAGTAACGGTAAGAGTG 50 mer used in construction of HNP- 1 gene  CCTGCATCTACCAGGGCCGTCTGTGGGCGTrCTGCTG CTAAAAGCYCGC  GCGAAGC]TITAGCAGCAGAACGCCCACAGACGGCCCT 76 mer used in construction of HNP- 1 gene GGTAGATGCAGGTACCGTAACGACGTTCGCCCGCGATG  D  E  F  I  H  CGGGGATCCGCATATGAAATGGAAACTGITCAAGAAGA 102 mer encoding CEMA TCGGCATCGGCGCCGTGCTGAAAGTGCTGACCACCGGT CTGCCGGCGCTGAAGCTAACTAAGTA con’t...  GCGGGAKITCAAGCITGCATGCACGACCTI’CGATCAGA 42 mer used in converting pGEX-3X to pGEX-KP TCCG  30 mer used in converting pGEX-3X to pGEX-KP  65 mer used in construction of HNP- 1 gene  TGTGACAAAAGCCGCATGCTACTGCCGTATACCGGCCT GCATCGCGGGCGAACGTCGTTACGGTA  C  CCGATGGCCATCATACG’TTATATAGCTGAC  56 mer used in construction of HNP-1 gene  CCAGTGCAATAGTGCTITGYITCATATGTCTCCTCCT TAGYI’AGTPAGGAGCTCC  B  G  GGGAGCTCCTAACTAACTAAGGAGGAGACATATGAAAC 81 mer used in construction of HNP- 1 gene AAAGCACTATrGCACTGGCACTCTI’ACCGTTACTGm ACCCC  A  Description  Sequence 5’- 3’  Name  Table VI: Oligonucleotides.  01 Ci)  24 mer encoding factor Xa recognition site and an SphI to SaLT adaptor  CACGACC’ITCGATGTCGACGCATG  S  con’t...  24 mer encoding factor Xa recognition site and an SphI to SalT adaptor  CTCATCAGCTCTTGCCTGGAGTGGCTCAGCCTGGGCCT 92 mer used in construction of pre pro GCAGGGCCAGCAGGAGAATGGCAGCAAGGATGGCGAGG cartridge GTCCTCATATGGCATG  P  CGTCGACATCGAAGGTCGTGCATG  109 mer used in construction of pre pro cartridge  CCATGYf1TI’CCTTGAGCCTGGATGC1TFGGAGCCAA GC1TCGTCCCATGCAAGGGAAACAACCACTCTGGGA TGTCAGCTGCAATCTGCTCCGGGGCTGCTGCAAC  0  R  TTGCAGCTGACATCCCAGAAGTGGYrGYITCCCTI’GCA 91 mer used in construction of pre pro TGGGACGAAACGTGGCTCCAAAGCATCCAGGTCAAG cartridge GAAAAACATGGCATG  N  12 mer encoding a HiridIII to SaLT adaptor  CCATATGAGGACCCTCGCCATCC’ITGCTGCCAYrCTCC 110 mer used in construction of pre pro TGGTGGCCCTGCAGGCCCAGGCTGAGCCACTCCAGGCA cartridge AGAGCTGATGAGGYGCAGCAGCCCCGGAGCAGA  M  AGCYGTCGACA  31 mer used in converting CEMA to CEME  AATPCAAGCTTACYPAG’rFAGCTrCAGCGCC  L  Q  27 mer used in converting CEMA to CEME  GGCGCTGAAGCTAACTAAGTAAGCTJ’G  K  AGCYACTAGTPAGCTCAGCGCCGGCAGACCGGTGG 110 mer encoding CEMA TCAGCACTTTCAGCACGGCGCCGATGCCGATCTCYG AACAGTITCCATITCATATGCGGATCCCCGCATG  J  Description  Sequence 5’- 3’  Name  Table VI: Oligonucleotides (con’t).  01  Description 15 mer encoding a methionine residue and an SphI to BamHl adaptor 15 mer encoding a methionine residue and an SphI to BamHl adaptor 12 mer encoding an EcoRl to BamH 1 adaptor 12 mer encoding an NdeI to BamHl adaptor 23 mer used as sequencing primer 20 mer used as sequencing primer  Sequence 5’- 3’  CGGATCCATGGCATG  CCATGGATCCGCATG  AA’ITCGGATCCG  TATGGGATCCCA  CCAAAATCGGATCTGATCGAAGG  CAGATCGTCAGTCAGTCACG  Name  T  U  V  W  X  Y  Table VI: Oligonucleotides (con’t).  A  C  B  D  E  F  Ligate into Smal site of pTZ19R  Figure 7: Schematic representation of the strategy used to anneal the six oligonucleotides that encoded the HNP- 1 gene.  55  Sstt  SphI  NdeI  —  SstI HindIJI  T7 RNA Polymerase Promoter  Figure 8: Construction of pKP19O and pKP16O. The HNP-1 gene was inserted into p17-5 and p17-7 to form pKP19O and pKP 160 respectively as described in Materials and Methods, section C. 1. Only relevant restriction sites are shown. The large arrow indicates the position and direction of the 17 RNA polymerase promotor. AP, alkaline phosphatase; rbs, ribosome binding site.  56  2.  GST Expression Vectors.  The multiple cloning site of the fusion protein expression vector pGEX 3X had to be changed before the HNP- 1 gene could be cloned into it. Therefore, a 500 bp BamHI/BalI fragment was isolated from pGEX-3X and subjected to PCR using oligonucleotides G and H, the latter which had a 21 base overhang encoding SphI, Hindlil and EcoRI restriction enzyme sites. The PCR reaction (Materials and Methods, section B.3.) was performed in an Ericomp thermocycler. The reaction products were blunt-ended using Kienow fragment and ligated into pTZ19R cleaved with Smal to produce pPCR.  A 200 bp  BclI/EcoR[ fragment from pPCR was used to replace the BclI/EcoRI fragment  from pGEX-3X to produce pGEX-KP, which now had a multiple cloning site consisting of SphI, HindIII and EcoRI instead of BamHI, SmaI and EcoRI. A 90 bp SphI/HindIII fragment from pKP196 containing just the HNP-1 gene was cloned into pGEX-KP to create pGEX-HNP- 1, which was sequenced using oligonucleotides X and Y as primers to ensure it was the correct construct. The plasmid pGEX-CEME was created by a two step process.  Two  complementary oligonucleotides encoding SphI and HirtdIII sticky ends and the CEME gene preceded by a methionine codon were cloned into pGEX-KP. Upon sequencing, however, a 2 bp deletion was discovered, which resulted in a gene encoding a peptide (CEMA) with an additional 2 amino acids and a net charge change of ÷2 as compared with CEME (oligonucleotides I and J). This plasmid was termed pGEX-CEMA. In order to fix the frameshift mutation, a NaeI/EcoRI fragment containing the deletion was removed from pGEX-CEMA and replaced with oligonucleotides K and L to form pGEX-CEME.  This correction was  confirmed by DNA sequencing.  57  The plasmids pGEX-proHNP- 1 and pGEX-proCEME were created using oligonucleotides M-P which encode the pre pro region of the HNP- 1 gene (Daher et al., 1988).  These oligonucleotides, which have SphI sticky ends when  annealed, were inserted into SphI-cleaved pGEX-HNP-1 and pGEX-CEME. The insertion orientation of the prepro fragment was confirmed by restriction enzyme analysis.  3.  Protein A Expression Vectors.  The limited restriction sites available for cloning into pRIT5 (Nilsson et a!., 1985a) and the requirement for obtaining the correct reading frame, necessitated changing the 5’ and 3’ ends of the CEME, CEMA and HNP- 1 genes. For CEME and CEMA, the 3’ ends were altered by inserting the self-annealing oligonucleotide  Q encoding a Hindill to Sail adapter into the Hindill sites of  pGEX-CEME and pGEX-CEMA. These were further altered at the 5’ end by cloning, into the SphI sites, the annealed oligonucleotides R and S which encode an SphI to Sail adapter including a factor Xa recognition site.  The  orientation of this asymmetric insertion was confirmed by DNA sequencing. The Sail fragments from the resulting two vectors (pGEX-CEME-S and pGEX CEMA-S) were cloned into pRIT5 to produce pPA-CEME and pPA-CEMA. The HNP- 1 gene was modified in a similar manner. An SphI to BamHI adapter containing a methionine codon (oligonucleotides T and U) was inserted into the SphI site on the 5’ end of the HNP- 1 gene (the orientation was confirmed by DNA sequencing), while an EcoPJ to BamHI adapter (oligonucleotide V) was used at the 3’ EcoRI site. The resulting BamHI fragment from pGEX-HNP-1-B was cloned into pRIT5 to form pPA-HNP- 1. The plasmid pGEX-proHNP- 1 was changed to pGEX-proHNP-1-B using oligonucleotide V at the 3’ end and  58  oligonucleotide W, an NdeI to BamHI adapter, at the 5’ end. The cloning of this BamHI fragment into pRIT5 resulted in the production of pPA-proHNP- 1. All pPA plasmids were isolated and electroporated into S. aureus RN4220  D.  Immunological Techniques.  1.  Production and Purification of Antibodies.  Antibodies were prepared as described by Harlow and Lane (1988). A preparation of GST/CEMA was solubffized in SDS-PAGE loading buffer, heated at 100°C for 10 mm, and loaded onto a preparative SDS polyacrylamide gel. GST/CEMA contained in gel slices was passively eluted into water and lyophiized. The sample was resuspended and mixed with an equal volume of Freund’s complete adjuvant before injecting 1 mg of protein subcutaneously into a rabbit. Booster shots of 1 mg of protein mixed with Freund’s incomplete adjuvant were given at 3 and 7 weeks. After 10 weeks, the rabbits were bled  and the serum was isolated.  2.  Western Blotting.  Western immunoblotting (Mutharia  and  Hancock,  1983)  and  immunodetection (Mutharia and Hancock, 1983; Harlow and Lane, 1988) were done as previously described.  59  E.  Electrophoresis.  1.  SDS-PAGE.  SDS-PAGE was performed as previously described (Hancock and Carey, 1979).  2.  AU-PAGE.  AU-PAGE was done according to the method of Panyim and Chalkey (1969).  Briefly, 15% polyacrylamide gels containing 5 M urea (w/v) and 5%  acetic acid were pre-electrophoresed at 100 V for two hours (for mini gels) or 150 V overnight (for large gels) in 5% acetic acid. The buffer was replaced with new 5% acetic acid before the samples were loaded. Samples were solubiized in 5% acetic acid and diluted 2:1 with sample buffer (9 M urea in 5% acetic acid containing methyl green as a tracking dye).  Gels were run in the reverse  polarity (towards the cathode) at either 100 V or 250 V until the methyl green migrated off the bottom of the gel.  F.  Protein Expression.  1.  Direct Expression.  Attempts to express HNP-1 from pKP 190 and pKP 160 using the 17 RNA polymerase system were performed as previously described (Ausubel et al., 1987). Briefly, K38 (pGP1-2) cells containing pKP19O or pKP16O were grown in LBNS with kanamycin and ampidillin at 37°C to an 0D 600 of 0.5. A sample of cells was removed (as an uninduced control) before the culture was shifted to 42°C for 30 mm  to induce the T7 RNA polymerase. Again, a sample of cells was  60  removed before the culture was shifted back to 37°C and 200 ig/mL of rifampicin simultaneously added to prevent E. coiL RNA polymerase activity. The cells were harvested and the basic proteins extracted as previously described (Lindahi and Zengel, 1979). Proteins extracted from all strains were analyzed by SDS-PAGE and AU-PAGE.  2.  GST Fusions.  Cells of E. coil strain DH5a containing pGEX-KP, pGEX-CEME, pGEX pr0CEME, pGEX-CEMA, pGEX-HNP-l or pGEX-proHNP-1 were grown at 37°C to mid log phase and IPTG added to a final concentration of 0.2 mM to induce fusion protein expression. Growth was allowed to continue for 3 h before cells were harvested.  To test for fusion protein production, 500 jiL of cells were  pelleted in a microfuge for 1 mm  and resuspended in 30-50 iiL of water. An  equal volume of 2X SDS-PAGE whole cell lysing buffer (2X WCLB; 0.125 M Tris HC1 pH 6.8,  20%  (v/v) glycerol, 4% (w/v) SDS and  10%  (v/v)  mercaptoethanol) was added, the sample heated at 100°C for 10 mm  2and  loaded onto an SDS-PAGE gel.  3.  Protein A Fusions.  Initially, expression of PA/CEME fusion protein was attempted in E. coiL DH5o cells harboring pRIT5 or pPA-CEME were grown at 37°C until mid-log phase. Samples of whole cells and culture supernatants were analyzed by SDS PAGE and Western immunoblotting for the presence of fusion protein. Fusion proteins were detected on Western immunoblots using an IgG antiserum which bound to the carrier portion of the molecule. Plasmids pRIT5, pPA-CEME, pPA  61  HNP- 1, and pPA-proHNP- 1 were also expressed in S. aureus strain RN4220. In this case, S. aureus cells harboring the various plasmids were grown at 37°C to an 0D 600 of between 1.5-1.8 before the cells were removed by centrifugation. Culture supernatants  (20 tL) were analyzed as above by Western  immunoblotting. Large scale (20 L or 60 L) expression of pPA-CEME was done in a LH fermentor (100L working volume, 5000 series) and the cells removed by a Sharples centrifuge T-1P.  After the addition of 1 mM sodium azide, the  supernatant was clarified using a 0.45 iM membrane in a Pellicon Cassette System with tangential flow filtration (Millipore). The supernatant was then concentrated about 10-fold by ultrafiltration using a 1 kDa Omega Filtron Centrasett Screen Channel. Large scale growth of RN4220(pPA-CEME) and the clarification and concentration of the culture supernatant were carried out by L. Robillo and G. Lesnicki (Biotechnology Laboratory, University of British Columbia)  G.  Fusion Protein Purification.  1.  GST Fusion Proteins.  Cell pellets were resuspended in 1/100 volume of 50 mM Tris-HC1 pH 8.0, 50 mM NaC1 and 1 mM EDTA and passed twice through a French pressure cell at 15,000 psi. The lysate was fractionated by centrifugation at 2500 g for 5 mm  and the fusion protein recovered either in the supernatant fraction or in  the pellet as insoluble inclusion bodies.  In the former situation, the  supernatant was incubated for 1 h at 4°C with glutathione agarose beads (sulfur linkage, Sigma, St. Louis, Missouri) previously swelled and equilibrated in mouse tonicity phosphate buffered saline (MTPBS; 150 mM NaCl, 16 mM PO pH 7.2). The beads were washed three times 2 NaH , HPO and 4 mM 4 2 Na 4  62  with one volume of MTPBS by resuspension and centrifugation.  The fusion  protein was eluted with 5 mM reduced glutathione in 50 mM Tris-HC1 pH 8.0. The cellular production of inclusion bodies prevented the use of affinity chromatography to purify the fusion protein.  Therefore, two methods of  differential solubilization were employed to purify the inclusion bodies.  For  GST/HNP-1, the insoluble pellet was washed sequentially with: 1) 10 mM Tris HC1 pH 8.0, 10 mM EDTA and 1% Triton X-100; 2) H 0; 3) 3 M urea (APISTAR 2 quality, BDH Chemicals, Vancouver, Canada; previously deionized with AG 501-X8 mixed bed resin, Bio-Rad) in 5 mM Tris-HC1 pH 8.0; and 4) H 0. Each 2 wash consisted of resuspending the pellet thoroughly with a pipet and immediately pelleting it at 20 K for 15 mm  in an ultracentrifuge using a Ti50 or  60 rotor. Finally, the inclusion bodies were solubiized with 8 M urea in 5 mM Tris-HC1 pH 8.0. For GST/pr0CEME, the insoluble pellet was extracted using a different procedure. After washing the pellet with 10 mM Tris-HC1 pH 8.0, 10 mM EDTA and 1% Triton X-100, it was sequentially extracted twice with 10 mM Tris-HC1 pH 8.0, 10 mM EDTA and 3% (v/v) octyl-polyoxyethylene (0-POE; Bachem Bioscience, Philadelphia), and twice with 10 mM Tris-HC1 pH 8.0. This procedure removed all the contaminating membrane proteins and resulted in a reasonably pure inclusion body preparation.  2.  Protein A Fusion Proteins.  PA/CEME and PA/CEMA were purified as previously described (Moks et al., 1987a). Briefly, clarified culture supernatants were adjusted to pH 7.6 with NaOH and passed over an IgG-Sepharose column (bed volume of 30 mL, Pharmacia), previously equffibrated with TST buffer (50 mM Tris-HC1 pH 7.6, 150 mM NaCl and 0.05% Tween 20). The column was washed sequentially with  63  10 volumes of TST and 5 volumes of 5 mM ammontum acetate pH 5.0. Sample loading and column washing was done at a flow rate of 100-150 mL/hr which was controlled by a Pharmacia P-i peristaltic pump. The fusion protein was eluted at a flow rate of 50 mL/hr with 0.5 M acetic acid pH 3.4 and lyophilized.  H.  Peptide Release.  1.  Factor Xa.  Inclusion body preparations of GST/HNP- 1 previously solubilized in 8 M urea and 5 mM Tris-HC1 pH 8.0 were placed in Spectra/Por 3 dialysis tubing (Spectrum Medical Industries, Los Angeles, California) and sequentially dialyzed overnight against 1 M urea in 5 mM Tris-HC1 pH 8.0, and factor Xa cleavage ). If necessary, 2 buffer (50 mM Tris-HC1 pH 8.0, 100 mM NaC1 and 1 mM CaCl the sample was concentrated using a Centricon 10 (Amicon, Oakvfile, Canada). Factor Xa (Boehringer Mannheim) was added at an enzyme to substrate ratio of approximately 1:25, and the reaction was allowed to proceed at 37°C for 60 h. Samples were taken at 12 h intervals and analyzed on a 12-25% gradient SDS PAGE gel.  2.  Cyanogen Bromide.  Whether the sample was an inclusion body preparation of GST/proCEME or purified, lyophilized PA/CEME or PA/CEMA, the fusion proteins were solubilized in 70% formic acid to which 1 M CNBr was added.  Protein  concentrations in these reaction were such that the molar excess of CNBr to methionine residues in the fusion protein was at least 2000. The sample was flushed with nitrogen, tightly capped, and incubated in the dark at 25°C for 18-  64  24 h.  The reaction was quenched by diluting to 5% formic acid with H 0 2  followed by lyophiization.  I.  Peptide Purification.  The CNBr cleaved PA/CEME or PA/CEMA fusion protein was resuspended in 5% formic acid, and approximately 100 mg loaded onto a Bio Gel P100 column (bed volume of 300 mL, flow rate of 10 mL/h, Bio-Rad), and eluted with 1% acetic acid. Two mL fractions were collected, lyophiized and analyzed by AU-PAGE.  Fractions containing the peptide were pooled,  lyophiized and resuspended in 0.1% TFA.  In the case of a large scale  preparation, a 15 mg sample was loaded onto an FPLC Bio-Sil C 18 reverse phase column (bed volume of 50 mL, flow rate of 2 mL/min, Bio-Rad), previously equilibrated with 0.1% TFA. The sample was eluted with a 60 mL gradient of 50% acetonitrile in 0.1% TFA. Samples containing the peptide of interest were pooled, lyophiized and again resuspended in 0.1% TFA.  Final  purification of the peptide was performed on a Pharmacia PepRPC HR 5/5 column (bed volume of 1 mL, flow rate of 0.7 mL/rnin). One mg of protein was loaded onto the column and the peptide was eluted with the following gradient of acetonitrile in 0.1% TF’A:  3 mL, 0-30%; 5 mL, 30%; 20 mL, 30-50%.  Fractions (0.5 mL) were lyophilized and analyzed by AU-PAGE to confirm homogeneity.  J.  Gel Overlay Assay.  Detection of antibacterial activity of proteins separated by AU-PAGE was described previously (Hultmark et al., 1980).  Briefly, purified or partially  65  purified samples of antibacterial peptides were electrophoresed on a 15% acid urea gel which was then incubated in Mueller-Hinton broth containing 0.2 M sodium phosphate buffer pH 7.4 for 1 h. The gel was overlaid with 5 mL of the same media containing 0.6% agar and about  colony forming units of E. coil  DC2, and then again with another 5 mL of agar.  The gel was incubated  overnight at 37°C which resulted in zones of lysis that corresponded to the migration site of the antibacterial peptide.  K.  Peptide Analysis.  1.  Preparation of Samples.  Peptides were subjected to AU-PAGE on a 15% gel and electroblotted onto Immobilon membrane (Millipore, Bedford, Massachusetts) using the manufacturer’s method. Briefly, the transfer membrane was wetted with 100% methanol for a few seconds, rinsed in water, and equilibrated in transfer buffer (0.7% acetic acid, 10% methanol). Electroblotting was carried out in a Bio-Rad Mini Trans-Blot electrophoretic apparatus in the direction of the cathode for 2 h at 150 V. The membrane was stained with 0.5% (w/v) Ponceau S in 1% acetic acid for 2 mm  and destained with water until protein bands were visible  (Ausubel et aL, 1987).  2.  Amino Acid Sequencing and Analysis.  The band containing the peptide of interest was excised and analyzed for amino acid content using an Applied Biosystems amino acid analyzer (model 470) and the N-terminal sequence determined using an Applied Biosystems sequencer (model 420). The amino acid analysis and peptide sequencing was  66  carried out by S. Keiland (Department of Biochemistry and Microbiology, University of Victoria, B.C.).  L.  Assays.  1.  Protein Concentration Estimation.  a.  Lowry. Most protein concentrations were estimated with a modified Lowry assay  (Sandermann and Strominger, 1972). A 1 mg/mL solution of bovine serum  albumin was used as a standard.  b.  Dinitrophenylation. Since CEME and CEMA only have one aromatic residue in their primary  structures, a protein assay that measures the presence of free amino groups (Bader and Teuber, 1973) was used instead of the modified Lowry assay. A 1 mg/mL solution of poiymyxin B was used as the standard. Briefly, a 50 IlL sample of peptide was mixed with Na 7 10H O 4 B 2 0 (final concentration 0.8%) 2 and 1-fluoro 2,4 dinitrobenzene (final concentration 10 mM), and incubated at 37°C for 1 h. One mL of 2 N HC1 and 1 mL of n-butanol were added, and the mixture vortexed.  After centrifugation at 100 rpm for five minutes, the  absorbance of the butanol phase was read in a spectrophotometer at 420 nm. The values obtained needed to be adjusted to reflect the number of free amino groups in the respective peptides compared to the standard (CEME had 6, CEMA had 8, and polymyxin B had 5).  67  2.  Killing Assay.  This assay was performed as described previously (Lehrer et al., 1983). Briefly, reactions were carried out in 100 iL volumes and contained 106 CFU of  P. aeruginosa H187 in a low ionic strength buffer (10 mM potassium phosphate, pH 7.4), and either 2.5 Jig/mL or 5.0 Jig/mL of CEME. After either 20 or 60 mm at 37°C, samples of the bacteria were removed, diluted and plated to obtain a viable count.  3.  Lysozyme Lysis.  The  uptake  of lysozyme into whole  cells  due  to  membrane  permeabilization by various compounds was previously described by Hancock et al. (1981).  Overnight cultures of P. aeruginosa H309 or .E. cloacae 218R1  grown in LB-S were diluted 1 in ü in fresh medium and grown to an 0D 600 of 0.5-0.6. The cells were harvested in a Silencer H-103N clinical centrifuge at 1800 g for 10 mm, washed once with one volume of assay buffer (5 mM HEPES 600 of 0.5. pH 7.2, 5 mM KCN), and resuspended in the same buffer to an 0D Assays consisted of 600 jiL of cells with 50 jig/mL of chicken egg white lysozyme and varying concentrations of cationic compounds.  Cell lysis was  measured as a decrease in the 0D 600 in a Perkin-Elmer dual beam spectrophotometer. Parallel experiments performed without lysozyme enabled the measurement of the lytic activity of the compounds themselves. To test whether or not permeabffity to lysozyme could be inhibited by divalent cations, 2 were added to the assay after the addition of various concentrations of MgC1 lysozyme and before the addition of the test compound.  68  4.  i-N-phenylnaphthylamine Uptake.  This assay was previously described by Loh et al. (1984).  Cells were  prepared exactly the same as for the lysozyme lysis assay.  i-N  phenylnaphthylamine (NPN) was dissolved in acetone at a concentration of 500 jiM. NPN fluorescence was measured in a Perkin-Elmer 650-i OS fluorescence spectrophotometer using excitation and emission wavelengths set to 350 nm  and 420 nm respectively, with slit widths of 5 nm. The assay was standardized by adding 20 jiL of NPN (final concentration of 10 jiM) and 10 jiL of a 0.64 mg/mL solution of polymyxin B (final concentration of 6.4 jig/mL) into 1 mL of cells, and adjusting the resulting fluorescence to read 90% deflection on the chart recorder (90 arbitrary units). Various compounds were tested by adding 10 jiL of different concentrations to a cuvette containing 1 mL of cells and 10 jiM NPN. Permeabilizing activity was designated as the total fluorescence minus the fluorescence due to NPN alone. Following the fluorescence measurement, the 0D 600 of the cells was measured to ensure no significant cell lysis had occurred.  Control experiments showed that neither acetone nor test  compounds alone resulted in an increase in fluorescence in the absence of NPN.  5.  Dansyl Polymyxin B Displacement.  a.  Lipopolysaccharide Isolation. P. aerugiriosa LPS was isolated as previously described (Darveau and  Hancock, 1983). The procedure was performed by Susan Farmer.  69  b.  Dansyl Polymyxin B Synthesis. Dansyl polymyxin B was synthesized as described by Schindler and  Teuber (1975).  Briefly,  40 mg of polymyxin B and 10 mg of dansyl chloride  were mixed in 2 mL of 60 mM NaHCO 3 and 40% acetone and incubated in the dark for 90 mm. The unreacted dansyl chloride was separated from the dansyl polymyxin B by gel filtration on a Sephadex G-50 column.  The fractions  containing dansyl polymyxin were extracted with 1/2 volume of n-butanol and evaporated to dryness in a desiccator at 37°C. The dansyl polymyxin B was resuspended in 5 mM HEPES pH 7.0, quantified by dinitrophenylation and stored in aliquots at -20°C. This procedure was carried out by Susan Farmer.  c.  Assay. The method of Moore et al. (1986) was used to test how much dansyl  polymyxin B was needed to saturate the binding sites on LPS.  Briefly, 5 iL  samples of 100 iIM dansyl polymyxin B were titrated into 1 mL of 3 ig/mL of LPS until a maximum fluorescence was reached.  The fluorescence was  measured in a Perkin-Elmer 650-1 OS fluorescence spectrophotometer with an excitation wavelength of 340 nm and an emission wavelength of 485 nm using slit widths of 5 nm. A final concentration of dansyl polymyxin B giving 90100% maximum fluorescence (2.5 iM) was chosen and used in all subsequent experiments. For the binding displacement assays (Moore et al., 1986), 2.5 IIM dansyl polymyxin B was added to 3 jig/mL of H103 LPS in 5 mM HEPES pH 7.2.  Samples (5 jiL) of the test compounds were added and the decrease in  fluorescence due to displacement of the dansyl polymyxin B from the LPS was recorded. The addition of the compound was continued until it resulted in only a small (<5%) decrease in fluorescence. The data were plotted as the fraction of  70  dansyl polymyxin B bound as a function of the concentration of compound (I). The relative affinities of the compounds for the binding sites on LPS were determined by calculating the  values directly from the graph.  150  represented the concentration of compound that resulted in 50% maximal displacement of dansyl polymyxin B from the LPS.  All experiments were  performed a minimum of three times. For dansyl polymyxin B binding inhibition assays using whole cells instead of purified LPS, H309 cells were prepared in the same way as for the lysozyme lysis assay. The assay consisted of 10 jiL of cells at an 0D 600 of 0.5, 990 iL of 5 mM HEPES pH 7.2 and 5 mM KCN, and a concentration of dansyl polymyxin B that had been determined to result in 90-100% binding saturation. This concentration varied from day to day but usually was between 2.5 jiM and 3.5 jiM. Compounds were titrated in, and 150 values determined as described above.  6.  Minimum Inhibitory Concentration.  These assays were done according to the broth dilution method (Amsterdam, 1991).  Briefly, cells were grown overnight at 37°C in LB-S and  diluted 1 in 10 000 in the same medium to give concentrations of about 10 to iü CFU/mL.  Serial dilutions of the antimicrobial substances in LB-S were  performed in a 96 well microtitre plate. Subsequently, 10 jiL of bacteria were pipetted into 100 jiL volume of the diluted antibiotic, and the plates incubated overnight at 37°C.  Samples of the bacterial inoculum were plated to ensure  they were within the proper inoculum range. The next day the microtitre plates were scored for growth in the wells, and the MIC determined as the lowest antibiotic concentration that inhibited growth.  To determine the effect of  71  2 or 80 cations on the MIC values of the various compounds, either 5 mM MgC1 mlvi NaC1 were included in the LB-S medium. In the synergy MIC studies, the given sub-MIC concentrations of the peptides were included in the LB-S medium.  72  RESULTS CHAPTER ONE.  The Production of Cationic Peptides as GST Fusion  Proteins.  A.  Introduction: Why Fusion Proteins Are Necessary.  The HNP- 1 gene was initially cloned into the T7 RNA polymerase expression vectors pT7-5 and pT7-7 (Materials and Methods, section C. 1.).  Attempts at producing HNP-1 from either of these two constructs ((Materials and Methods, section C. 1.) were unsuccessful as determined by SDS-PAGE and  AU-PAGE (data not shown). To ensure that the lack of peptide production was not a transcriptional problem, Northern blots were performed with uninduced and induced cultures of K38 (pGP1-2)(pKP 160) using oligonucleotide D (Table VI) as a probe. The results showed a small transcript being produced in the induced cultures that was not present in the uninduced culture (data not shown).  Based on these experiments, it was concluded that although the  transcription of the gene was occurring, the protein was either not being produced at all, or was being produced and subsequently degraded by the host organism. The inabifity to produce HNP- 1 by direct expression of the gene in E. coli led to attempts to produce it as a fusion protein. Certain requirements of a fusion protein expression system had to be met if it were to be useful for producing cationic peptides.  First, the carrier protein had to have a high  affinity for a specific ligand to provide a simple means of purification. Second,  the affinity tag had to contain a site specific cleavage sequence (either enzymatic or chemical) to allow the release of the cationic peptide. Third, the vector had to possess restriction enzyme sites that would enable the insertion of the gene immediately adjacent to the specific cleavage site. This would allow  73  the release of the peptide from the carrier protein without any extra amino acids at the N-terminus of the peptide. This is critical in the case of cationic peptides since it has been shown that the addition of one or more amino acids to the peptide can alter its biological activity (Bessalle et al., 1992).  Since the GST  fusion protein system, specifically the vector pGEX-3X, fulfilled these criteria, it was used to express the genes encoding HNP- 1 and CEME.  B.  Construction of the pGEX-KP Vector.  The vector pGEX-3X did not have the restriction enzyme sites that were compatible with the ends of the HNP- 1 gene. Therefore, the multiple cloning site (BamHI/SmaI/EcoRl) was changed to include the appropriate sites  (SphI/HindIII/EcoPJ) necessary for the insertion of the HNP- 1 gene. This was accomplished using a series of genetic manipulations (Materials and Methods, sections B .3. and C .2.; Figure 9).  When the HNP- 1 gene (Figure 1 OB) was  cloned into the resulting vector, pGEX-KP (Materials and Methods, section C.2.; Figure 1 OA), the first amino acid codon of the HNP- 1 gene (Ala) was immediately 3’ to the last amino acid codon of the factor Xa recognition site (Arg)(Figure 9). Theoretically, therefore, when the fusion protein (GST/HNP- 1) produced by this construct (pGEX-HNP- 1) was purified and cleaved with factor Xa, there would be no extraneous N-terminal amino acids on the HNP- 1 peptide.  C.  The Production and Purification of GST/HNP-l.  The production of the GST/HNP- 1 fusion protein was investigated by inducing the expression of the gene with IPTG for varying amounts of time (Figure 11).  The vector pGEX-3X was used as a control, and pGEX-KP was  74  Cut out BamHI-BaII fragment from pGEX-3X  4  Factor Xa  Sphl  Ball  Hindill  EcoRl  BclI  primer  PCR  I  Isolate PCR fragment  500bp  C 1 I E G RA  I  Sphl  BcII  Ball  Hindlil  EcoRl  Blunt ligate into pTZ19U Cut with Bcll and EcoRl Isolate small fragment  Ligate  Ball  Isolate large EcoRIIBcll fragment  Sphl  HindIll EcoRl  Bcll  BcIl Ball  pG EX-KP  BcII  Figure 9: Construction of pGEX-KP. All genetic manipulations are described in Materials and Methods, sections B.3. and C.2. The I-E-G-R sequence is the factor Xa recognition site and the A-C residues are encoded by the SphI site and represent the first two amino acids of HNP- 1. The arrow between them shows the site of factor Xa cleavage.  75  A  GST  pGEX-KP  Amp  E. coil on lac Iq S  B  H  HNP-1  I,’’.,’’’ HNP-1 Construct  S  Met  H  CEME  C CEME Construct  S  Pro  Pre  D  Met S  II  Pre Pro Cassette Figure 10: Construction of GST/cationic peptide fusion proteins. A, The pGEX-KP cloning vector. B, DNA fragment containing the HNP-1 gene which was inserted into pGEX-KP using the SphI and HiridIII sites to form pGEX-HNP-1. C, DNA fragment containing the CEME gene, preceded by a methionine codon, which was cloned into pGEX-KP using SphI and Hindill to form pGEX-CEME. D, DNA fragment encoding the mammalian defensin prepro region which was inserted into the SphI sites of both pGEX-HNP- 1 and pGEX CEME to create pGEX-proHNP- 1 and pGEX-pr0CEME respectively. GST, glutathione-S-transferase; ptac, tac promotor; Amp, 3-lactamase gene; on, origin of replication; fXa, factor Xa recognition site; S, Sphi; H, Hindu!; E, EcoRI; Met, methionine codon.  76  1234  M5  6789101112 —94 67 —43  II I —  -  —  — —  0  3O  —144  Figure 11: Production of GST/HNP-1. Whole cell lysates of DH5a(pGEX-HNP-1)(lanes 1-4), DH5cL(pGEXKP)(lanes 5-8), and DH5cc(pGEX-3X)(lanes 9-12) were electrophoresed through an 11% SDS polyacrylamide gel and stained for protein with Coomassie blue. Approximately 15 jig of protein were loaded in each lane except lane 5 and 9 (5 600 of approximately 0.5 and induced with 0.2 jig). Cells were grown to an 0D mM IPTG for: 0 h (lanes 1,5 and 9); 1 h (lanes 2,6 and 10); 2 h (lanes 3,7 and 11); or 3 h (lanes 4,8 and 12). Lane M, molecular weight standards (in kDa). Arrow, GST/HNP- 1; open circle, induced 30 kDa 13-lactamase; open square, native GST.  77  included to ensure that the genetic changes made to the vector had no negative effects on gene expression. The results showed that pGEX-3X and pGEX-KP both produced a protein with an apparent molecular weight of 26 kDa (Figure 11, lanes 6-8 and 10-12). The vector pGEX-HNP-l produced a heterologous protein of 29 kDa which migrated just below the induced f3-lactamase protein (lanes 2-4).  Maximal expression seemed to occur between 2 and 3 h.  Other  studies showed that if expression were allowed to continue, the fusion protein began to be degraded after 6 h and was no longer detectable after overnight growth (data not shown). Once stable expression had been demonstrated, the next step was to purify the fusion protein. The affinity of GST for glutathione attached to an agarose matrix was utffized as a purification technique. The scheme for such a purification (Figure 12) contained all the basic elements of affinity tag purification:  the specific binding of the desired fusion protein to the matrix  (usually from a heterogeneous population of proteins such as a cell extract), the release of this protein from the matrix by competitive displacement, the specific release of the peptide from the carrier protein, and the final purification of the peptide using a second passage over the affinity column to remove the contaminating affinity tag. In this case, a soluble cell extract from a culture induced for GST/HNP- 1 production was passed over a glutathione agarose colunm, and the fusion protein subsequently eluted using reduced glutathione (Materials and Methods, section G.1.). The results of this first stage in HNP- 1 purification are found in Figure 13. Various samples were retained throughout the purification procedure to monitor the state and location of the fusion protein. Lane 2 showed that the fusion protein was indeed being produced. The fact that lanes 3 and 4, the soluble cellular fractions before and after being incubated with glutathione  78  A Supernatant of lysed whole cells  * 101531  I  I  SD 01  wash with buffer  elute with 5 mM reduced glutathione  ca  pure fusion protein  SD  B I.— I  I. —I I  10  SD  o Factor Xa  I  I.  0  •R — 0  •  •  00 RO • • 0 — 0 O 0 —•  I• I II —.1 I — tm • I I  I  I •—I I• .11 \_ /  Vo  o%o  0 O°Oc?° 0000 9 o%O oOc  pure peptide  Figure 12: Schematic diagram of GST fusion protein affinity purification. A, Purification of the fusion protein from the soluble fraction of whole cell lysates. B, Release of the target protein by factor Xa cleavage and its purification by a second passage over the affinity matrix. Closed squares, GST; open circles, target protein.  79  12345M6 94— 67—  789  --  43—..b_=_  —  p  ——  3020.1— 14.4—  Figure 13: Affinity purification of GST/HNP-1. A culture of DH5o(pGEX-HNP-l) was induced for fusion protein production (Materials and Methods, section F.2.) and the fusion protein purified by affinity chromatography (Materials and Methods, section G. 1.). Samples were retained after various steps in the procedure and subjected to 12% SDS PAGE prior to being stained for protein with Coomassie blue. Lanes: 1, uninduced whole cell lysate; 2, induced whole cell lysate; 3, soluble fraction before incubation with glutathione agarose beads; 4, soluble fraction after incubation with glutathione agarose beads; 5, insoluble pellet fraction; 6, glutathione agarose bead-bound fraction before elution with 5 mM reduced glutathione; 7, glutathione agarose bead-bound fraction after elution with 5 mM reduced glutathione; 8, eluted fraction; 9, whole cell lysate of induced DH5x(pGEX-KP); M, molecular weight standards (in kDa). Open circle, GST/HNP-1; open square, GST. Approximate protein content in each lane: 14, 15 jig; 5, 50 jig; 6-9, 10 jig.  80  agarose beads, showed virtually no difference suggested that there was very little soluble GST/HNP- 1 in the cell. This was confirmed by the presence of a large protein band with the apparent molecular weight of GST/HNP- 1 in the insoluble pellet fraction (lane 5), which suggested that most of the fusion protein was produced as inclusion bodies (see below).  Nonetheless, some  GST/HNP- 1 was produced as soluble protein that bound to glutathione agarose beads (lane 6) and was released by competitive displacement with free glutathione (lane 8).  When samples of the protein that bound to and were  eluted from the affinity column were analyzed by SDS-PAGE, two distinct protein bands were detected (Figure 13, lanes 6-8). The migration distance of these two bands corresponded to those of GST/HNP- 1 (compare with lane 2) and GST alone (compare to lane 9), which suggested that the fusion protein was susceptible to proteolytic degradation, particularly at the fusion junction between the carrier molecule and the peptide. Different conditions throughout the purification scheme were employed in an attempt to reduce the breakdown of this fusion protein.  Neither lower temperatures nor the use of protease  inhibitors such as PMSF, TLCK, TPCK or EDTA were able to enhance the stability of the protein (data not shown).  The pGEX-HNP- 1 vector was  transformed into a number of different strains that were either mutants that prevented the expression of certain proteases or the parents of these mutant strains to investigate whether such hosts could produce stable GST/HNP- 1 fusion protein. Table VII summarizes the data from these strains with respect to protein production and stability.  Although several strains showed better  expression of the fusion protein than DH5cs, none of them, including the protease-deficient strains, were able to prevent the subsequent degradation of the fusion protein.  81  Table VII: Summary of Strains Used to Prevent Proteolytic Degradation of GST/HNP 1. Degradationb  Expressiona  Relevant Phenotype  Strain  Purified Protein  In Whole Cell Lysates DH5a  Original host used  BL21  Host for T7 RNA polymerase expression  +++  +  HMS174  Host for T7 RNA polymerase expression  ++÷  +  UT5600  ornpr  C474  Parent of C475 and C476  ++  C475  lon  ++  C476  htpR  +  —  —  weak;  ND  ND  —  ++  +  ++  ND  ND  not detected  a  very strong;  b  >70% degraded; i-i-, 30-70% degraded; +, <30% degraded; degradation detected; ND, not determined  ++,  strong;  +,  —,  ++  —  —,  no  82  As indicated above, the induction of GST/HNP- 1 expression led to the formation of insoluble inclusion bodies (Figure 13, lane 5). This phenomenon has been documented for many recombinant proteins (Kane and Hartley, 1988) and, in fact, can be useful in a purification scheme (Marston, 1986).  Since  inclusion bodies are quite resistant to mild conditions of solubilization, many proteins in a heterogeneous pellet can be removed by such treatment before the inclusion bodies are solubilized using harsher conditions.  Many different  selective solubiization conditions were tested on an inclusion body preparation of GST/HNP- 1 before a final purification scheme was established (Materials and Methods, section G. 1.).  This procedure used a lower induction temperature  (30°C), which allowed the eventual solubilization of the inclusion bodies with milder conditions (Stein and Noteborn,  1988),  and differential urea  solubiizations to obtain a pure preparation of GST/HNP- 1. Figure 14 shows that many of the contaminating proteins were removed through the procedure (lanes 2-4) and indicates the purity of the solubiized inclusion bodies (lane 5). The loss of some of the fusion protein which was either solubiized by 3 M urea (lane 4) or left in the pellet after the 8 M urea treatment (lane 6) was expected due to the heterogeneous nature of the inclusion bodies. The protein that was solubilized by the 8 M urea migrated slightly faster in SDS-PAGE (lane 5) possibly due to carbamylation which neutralizes positive charges (Stark, 1965; Marston and Hartley, 1990). This carbamylation occurred despite the use of deionized urea and the inclusion of 5 mM Tris in the solubilization buffer to minimize the amount of cyanate ions present.  83  123M456 94— 67— 43— 30— 20.1— 14.4  Figure 14: Purification of GST/HNP-1 inclusion bodies. An induced culture of DH5ci(pGEX-HNP-1) was lysed and the insoluble pellet extracted with a series of different solutions (Materials and Methods, section G. 1.). Samples were electrophoresed on a 12% SDS polyacrylamide gel and stained for protein with Coomassie blue. Lanes: 1, induced whole cell lysate; 2, soluble fraction from lysed cells; 3, soluble extract after 10 mM Tris HC1 pH 8.0, 10 mM EDTA, 1% Triton X-100 wash; 4, soluble extract after 3 M urea wash; 5, soluble extract after 8 M urea solubiization; 6, insoluble pellet after all washes and solubilizations; M, molecular weight standards (in kDa). Arrow indicates GST/HNP-1. Approximate protein content in each lane: 1-3, 15 jig; 4-5, 3 jig; 6, 50 jig.  84  D.  Factor Xa Cleavage of GST/HNP- 1.  Inclusion bodies solubilized by differential urea extraction were dialyzed against factor Xa cleavage buffer using a two step procedure (Materials and Methods, section G. 1.) to avoid the precipitation of the protein that can occur if the urea was removed too quickly.  The protein was subjected to factor Xa  cleavage using a number of different incubation temperatures and times (Figure 15). Although incubation at 4°C can be used to prevent non-specific proteolysis of the fusion protein, this condition did not result in the cleavage of any GST/HNP-1 (data not shown).  Incubation at 23°C resulted in some fusion  protein cleavage as indicated by the reduction of the GST/HNP- 1 band in lanes 3-5; however it led to very little, if any, protein corresponding to the size of HNP 1, even after long incubation times (lane 5). Increasing the temperature to 37°C improved the cleavage of the fusion protein and resulted in the appearance of a protein band of approximately 3500 daltons, the predicted molecular weight of HNP-l.  This protein band was electroblotted onto an Immobilon transfer  membrane and analyzed for its N-terminal amino acid sequence. The analysis showed that the HNP- 1 peptide was present in this band. Therefore, the HNP- 1 peptide was released from the GST/HNP- 1 fusion protein by factor Xa but only under conditions (37°C for 60 h with an enzyme to substrate ratio of 1:25; Figure 16) that are much harsher than normally required (Nagai and Thøgersen, 1984; Smith and Johnson, 1988).  The reason for this may be  because the factor Xa recognition site was inaccessible to the large (55 kDa) factor Xa molecule.  This inaccessibility may arise because of the highly  constrained and compact structure of the defensin molecule, which might appear as a bulky addition to the GST protein.  In addition, the  denaturation/renaturation step of inclusion body purification may have led to  85  12345M67 8  16.9— 14.4 8.1— 6.2” 2.5 —  Figure 15: Factor Xa cleavage of GST/HNP 1. Solubiized GST/HNP- 1 inclusion bodies were dialyzed against factor Xa cleavage buffer (Materials and Methods, section H. 1.) and subjected to factor Xa cleavage at 23°C (lanes 3-5) or 37°C (lanes 6-8). Samples were removed at 2 h (lanes 3 and 6), 6 h (lanes 4 and 7), and 24 h (lanes 5 and 8) and electrophoresed on a 12-25% gradient SDS polyaciylainide gel which was then stained for protein with Coomassie blue. Other lanes: 1, induced whole cell lysate of DH5o(pGEX-KP); 2, uncleaved, solubilized GST/HNP- 1 inclusion bodies; M, molecular weight standards (in kDa). The arrow indicates the protein band in which HNP- 1 was found. Equal volumes of the reaction mixture were loaded for lanes 2-8.  86  12  16.9 14.4— 8.1— 6.2” 2.5—  —  Figure 16: Optimal factor Xa cleavage of GST/HNP-l. Samples of solubilized GST/HNP- 1 inclusion bodies were incubated at 37°C for 60 h with (lane 2) or without (lane 1) factor Xa at an enzyme to substrate ratio of 1:25. Samples were then subjected to 12-25% gradient SDS PAGE and stained for protein with Coomassie blue. The arrows indicate the major GST cleavage products (see text). 5 jig of protein was loaded in lane 1 and 10 jig of protein was loaded in lane 2.  87  incorrect disulfide bond formation and inaccurate protein folding and thus contributed to the inaccessibility of the target cleavage site. The sequencing analysis of the 3500 dalton molecular weight band revealed the presence of another N-terminal sequence that started with Asn Lys-Lys-Phe-Glu-Leu-Gly. Upon examination of the GST amino acid sequence (Smith et al., 1986), it was discovered that this contaminating peptide corresponded to an internal peptide fragment (Figure 17), which suggested it arose from the non-specific factor Xa cleavage of GST. This suggestion was supported by the fact that this peptide sequence in GST is preceded directly by an arginine residue, which is the amino acid found at the end of the factor Xa recognition site. Further N-terminal amino acid sequence investigation of the other two major bands produced in the factor Xa digest of GST/HNP- 1 (Figure 16, lane 2, indicated by arrows), revealed that they also were proteolytic fragments of GST which corresponded to its first 42 ( 5.0 kDa) and last 145 ( 16 kDa) amino acids (Figure 17). The latter peptide, as with the 31 amino acid proteolytic fragment, was produced by cleavage of the protein after an arginine residue, which suggested that there were two sites in the GST/HNP- 1 fusion protein, other than the authentic recognition site, that were susceptible to cleavage by factor Xa. Since GST is not usually cleaved internally by factor Xa (Smith and Johnson, 1988), the possibility existed that these sites became susceptible due to improper refolding of the GST moiety during the renaturation of the GST/HNP- 1 fusion protein after inclusion body solubilization with 8 M urea. To test this hypothesis, purified GST was denatured using 8 M urea, and renatured using the same conditions as for GST/HNP- 1 (sequential dialysis against 1 M urea in 5 mM Tris-HC1 pH 8.0, and factor Xa cleavage buffer). This denatured I renatured GST was subjected to factor Xa cleavage as described for GST/HNP- 1 and analyzed by gradient SD S-PAGE (Figure 18).  The results  88  TKLILGYWKIKGLVQPTRLLLEYLEEKYEE HLYERDEGDKWRNKKFELGLEFPNLPYY IDGDVKLTQSMAIIRYIADKHNMLGGCRK ERAEISMLEGAVLDIRYGVSRIAYSKDFET LKVDFLSKLPEMLKMFEDRLCHKTYLNGD HVTHPD FMLYDALDVVLYMDPMCLDAFPK LVCFKKRIEAIPQIDKYLKSSKYIAWPLQGW QATFGGGDHPPK  Figure 17: Amino acid sequence of GST. The arrows indicate non-specific denatured/renatured GST/HNP- 1 and GST.  factor Xa cleavage sites in  89  12  34M567891011M121314  —16.9  —14.4 i_8.1 6.2 —2.5  Figure 18: Cleavage of denatured/renatured GST by factor Xa. GST that was denatured by 8 M urea then renatured (lanes 1-7), and solubiized GST/HNP- 1 inclusion bodies (lanes 8-14) were cleaved with factor Xa at 37°C using different enzyme to substrate ratios and incubation times. Samples were and electrophoresed on a 12-25% gradient SDS polyacrylamide gel which was then stained for protein with Coomassie blue. Conditions: enzyme to substrate ratio, 1:25 (lanes 2-4 and 9-11) and 1:12 (lanes 5-7 and 12-14); time, 8 h (lanes 2,5,9 and 12), 24 h (lanes 3,6,10 and 13), and 60 h (lanes 4,7,11 and 14). Other lanes: 1, uncleaved GST; 8, uncleaved GST/HNP 1; M, molecular weight standards (in kDa). Equal volumes of the GST cleavage reaction were loaded in lanes 1-7. Equal volumes of the GST/HNP-1 cleavage reaction were loaded in lanes 8-14.  90  showed that GST treated in this manner was indeed susceptible to non-specific factor Xa cleavage, yielding the three proteolytic fragments found in factor Xa digests of GST/HNP-1 (Figure 18, lanes 6 and 7, 13 and 14). The fact that the cleavage of GST was not as extensive as GST/HNP- 1 may indicate that the presence of the HNP- 1 moiety contributed to the improper refolding of the GST molecule in GST/HNP-l.  E.  The Production of GST/proHNP- 1.  Although HNP- 1 was successfully produced and released in the GST fusion protein system, further purification would have been difficult considering the small amount of peptide released and the contaminating GST fragment of identical molecular weight. The formation of GST/HNP- 1 inclusion bodies also prevented the use of affinity chromatography to purify the fusion protein, although recent studies have been able to accomplish the affinity purification of other GST fusion proteins that form inclusion bodies (Hartman et al., 1992). It is not entirely understood why some recombinant proteins form inclusion bodies while others do not (Kane and Hartley, 1988), but one hypothesis is that inclusion bodies are formed due to improper folding of protein intermediates (Mitraki and King, 1989).  Therefore, in the case of fusion proteins, any  properties of the target sequence that contribute to the misfolding of the carrier protein can be the cause of inclusion body formation. Some of the properties which could apply to HNP- 1 include a high charge density or any number of cysteine residues that could result in improper intra- and interchain disulfide bond formation. Although little could be done about incorrect disulfide bond formation, an attempt was made to minimize the effect of the high positive charge density of the HNP- 1 molecule on proper fusion protein folding. In vivo,  91  HNP1 is produced in the neutrophils as a prepro molecule (Harwig et al., 1992). The pro region of this molecule is highly negatively charged (Figure 3) and is believed to neutralize and stabilize the positively charged defensin molecule until it is properly compartmentalized into primary granules (Michailson et al., 1992) during which the pro peptide is removed and the defensin forms its native configuration. It was hypothesized that the inclusion of a prepro defensin cartridge between the GST and HNP- 1 genes might result in the stabilization of the fusion protein as well as enhance its solubility by neutralizing the positive charges on the HNP- 1 moiety.  Therefore, four  oligonucleotides (M-P, Table VI) encoding the prepro defensin sequence (Figure 3) on an SphI fragment (Figure 1OD) were synthesized, annealed and inserted into the SphI site of pGEX-HNP- 1 to form pGEX-proHNP- 1.  Proper insertion  orientation was confirmed by restriction endonuclease digestion analysis. Production of GST/proHNP- 1 was performed (Materials and Methods, sections F.2. and G. 1.) to determine if the presence of the prepro sequence prevented proteolysis of the fusion protein. The results indicated that GST/proHNP- 1 was produced in F. coli (Figure 19, lane 2).  Although some of the protein was  soluble as indicated by the difference between the soluble fraction before (lane 3) and after being incubated with glutathione agarose beads (lane 4), much of the protein was still found in the insoluble pellet as inclusion bodies (lane 5). When the soluble fusion protein was purified on glutathione agarose beads, it was again found to be proteolytically degraded (lanes 6-8) although apparently not to the same degree as GST/HNP-1 (Figure 13, lanes 6-8). It was determined from this experiment that the presence of the prepro defensin cartridge in pGEX-proHNP- 1 had a slight effect on the stability but not on the solubiuty of the fusion protein.  92  1  234M56  78  94— 67—  e.  43— J_._  0  30—  20.1— 14.4—  Figure 19: Production and affinity purification of GST/proHNP-l. A culture of DH5cc(pGEX-proHNP- 1) was induced for fusion protein production (Materials and Methods, section F.2.) and the fusion protein purified by affinity chromatography (Materials and Methods, section G. 1.). Samples were retained after various steps in the procedure and subjected to 12% SDS PAGE prior to being stained for protein with Coomassie blue. Lanes: 1, uninduced whole cell lysate; 2, induced whole cell lysate; 3, soluble fraction before incubation with glutathione agarose beads; 4, soluble fraction after incubation with glutathione agarose beads; 5, insoluble pellet fraction; 6, glutathione agarose bead-bound fraction before elution with 5 mM reduced glutathione; 7, glutathione agarose bead-bound fraction after elution with 5 mM reduced glutathione; 8, eluted fraction; M, molecular weight standards (in kDa). Open circle, GST/proHNP- 1; open square, GST. Approximate protein content in each lane: 1-5, 20 pg; 6-8, 5 g.  93  F.  The Production of GST/CEME.  The cecropin A/melittin hybrid peptide CEME was chosen for this study because it represented the x-helical (non-defensin-like) family of cationic peptides and it possessed potent antibacterial activity against P. aeruginosa (Wade et al., 1990). The hypothesis that this peptide would be less likely to form inclusion bodies in the GST fusion protein system than HNP- 1 came from the fact that it contained no cysteine residues and consequently no disulfide bonds. The gene encoding CEME was created by a two step process (Materials  and Methods, section C.2.) because of a two base pair deletion in the original gene. It should be noted that although a factor Xa cleavage site was present in  this construct, the mature CEME peptide was preceded directly by a methionine residue (Figure bC). Thus CNBr cleavage would ensure that no extra amino acids were present at its N-terminal end.  The plasmid pGEX-CEME, was  expressed in F. coli as described for both pGEX-HNP- 1 and pGEX-proHNP- 1 (Materials and Methods, section F.2.).  The samples prepared from the  production and purification of GST/CEME were run in duplicate on SDS-PAGE (Figure 20A) and one set of samples was electroblotted onto nitrocellulose for Western immunoblotting (Figure 20B). The primary antibody used to detect the fusion protein was a rabbit polyclonal serum raised against GST/CEMA (Materials and Methods, section D. 1.) As predicted, virtually all of the protein produced by this vector was found in the soluble cellular fraction (Figure 20B, lane 3) while little, if any, was detected, even with the ccGST/CEMA antibody, in the insoluble pellet fraction (Figure 20B, lane 5). As with GST/HNP-1, however, GST/CEME fusion protein was highly susceptible to proteolytic degradation. SDS-PAGE of a sample of GST/CEME that was purified using glutathione agarose beads revealed that almost all of the protein was degraded to the  94  A 1234567 94— 67— 43-  ——  30—  20.1— 14.4—  B 1  234567  94— 67— 43— 30—  20.1— 14.4—  Figure 20: Production and affinity purification of OST/CEME. A culture of DH5x(pGEX-CEME) was induced for fusion protein production (Materials and Methods, section F.2.) and the fusion protein purified by affinity chromatography (Materials and Methods, section G. 1.). Samples retained throughout the procedure were run in duplicate on an 11% SDS polyacrylamide gel and either A, stained for protein with Coomassie blue, or B, electroblotted onto nitrocellulose for Western immunoblotting. Lanes: 1, uninduced whole cell lysate; 2, induced whole cell lysate; 3, soluble fraction before incubation with glutathione agarose beads; 4, soluble fraction after incubation with glutathione agarose beads; 5, insoluble pellet fraction; 6, glutathione agarose bead-bound fraction before elution with 5 mM reduced glutathione; 7, purified GST. The primary antibody used in B was a rabbit polyclonal xGST/CEMA serum. Open circle, GST/CEME; open square, GST. Molecular weight standards are indicated in kDa. Approximate protein content in each lane: 1-4, 25 jig; 5-7, 5 jig.  95  molecular weight of GST (Figure 20A and B, lanes 6 and 7).This is in contrast to the sample of GST/HNP- 1 which showed that almost half of the purified fusion protein remained intact throughout the purification procedure (Figure 13, lanes 6-8).  G. The Production and Purification of GST/pr0CEME.  In an attempt to stabilize the GST/CEME fusion protein,  an  oligonucleotide cartridge encoding the anionic prepro defensin sequence (Figure 3) was cloned into the SphI site of pGEX-CEME to form pGEX-proCEME. This plasmid was transformed into DH5o and the gene expressed as previously described (Materials and Methods, section F.2.). Samples subjected to SDS PAGE were either stained for protein content with Coomassie blue or Western immunoblotted to detect the fusion protein (Figure 21).  Although the  GST/pr0CEME fusion protein was only weakly detected in a sample from an induced culture stained with Coomassie blue (Figure 21A, lane 2), its production was confirmed with the Western blot (Figure 21B, lane 2).  It was  interesting to note that the fusion protein in this sample was already partially degraded. The addition of the prepro sequence to this fusion protein resulted in a shift from soluble protein (very little GST/pr0CEME in lanes 3 and 4), as was the case for GST/CEME, to insoluble inclusion bodies (lane 5).  The small  amount of protein that was produced in soluble form (lane 8) was almost completely degraded to the size of GST (lane 9).  Therefore, although the  inclusion of the prepro region did not stabilize the soluble form of the fusion protein, it did result in the formation of insoluble inclusion bodies which protected the heterologous protein from extensive proteolysis.  96  A 1234  56789  94— 67— 43  —  30—  0  20.1  B 123456789 94— 67  —  43— 0  30—  —  201 144—  Figure 21: Production and purification of soluble and insoluble GST/pr0CEME. A culture of DH5cL(pGEX-proCEME) was induced for fusion protein production (Materials and Methods, section F.2.) and the fusion protein purified either by affinity chromatography or differential solubiization of the insoluble pellet fraction (Materials and Methods, section G.1.). Samples retained throughout the procedure were run in duplicate on an 11% SDS polyacrylamide gel and either A, stained for protein with Coomassie blue, or B, electroblotted onto nitrocellulose for Western irnmunoblotting. Lanes: 1, uninduced whole cell lysate; 2, induced whole cell lysate; 3, soluble fraction before incubation with glutathione agarose beads; 4, soluble fraction after incubation with glutathione agarose beads; 5, insoluble pellet fraction; 6, heated and 7, unheated samples of insoluble pellet fraction after 3% octyl -POE extraction; 8, glutathione agarose bead-bound fraction; 9, purified GST. The primary antibody used in B was a rabbit polyclonal xGST/CEMA serum. Open circle, GST/pr0CEME; open square, GST. Molecular weight standards are indicated in kDa. Approximate protein content in each lane: 1-4, 25 jig; 5-7, 15 jig; 8-9, 5 jig.  97  Since the CEME peptide had to be released from GST/proCEME using CNBr, the inclusion bodies eventually needed to be solubilized in 70% formic acid. Such conditions would solubiize most protein contained in the insoluble pellet fraction.  Therefore, a novel method of purifying the GST/proCEME  inclusion bodies was developed. The strategy in this protocol was to solubiize all the contaminating proteins, thus leaving only the inclusion bodies to be solubilized by 70% formic acid. Since outer membrane proteins are known to be the major contaminants in inclusion body preparations (Veeraragavan, 1989) the protocol used 3% 0-POE, a detergent that has been shown to solubilize such proteins (Siehnel et al., 1992).  The pellet was sequentially washed as  described in Materials and Methods, section G. 1. The selective extraction of outer membrane proteins was easily monitored by SDS-PAGE analysis of heated (100°C for 10 mm) and non-heated samples, since outer membrane proteins are  known to be heat-modifiable (Hancock and Carey, 1979). Both the heated and non-heated samples of post-3% 0-POE extraction pellets were analyzed by SDS PAGE and Western immunoblotting (Figure 2 1A and B, lanes 6 and 7). The results showed little contamination and little difference between the two samples, which indicated there were no detectable membrane protein contaminants in the pellet.  Western blots of the 3% 0-POE supernatant  samples showed that no GST/pr0CEME inclusion bodies were solubilized under these conditions (data not shown).  H. The Release of CEME From GST/pr0CEME Using CNBr.  The GST/pr0CEME inclusion bodies were solubilized in 70% formic acid and subjected to CNBr cleavage (Materials and Methods, section H.2.). Analysis of the cleavage products by AU-PAGE revealed a complex array of peptides  98  (Figure 22A, lane 1). This was expected given the fact that the inclusion body preparation was not entirely homogeneous and that the GST protein contains 8 methionine residues (Figure 17).  Nonetheless, a peptide band which  corresponded to the migration of chemically synthesized CEME was detected (Figure 22A, lane 1, arrow)  Identical samples were tested for antibacterial  activity using a gel overlay assay (Materials and Methods, section J.; Figure The results showed a zone of bacterial lysis in the CNBr-cleaved  22B).  GST/pr0CEME sample that corresponded to the zone produced by synthetic CEME. This confirmed that biologically active CEME could be produced in this system.  However further purification of this peptide from the complicated  mixture of CNBr cleavage fragments was presumed to be too difficult and potentially inefficient given the fact that the CEME band was a minor species.  I.  Summary.  Both HNP- 1 and CEME were produced as GST fusion proteins. When made as soluble proteins, they were highly susceptible to proteolytic degradation.  GST/HNP- 1 formed insoluble inclusion bodies which were  purified using differential urea solubilization.  Cleavage of this fusion protein  with factor Xa released a peptide fragment that was confirmed by N-terminal amino acid sequencing to be HNP- 1.  The inclusion of the defensin prepro  region in the fusion protein (GST/proHNP- 1) rendered it only slightly more stable than GST/HNP-1.  Compared to GST/HNP-1, GST/CEME was more  soluble but also more susceptible to proteolysis. The presence of the prepro region in GST/pr0CEME dramatically increased the stability of this fusion protein, presumably in part because it resulted in the formation of inclusion bodies.  These inclusion bodies were purified by removing contaminating  99  A  B 12  2  -  Figure 22: CNBr release of active CEME from GST/pr0CEME.  GST/pr0CEME inclusion bodies were solubiized and cleaved with CNBr (Materials and Methods, section H.2.). Samples of the CNBr digest (lane 1) and purified CEME obtained by chemical synthesis methods (lane 2) were electrophoresed in duplicate on a 15% acid urea polyacrylamide gel and either A, stained for protein with Coomassie blue, or B, tested for antibacterial activity using a gel overlay assay (Materials and Methods, section J.). Arrow indicates the CEME peptide. Approximate protein content in each lane: 1, 90 jig; 2, 10 jig.  100  proteins with 3% 0-POE, and cleaved with CNBr to release active CEME peptide, as confirmed by a gel overlay assay.  101  CHAPTER TWO: The Production of Cationic Peptides as Protein A Fusion Proteins.  A.  Introduction.  Protein A from S. aureus has a high binding affinity for the Fe portion of IgG molecules (Forsgren and Sjoquist, 1966). This property was the basis of a number of gene fusion vectors (Uhlén et al., 1983; Nilsson et al., 1985a) whose fusion proteins could be purified by IgG affinity chromatography.  Several  proteins have been produced in this system including 13-galactosidase and alkaline phosphatase (Nilsson et aL, 1985a) and human insulin growth factor (Moks et al., 1987a). This chapter describes the use of the protein A fusion protein system for producing cationic peptides. The vector pRIT5 (Figure 23A) was chosen for these studies because of its host range (it possesses both E. colt and S. aureus origins of replication) and the presence of the protein A signal sequence which directs export of the fusion protein to the periplasm when in E. colt or to the external medium when in S. aureus, and thus may serve to protect it from intracellular proteases.  B.  Construction of the Vectors.  The restriction enzyme sites available on pRIT5 were not compatible with those of the gene cartridges that encoded HNP- 1, CEME or CEMA. Rather than changing the multiple cloning site of the vector several times to create the necessary reading frames for the cationic peptide genes, the genes themselves were modified using a series of oligonucleotides (Materials and Methods, section C.3.). Figure 23A-C are schematic representations of the changes made to the genes (compare with Figure 8A-C). The genes encoding CEME and CEMA were  102  A Signal Protein A CAT  S. aureus on  E. coli on fXa S L  II_Li  B  HLH  S B Met  I  tr  CEME  CEME Construct Met B S\/s  E BE  HNP-1  HNP-1 Construct N  BN  Pro  Pre  Met S  Pre Pro Cassette  Figure 23: Construction of protein A/cationic peptide fusion proteins. A, The pRIT5 vector; B-D, DNA fragments from Figure 1OB-D encoding CEME, HNP-1 and the mammalian defensin prepro region. Their restriction endonuclease sites were altered using oligonucleotide adaptors. The genes were cloned into pRIT5 using a Sail fragment for CEME and a BamHI fragment for HNP- 1 and preproHNP- 1 (Materials and Methods, section C.3.). Protein A, truncated protein A gene of S. aureus; SS, protein A signal sequence; pPA, protein A promotor; Amp, [3-lactamase gene; CAT, chloramphenicol acetyl transferase; or, origin of replication; S, SphI; L, Sail; B, BamHI; H, Htn.dIII; N, NdeI; E, EcoRI; fXa, factor Xa recognition site; Met, methionine codon.  103  excised from pGEX-CEME-S and pGEX-CEMA--S using Sail, and inserted into the SalT site of pRIT5 to form pPA-CEME and pPA-CEMA respectively. Similarly, BamHI fragments from pGEX-HNP- 1-B and pGEX-proHNP- 1-B encoding the HNP- 1 and preproHNP- 1 genes respectively were cloned into the BamHI site of pRIT5 to form pPA-HNP- 1 and pPA-proHNP- 1.  C.  Expression of pPA-CEME in E. coiL  Fusion proteins produced by pRIT5 in E. coil are transported to the periplasm.  Both pRIT5 and pPA-CEME were transformed into DH5a and  expressed in cells grown to mid-log phase.  Samples of whole cells were  analyzed by SDS-PAGE and Western immunoblot using IgG antibody to detect the protein A moiety (Figure 24). There was no detectable difference between the pRIT5 and pPA-CEME samples (Figure 24B, lanes 1 and 2), indicating extensive degradation of the PA/CEME fusion protein. In fact, it appears as if the protein A carrier molecule itself is subject to proteolysis in E. coil (compare lanes 1 and 3). This result is not unexpected since other researchers using the same vector system to produce human IGF-I found that using E. coil as a host organism led to the production of unstable fusion protein (Nilsson et aL, 1985b; Moksetal., 1987a).  D.  Expression and Purification of Protein A/Cationic Peptide Fusion Proteins  in S. aureus.  Since no stable fusion protein was produced in the E. coil periplasm, all four plasmids, pRIT5, pPA-CEME. pPA-HNP-1, and pPA-proHNP-1, were electroporated into S. aureus (Materials and Methods, section B.4.) where the  104  A 12  B 123456  7  0  ‘a  Figure 24: Production of protein A/cationic peptide fusion proteins. Fusion proteins were produced in E. coil DH5o (lanes 1 and 2) or S. aureus RN4220 (lanes 3-6)(Materials and Methods, section F.3.). Whole cell lysates (lanes 1 and 2) and extracellular supernatants (lanes 3-6) were run in duplicate on an 11% SDS polyacrylamide gel and either A, stained for protein with Coomassie blue or B, transferred to nitrocellulose for Western 1, DH5cz(pRIT5); 2, DH5a(pPA-CEME); 3, Lanes: immunoblotting. -CEME); 5, RN4220(pPA-HNP- 1); 6, RN4220(pPA T5); 4, RN4220(pRI a 5 jig sample of PA/CEME purified on an is B7 Lane -proHNP-1). RN4220(pPA and Methods, section G.2.). Open square, (Materials column IgG Sepharose aureus protein A. Molecular weight standards S. native circle, PA/CEME; open supematants were loaded in lanes of culture volumes Equal kDa. are shown in 3-6.  105  fusion protein would be exported to the external medium. The proteins were expressed (Materials and Methods, section F.3.) and samples of culture supernatant analyzed by SDS-PAGE and Western immunoblot (Figure 24). The protein A carrier molecule and the PA/CEME fusion protein were barely visible on a Coomassie-stained polyacrylamide gel (Figure 24A, lanes 3 and 4) but PA/HNP- 1 and PA/proHNP- 1 were not detected (lanes 5 and 6). The Western immunoblot, however, clearly showed that the proteins were produced and exported with little (Figure 24B, lanes 3 and 4) or no (lanes 5 and 6) proteolytic degradation.  Once expression of the genes had been established, PA/CEME  was chosen as the fusion protein to be purified. PA/CEME was affinity purified from culture supernatants of S. aureus RN4220(pPA-CEME) on an IgG Sepharose column (Materials and Methods, section G.2.).  A sample of the  protein eluted off the column showed that only PA/CEME and native S. aureus protein A were present in the sample (Figure 24B, lane 7). These were the only  two bands present in a Coomassie-stained SDS polyacrylamide gel (data not shown).  E.  Release and Purification of CEME.  Purified PA/CEME fusion protein was pooled, lyophilized and treated with CNBr to release the CEME peptide (Materials and Methods, section H.2.). The protein A moiety of the fusion protein contains three methionine residues other than the one that precedes the CEME peptide (Uhlén et aL, 1984; Nilsson et al., 1985a), which resulted in a total of five CNBr fragments including CEME. Native protein A present in the sample contained a total of six methionine residues (Uhlén et al., 1984) which gave rise to seven fragments, four of which were different from those produced by the protein A carrier molecule (which is a  106  truncated version of native protein A).  Fortunately, all the CNBr fragments  from the protein A carrier molecule had p1 values that ranged from 3.9 to 4.7 compared to 11.3 for CEME. This difference in p1 values was evident when a sample of CNBr-cleaved PA/CEME was analyzed by AU-PAGE (Figure 25, lane D) which separates proteins on the basis of charge and size. The CEME peptide was well separated from the major contaminating protein, indicating that these differences in p1 values could be used in subsequent purification techniques. The PA/CEME CNBr digest was resuspended in 5% formic acid and fractionated on a Bio-Gel P100 column by isocratic elution with 1% acetic acid (Materials and Methods, section I.).  Protein content of the fractions was  monitored by absorbance at 280 nm (Figure 25A). A sample from every third fraction, beginning with number 27, was electrophoresed on an acid urea polyacrylamide gel (Figure 25B) which revealed that fragments from the CNBr digest eluted from the column well ahead of CEME. Fractions which contained CEME (Figure 25A, indicated by bar) were pooled and lyophilized. The final purification step was by reverse phase chromatography using a PepRPC FPLC column (Materials and Methods, section I.). If large samples were 18 to be purified, an initial purification step was performed on a larger Bio-Sil C reverse phase column which possessed a higher loading capacity but resulted in poorer resolution (data not shown). Samples from Bio-Gel P100 or Bio-Sil 18 chromatography that contained CEME were dissolved in 0.1% TFA and C applied in 1 mg quantities to the PepRPC column. Peptides were eluted from the column using a tri-phasic acetonitrile gradient (Figure 26; Materials and Methods, section I.).  Under these conditions, CEME was eluted by  approximately 44% acetonitrile as a homogeneously pure peptide that comigrated with chemically synthesized CEME on an acid urea polyacrylamide gel (Figure 26, inset). A sample of this purified CEME was electroblotted onto  107  A  C  C  —— —  —— —  — —  Figure 25: Bio-Gel P100 chromatography of CNBr-digested PA/CEME. Purified PA/CEME was cleaved with CNBr, lyophilized, resuspended and subjected to gel exclusion chromatography (Materials and Methods, section I.). A, Proffle of protein content in colunm fractions. The bar indicates the fractions that were pooled for RP-FPLC. B, 15% AU-PAGE in which every third fraction between 27 and 75 (inclusive) was analyzed and stained for protein with Coomassie blue. D, 50 ig of PA/CEME CNBr digest; C, 15 pg of synthetic CEME control; arrow, CEME. Approximately 5-10 jig from each column fraction was loaded.  108  0.4  100 90 80  0.3 70 60 C  0.2  ‘-“-I  40  C C.) “p  30 0.1 20 10 0.0  0 0  10  20  30  40  Fraction #  Figure 26: Reverse phase chromatography of CEME. Pooled fractions from Bio-Gel P100 chromatography were applied to a PepRPC HR 5/5 column and eluted with an acetonitrile gradient (Materials and Methods, section I.). Fractions were monitored for protein content and analyzed by AU-PAGE. Inset: 15% AU-PAGE showing a 5 jig sample from fraction 33 (lane 1), and 5 jig of chemically synthesized CEME (lane 2).  109  an Immobjion transfer membrane (Materials and Methods, section K. 1.) and analyzed for both amino acid content and N-terminal amino acid sequence. All the data was consistent with the amino acid sequence and content of authentic CEME.  The yield of the CEME peptide from a 60 L fermentor run of  RN4220(pPA-CEME) was not overly impressive (Table VIII). It should be noted, however, that this was the only attempt at large scale production of CEME. Although the bacterial production of cationic peptides was a goal of this study, optimization of production was not the focus, and therefore no attempt was made to improve the yield of the peptide in this system. To determine whether antibacterial activity was retained during the purification process, samples of isolated PA/CEME fusion protein, CNBr digested PA/CEME, purified CEME from the PepRPC column, chemically synthesized CEME, and melittin were subjected to AU-PAGE (Figure 27A) and tested for activity using a bacterial overlay assay using E. coli DC2 as the test organism.  Figure 27B shows that CEME produced by recombinant DNA  techniques had antibacterial activity comparable to melittin and CEME produced by chemical synthesis, while the uncleaved PA-CEME showed no activity.  F.  Purification of Other Cationic Peptides.  The CEMA peptide, which is the CEME analogue with two extra C terminal amino acids and two additional positive charges (Figure 3), was purified to homogeneity from culture supernatants of RN4220(pPA-CEMA) using the same procedure as for CEME by Dr. M. Brown. Dr. M. Brown also used a similar scheme to purify PA/HNP- 1. The fusion protein was isolated, cleaved with CNBr, and passed over a Bio-Gel P100 column. This resulted in a  110  Table VIII: Percent Yield of CEME from a 60 1 Fermentor Run.  Protein Sample  Concentration Volume Total Protein Estimated amount of (mg) (mL) (mg/mL) CEME (mg)  Yield (%)  Supernatent after 0.4 jim filtration  0.la  50000  5000  N/A  N/A  Supernatent after 1 kDa cut-off concentration  0.26a  5000  1309  N/A  N/A  After IgG  106  6  636  22.3c  100  After CNBr treatment  32  14  448  15.7C  70  After P100 gel ifitration  ioa  5  50  d 8  36  After RP-FPLC using Bio-Sil  33  1.5  5  After RP-FPLC  b 054  1.1  0.6  Sepharose purification  purification 4.5 6 O.  2.7  using PepRPC a Determined by the modified Lowry assay. b Determined by the dinitrophenylation assay. C  Estimation assuming that 50% of the protein bound to the IgG Sepharose column is native S. aureus protein A and that CEME is 7% of the PA CEME fusion protein.  d Estimation based on AU-PAGE of the sample.  111  A  B  12345  Ii —  Figure 27: Antibacterial activity of CEME. Various samples were electrophoresed in duplicate on a 15% acid urea polyacrylarnide gel and either A, stained for protein with Coomassie blue, or B, tested for antibacterial activity using a gel overlay assay (Materials and Methods, section J.). Lanes: 1, 5 jig of purified, uncleaved PA/CEME; 2, 50 jig of CNBr-cleaved PA/CEME; 3, 5 jig of purified, recombinant CEME; 4, 5 jig of chemically synthesized CEME; 5, 5 jig of melittin.  112  partially purified preparation of HNP- 1, as determined by comigration with purified HNP- 1 (a gift from M. Selsted) on AU-PAGE (data not shown).  This  partially purified HNP- 1 was also tested for antimicrobial activity using the gel overlay assay which showed that the HNP- 1 preparation had no detectable antibacterial activity. There are a few possibilities as to why this peptide did  not show any antibacterial activity in this assay. First, the assay may not be sensitive enough to detect HNP- 1 activity, in part due to the high ionic strength of the buffer in which it is performed. Second, during the production of the fusion protein, proper disulfide bond formation in HNP- 1 may not have occurred, which would result in an inactive peptide (Selsted and Harwig, 1989). It should be noted here that no attempt was made in this study to refold the disulfide bonds which may have been improperly formed throughout the purification procedure.  G.  Summary.  The protein A fusion protein system was used to produce various cationic peptides. When E. colt was used as a host organism, both the PA/CEME fusion protein and the protein A carrier molecule were extensively degraded. However, all fusion proteins produced in S. aureus showed little or no proteolysis, which indicated that export to the culture supernatant was a critical step in the formation of stable fusion proteins. CEME was purified to homogeneity using a combination of affinity, gel exclusion and reverse phase chromatographic methods.  The amino acid sequence of this peptide was confirmed and its  biological activity demonstrated using a gel overlay assay. HNP- 1 produced in the system was partially purified, but possessed no antibacterial activity.  113  CHAPTER THREE: Antimicrobial Activity of Cationic Peptides.  A.  Introduction.  The antimicrobial properties of CEME and melittin against several Grampositive and Gram-negative bacteria have been previously documented (Wade et al., 1990). These data showed that both peptides had a broad range of activity, with CEME being more active against Gram-negative bacteria and melittin being more active against Gram-positive bacteria. The key difference between these two is that melittin was lytic for erythrocytes which prohibited it from being considered as a therapeutic agent.  Many attempts have been made to  create cecropin/melittin hybrids peptides that have improved antibacterial activity but no hemolytic activity (Boman et al., 1989a; Andreu et al., 1992; Wade et al., 1992). These studies helped to define the structural requirements for antibacterial activity but did not address the actual mechanism of that activity. This chapter focuses on the use of antibacterial activity assays as a means for investigating the mechanism of action of cationic peptides, particularly with regards to the self-promoted uptake model. This was done primarily through MIC assays using various mutant strains as test organisms, and different cations as antagonists.  As well, synergy studies using other  conventional antibiotics were undertaken to provide information on the mode of the uptake of these peptides, as well as their therapeutic potential.  The  peptides used in these studies were CEME, CEMA and melittin. CEMA was of particular interest because of its two extra positive charges, since it has been shown with magainins that extending the polypeptide chain with positively charged amino acids could augment antibacterial activity (Bessalle et al., 1992).  114  B.  Killing of P. aeruginosa H187 by CEME.  The antimicrobial activity of CEME was initially quantified by a killing assay (Lehrer et al., 1983) in which 106 CFU of P. aeruginosa H187 were incubated with either 2.5 jig/mL or 5.0 jig/mL of peptide in a low ionic strength buffer (10 mM potassium phosphate, pH 7.4).  After either 20 or 60 mm,  samples of the bacteria were diluted and plated to obtain a viable count. The data was plotted as the log of CFU/mL as a function of time (Figure 28). The results showed that P. aeruginosa H187 was highly susceptible to the action of CEME, with greater than 99.9% of the bacteria killed by 2.5 ig/mL of peptide in 20 mm.  Under these conditions, CEME was able to kill P. aeruginosa more  effectively (a decrease in viability of 3.2 log orders) than the reported value for rabbit lung macrophage cationic protein 1 (2.1 log order decrease; Lehrer et al., 1983). Further incubation caused little or no decrease in viability compared to the control. This could be due to interference by bacterial components, such as LPS, released from initially lyséd cells, or it may represent a less susceptible subpopulatmon of cells.  C.  Minimum Inhibitory Concentrations.  The minimum inhibitory concentrations of CEME, CEMA and melittin were determined for a number of different organisms (Materials and Methods, section L.5.; Table IX).  Generally, CEME and CEMA had similar MIC values  which were consistently lower than those of melittin. The exception to this was S. aureus, which had an MIC value for CEME and CEMA that was equivalent to that observed for melittin. This is in agreement with data from Wade et al. (1990) who demonstrated that melittin had a lethal concentration which was  115  Time (mm)  Figure 28: Killing of P. aerugthosa H187 by recombinant CEME. P. aerugirtosa H187 (10 CFU/mL) was incubated with 0, 2.5, or 5.0 ig/mL of CEME for 20 or 60 mm before plating the bacteria out for viability counts (Materials and Methods, section L.2.). The data was plotted as the log of CFU/mL as a function of time.  116  8 8 8 4 8 8 16 8 8 8 8 8  2.8 1.4 2.8 0.7 1.4 1.4 5.6 1.4 2.8 1.4 >5.6 >5.6  4.8 1.2 2.4 0.6 1.2 1.2 2.4 0.6 2.4 2.4 9.6 9.6  2 0.03 0.5 0.06 0.12 0.5 0.25 0.25 0.5 >16 8 >16  1 0.25 1 0.5 2 4 4 2 0.5 0.5 2 >8  0.5 0.06 0.5 0.06 0.06 4 1 0.25 0.5 0.5 >8 >8  Parent of H188 Antibiotic sensitive Parent of DC2 Polymyxin sensitive Parent of SC9252 Polymyxin resistant Parent of C590 Defensin sensitive Parent of 218R1 j3-lactam resistant Methicihin sensitive  H187  H188  UB1005  DC2  SC9251  SC9252  C587  C590  218S  218R1  RN4220  SAPOO17 Methicihin resistant  a PX, polymyxin B; GM, gentamicin; CEF,ceftazidime; MEL, melittin.  S. aureus  F. cloacae  S. typhmurium  F. coli  8  2.8  2.4  1  1  0.5  Wildtype  H309  P. aeruginosa  MEL  CEMA  CEME  CEF  GM  MIC (JIg/mL)a PX  Relevant Phenotype  Strain  Bacterium  Table IX: MIC Values of Various Antimicrobial Agents.  lower than CEME for Gram-positive bacteria, but higher for Gram-negative bacteria. The MICs of the peptides were usually higher than those of polymyxin B, gentamicin (an aminoglycoside) and ceftazidime (a 3-lactam), but this difference was deceiving due to the respective molecular weights of these compounds.  For example, when the MICs for P. aeruginosa H309 were  converted to jiM, the MIC values (polymyxin B, 0.3 jiM; gentamicin, 1.0 jiM; ceftazidime, 1.8 jiM; CEME, 0.9 jiM; CEMA, 1.0 jiM; melittin, 2.8 jiM) showed that CEME and CEMA were equally, or more effective at killing this organism on  a molar basis than the often utilized anti-pseudomonal antibiotics gentamicin and ceftazidime. The MIC values of these compounds against certain mutant strains provided initial evidence regarding the uptake pathway of cationic peptides. Both antibiotic supersusceptible mutants (P. aerugtnosa Z6 1 and E. colt DC2) were two- to four-fold more sensitive to the cationic peptides (the exception being melittin against Z61) as compared to the parental strains. This increased sensitivity for E. colt DC2 can be explained by the nature of its mutation. Studies on the outer leaflet of DC2 showed that there was a marked decrease in the esterification of the LPS molecules, which rendered them more negatively charged than the parent strain (Rocque et al., 1988). This could provide the cationic peptides with an increased number of accessible sites on the LPS with which to interact, thus increasing the susceptibility of the organism to these compounds.  Strain Z61 has an outer membrane alteration resulting in  increased susceptibility to most antibiotics (Angus et al., 1982).  However,  although analysis of the Z6 1 LPS is underway, no specific conclusions as to why this organism is susceptible to cationic peptides could be made. The LPS of the polymyxin B resistance mutant SC9252, in contrast to DC2, was found to have increased esterification and consequently, fewer  118  negative charges (Peterson et al., 1987). SC9252 had increased resistance to polymyxin B which is known to interact at these sites (Schindler and Osborn, 1979).  In contrast, SC9252 showed no increased resistance to any of the  cationic peptides, despite the hypothesis that these molecules interact with negatively charged sites on the LPS. The discrepancy could be explained if the specific sites of esterification in SC9252 were not the primary sites of cationic peptide interaction.  An indication of this came from the MIC values for the  parental strain SC925 1. Against this strain, polymyxin B had an MIC that was at least 20-fold lower than the cationic peptides.  This suggested that the  negatively charged sites in SC925 1 that were esterified in SC9252 were targeted to a greater extent by polymyxin B than the cationic peptides. This site-specific interaction may reflect the accessibility of the sites to the different structures that polymyxin B and the various cationic peptides adopt in an aqueous environment. The importance of the relationship between the tertiary structure of compounds and their interaction with the outer membrane has been demonstrated by Vaara (1991) who showed that linear analogues of polymyxin B nonapeptide could not permeabiize the outer membrane. The S. typhimurtum defensin sensitive strain was an interesting organism to test, since it has a mutation in the phoP/phoQ two-component virulence regulon (Fields et al., 1989).  The PhoQ protein is a transmembrane sensor  kinase that contains an anionic domain predicted to be in the periplasmic region, and therefore it was hypothesized that in wild-type cells this domain would interact with,  and neutralize defensins (Miller et al.,  1989).  Characterization of phoP and phoQ mutants revealed that this hypothesis was incorrect and that defensin sensitivity was conferred by the lack of synthesis of PhoP-activated genes (Miller et al., 1990). The defensin sensitive mutant was two- to four-fold more susceptible to the cationic peptides than the wild-type  119  parent.  Only the MIC of ceftazidime, which is taken up across the outer  membrane by a porin-mediated pathway different from that of the peptides, remained unchanged.  These results suggested that the mutation was only  affecting the self-promoted uptake pathway, possibly at the sites of initial antibiotic contact on the surface of the cell. This conclusion, however, remains speculative since little is known about the genes that are activated by PhoP. The peptides were tested against a clinical isolate of E. cloacae (2 18S) and its f3-lactam resistant mutant (218R1, a j3-lactamase overproducer; Marchou et al., 1987). Not surprisingly, the compounds proposed to be taken up by the self-promoted uptake pathway were equally active against both of these, with ceftazidime being the only antibiotic that showed a higher MIC for the mutant. Similarly methicillin resistance in S. aureus had no apparent effect on cationic peptide susceptibifity.  D. The Effect of Cations on the MIC of Cationic Peptides.  One of the key proposals of the self-promoted uptake hypothesis is the  initial interaction between the cationic antibiotic and the negatively charged sites on the surface of the outer membrane (Hancock et al., 1981).  In cells  grown under physiological conditions, these sites are occupied by divalent 2 ions, the MIC cations. Therefore, one can envision that, in the presence of Mg values of compounds proposed to be taken up by the self-promoted uptake 2 ions competing for the negatively pathway would increase due to the Mg charged binding sites. Indeed it has been demonstrated that the presence of 5 mlvi MgC1 2 can increase the MIC of polymyxin B four-fold (Nicas and Hancock, 1980).  120  The MIC determination was repeated for strain H309 in the presence of 5 2 or 80 mlvi Na to determine whether or not the antibacterial activity of mM Mg the cationic peptides would be inhibited (Materials and Methods, section L.5.; Table X).  The results showed that the MIC of all three peptides were  2 but only minimally in the dramatically increased in the presence of Mg presence of a higher concentration of Na. Other antibiotics were also affected , albeit to a much lesser extent. 2 by the presence of Mg  The differences  2 on the MIC of cationic peptides, and polymyxin B between the effects of Mg and gentamicin (which are all proposed to be taken up via the self-promoted uptake pathway), could reflect a difference in the nature of the initial contact of these compounds with the outer membrane.  Nonetheless, this evidence was  consistent with the hypothesis that the initial step in the antibacterial mechanism of cationic peptides is an association with the negatively charged 2 binding sites on LPS molecules. Mg  E.  Synergy Studies with Cationic Peptides and Other Antibiotics.  The ability of the cationic peptides to augment the activity of different antibiotics was tested.  Previous studies have shown that some cationic  , at sub-MIC lysine o membrane permeabilizing agents such as PMBN and 2 levels, were able to increase the sensitivity of bacteria to a number of different antibiotics (Vaara and Vaara, 1983).  Therefore, MIC assays using various  antibiotics were performed in the presence of 1/2 or 1/4 MIC levels of cationic peptides to determine whether any synergy existed between them (Materials and Methods, section L.5.; Table XI). Generally the peptides had very little effect on the MIC of antibiotics that are proposed to be taken up through porins (ceftazidime, imipenem, and tetracycline), although CEMA at 1/2 MIC levels did  121  2 and Na Cations on the MICs of Cationic Peptides Table X: Effects of Mg aeruginosa H309. P. Against MIC (jig/mL)  Compound No addition  +  2 5 mM Mg  +  80 mM Na  0.5  1  0.5  Gentamicin  1  4  1  Ceftazidime  1  2  2  CEME  2.4  38.4  4.8  CEMA  2.8  22.4  5.6  8  >64  16  Polymyxin  Melittin  122  Table XI: Effects of Sub-MIC Levels of Cationic Peptides on the MICs of Common Antibiotics. MIC (jig/mL) in the presence of  Compound No peptide  CEME (ig/mL)  CEMA (jig/mL)  Meittin (jig/mL)  0.6  1.2  0.7  1.4  2  4  Polymyxin  1  0.5  0.25  0.5  0.12  0.5  0.06  Ceftazidime  4  4  4  2  2  4  2  Imipenem  4  4  4  4  2  4  4  Tetracycline  8  8  8  8  4  8  8  Novobiocin  256  256  256  256  128  256  256  Fusidic Acid  1024  1024  1024  1024  512  1024  1024  123  reduce their MICs two-fold. This phenomenon was also observed for novobiocin and fusidic acid, two antibiotics that are believed to cross the membrane via the hydrophobic uptake pathway.  Any compound possessing membrane  permeabilizing activity at sub-lethal concentrations (which included CEME and melittin) would be expected to enhance the uptake of these hydrophobic antibiotics by disrupting the outer membrane. observed.  This, however, was not  It is possible that due to the high antimicrobial activity of CEME,  concentrations of the peptide that are required to permeabilize the outer membrane to such antibiotics result in cell death and thus mask its permeabilizing activity. This has been shown for polymyxin B, which could not enhance the uptake of novobiocin or fusidic acid (Vaara and Vaara, 1983), despite evidence that it could permeabilize outer membranes at sub-lethal concentrations (this study; Hancock and Wong, 1984). In contrast, PMBN was able to augment hydrophobic antibiotic activity at sub-lethal concentrations probably because it had such a high MIC (>100 jig/mL; Vaara and Vaara, 1983). Therefore, one could test its abffity to permeabiize the outer membrane to hydrophobic antibiotics at relatively high concentrations without killing the cells. The sub-MIC levels of cationic peptides rendered strain H103 4- to 16fold more susceptible to polymyxin B (Table Xl). Given the fact that the cationic peptides and polymyxin B are both proposed to be taken up by the selfpromoted uptake pathway, these results are consistent with additive effects of the membrane permeabilizing and killing activities of these two compounds. This suggestion, however, is incomplete since melittin showed the greatest influence on the polymyxin B MIC despite having the lowest permeabilizing activity of the three peptides tested (see below). This raised the question of which compound of the two was responsible for outer membrane  124  permeabiltzation and which one was responsible for killing by the disruption of the cytoplasmic membrane. In the cases of CEME and CEMA with polymyxin B, it was considered likely that both compounds contributed equally to permeabilization and killing, since their membrane permeabilization activities (see below) and MIC values against H309 were quite similar. However, since melittin showed greater synergy with polymyxin B, it was reasonable to conclude that polymyxin B, with its stronger outer membrane disrupting abffity, was permeabilizing the outer membrane for melittin which would subsequently target the cytoplasmic membrane. This interpretation would imply that melittin was more effective once it reached its target site and that the rate limiting step in its antibacterial activity was its passage across the outer membrane.  F.  Summary.  The antimicrobial activities of CEME, CEMA, and melittin were examined to provide initial information regarding their mechanism of action.  All the  cationic peptides, especially CEME and CEMA, were shown to kill a number of different organisms at molar concentrations that were comparable to some conventional antibiotics. MIC assays performed against some mutant strains gave initial, yet unconfirmed evidence that the cationic peptides were interacting with the divalent cation binding sites on LPS molecules. This was 2 on supported by experiments that demonstrated the inhibitory effects of Mg the MIC of cationic peptides. Finally, synergy studies with the cationic peptides and various conventional antibiotics showed that with the exception of polymyxin B, the peptides were unable to substantially augment antibiotic activity.  125  CHAPTER FOUR:  Membrane Permeabilizing Activities of Cationic  Peptides.  A.  Introduction.  One of the proposed requirements for compounds taken up by the selfpromoted uptake pathway is they must be able to permeabilize the outer membrane (Hancock et al., 1981).  The outer membrane permeabilizing  activities of many different compounds have been studied (Hancock and Wong, 1984; Vaara, 1992).  With respect to cationic peptides, and defensins in  particular, there has been some disagreement as to whether or not they possess the ability to disrupt membranes.  Rabbit defensins (macrophage cationic  proteins; Sawyer et at, 1988) and human defensins (Lehrer et al., 1989) were shown to permeabiize the outer membrane as measured by the uptake of NPN or the crypticity of periplasmic f3-lactamase respectively. Viljanen et at (1988) argued that sub-lethal concentrations of human defensins could not permeabilize the outer membrane to rifampicin as measured by fractional inhibitory concentration assays. Therefore, this chapter describes experiments that were performed to determine whether or not these cationic peptides have membrane permeabilizing activity and therefore fulfill one of the requirements of the self-promoted uptake model.  B.  Lysozyme Lysis Assays.  Lysozyme is a 14 kDa basic protein that is unable to penetrate intact outer membranes, but can diffuse across ruptured membranes to exert its lytic  activity (Hancock and Wong, 1984). Because of its large size, one would expect  126  that significant destabilization of the membrane would be required in order for it to penetrate through to the peptidoglycan. The catiomc peptides were tested for their ability to facilitate the uptake of lysozyme by permeabilizing the outer membrane (Materials and Methods, section L.2.).  Briefly, the assay mixture contained prepared cells, lysozyme  (which demonstrated no lytic activity by itself) and cationic peptides at various concentrations.  Cell lysis due to the cationic peptide-enhanced uptake of  600 (Figures 29 and 30, solid lines). lysozyme was measured as a decrease in 0D The data showed that CEMA was a stronger permeabiizer for lysozyme than polymyxin B in either P. aeruginosa H309 or E. cloacae 218R1.  At low  concentrations, CEME demonstrated better activity than polymyxin B against P. aerugtnosa H309 while with E. cloacae 2 18R1, these two compounds showed  similar activities. The assays were also performed in the absence of lysozyme (Figures 29 and 30, dashed lines).  These studies revealed that CEME and  particularly melittin (P. aerugthosa data only) possessed significant lytic activity, compared to permeabiizing activity, at the concentrations tested.  In light of  this activity, melittin did not appear to be a good permeabiizer compared to the other peptides, yet it was still 5- to 10-fold better than gentamicin (Hancock et al., 1981; data not shown). These data supported earlier suggestions in this study that although melittin appeared to have difficulty penetrating the membrane barrier, it had strong lytic activity at its target site.  In contrast,  CEMA had little or no lytic activity at concentrations which resulted in extensive membrane permeabiization. Since lysozyme has been shown to bind LPS (Ohno and Morrison, 1989), it could be suggested that this binding may interfere with the interaction of the cationic peptides with LPS.  If this was a  significant factor in this assay, one might expect to see antagonism rather than a synergistic effect between lysozyme and the cationic peptides.  At low  127  0.5  0.4  0  0.3  4) 4) I.’ 4) 0.2  0.1  0.1  Compound Concentration (ug/mi) Figure 29:  Peptide-mediated lysozyme lysis of P. aeruginosa H309.  Various peptide antibiotics were tested for their ability to permeabilize the outer membrane of P. aeruginosa H309 to lysozyme (Materials and Methods, 600 as a function of section L.3.). Lysis was measured by a decrease in 0D peptide concentration.  128  0.5  0.4  0.3  0 .  C) 4) C) C)  0.2  0.1  Compound Concentration (ug/mi)  Figure 30:  Peptide-mediated lysozyme lysis of E. cloacae 218R1.  Various peptide antibiotics were tested for their ability to permeabilize the outer membrane of E. cloacae 218R1 to lysozyine (Materials and Methods, 600 as a function of section L.3.). Lysis was measured by a decrease in 0D peptide concentration.  129  concentrations, neither the cationic peptides nor lysozyme were able to lyse cells, but when used simultaneously, lysis was observed.  Therefore, it was  concluded that lysozyme either did not bind appreciably to cellular LPS or it could be readily displaced by the cationic peptides, which possess high LPS binding affinities (see below). Additional experiments demonstrated that Mg ÷ 2 concentrations as low as 1 mM were able to prevent lysozyme lysis induced by the cationic peptides. This indicated that the cationic peptides interacted with divalent cation binding sites on the LPS to initiate outer membrane permeabiization.  C.  1-N-phenylnaphthylamine Uptake Assay.  1 —N-phenylnaphthylamine (NPN) is an uncharged, fluorescent probe  that has  been  used  to  hydrophobic  study outer  membrane  permeabiization (Loh et al., 1984; Sawyer et at, 1988). When NPN is mixed  with cells, it fluoresces weakly since it is unable to breach the outer membrane permeability barrier. Upon membrane destabilization, however, it can partition into the hydrophobic environment of the membrane where it emits a bright fluorescence. One advantage of NPN is that it is uncharged and therefore is not expected to bind to anionic sites on LPS and interfere with the activity of the cationic peptides.  In addition, its small size and hydrophobicity enable it to  insert into membranes more easily and therefore may be used to detect more subtle disruptions of the outer membrane. NPN uptake assays were performed on P. aerugthosa H309 and .E. cloacae  218R1 (Materials and Methods, section L.3.). Various concentrations of cationic peptides were added to cuvettes containing cells and NPN.  The resulting  increases in fluorescence (measured in arbitrary units) were plotted as a  130  function of the compound concentration (Figures 31 and 32). For P. aeruginosa H309, CEMA and polymyxin B were found to have virtually identical membrane permeabiizing activities.  CEME and melittin also had similar activities, but  were weaker permeabiizers than CEMA and polymyxin B. These results (CEMA polymyxin B  >  CEME  melittin) were different to those obtained in the  lysozyme lysis assays (Figure 29; CEMA> CEME> polymyxin B Analysis of these data revealed that similar concentrations (0.25  -  >  melittin).  1.0 ig/mL) of  CEMA permeabilized the P. aeruginosa H309 outer membrane to lysozyme and NPN.  In contrast, the concentrations of polymyxin B which were able to  permeabiize cells to NPN, were not sufficient to permeabiize them to lysozyme. These data could be explained if polymyxin B caused more subtle membrane perturbations at low (< 1 pg/mL) concentrations and larger disruptions at higher (> 1 Ig/mL) concentrations. The similarities of CEMA activity in both assays could be explained if the peptide caused substantial perturbations at both low and high concentrations. Similar arguments could be made for CEME (cf CEMA), which showed no difference in the two assays and melittin (cf polymyxin B), which showed much lower permeabiization concentrations in the NPN assay.  Under the conditions of the NPN assay, little or no cell lysis  . 600 occurred as measured by 0D The results from NPN uptake experiments performed on E. cloacae 2 18R1 showed that the cationic peptides were able to enhance the uptake of the hydrophobic probe at concentrations similar to those in the P. aeruginosa H309 experiments. Although conclusions regarding the differences between the outer leaflets of F. cloacae 2 18R1 and P. aeruginosa H309 cannot be made, the results  do  indicate that cationic  peptide-induced  outer membrane  permeabiization is a phenomenon that is not restricted to the Pseudomonads.  131  C.) C.)  Compound Concentration (ug/mi) Figure 31: Peptide-mediated NPN uptake in P. aerugthosa H309. P. aeruginosa H309 cells were incubated with NPN in the presence of various concentrations of cationic peptide antibiotics (Materials and Methods, section L.4.). Enhanced uptake of NPN was measured by an increase in fluorescence due to the partitioning of NPN in the hydrophobic membrane. The data was plotted as arbitrary fluorescence units as a function of peptide concentration.  132  0  C.) 4) C.) 0  0.1  1  Compound Concentration (ug/mi) Figure 32: Peptide-mediated NPN uptake in E. cloacae 218R1. E. cloacae 2 18R1 cells were incubated with NPN in the presence of various concentrations of cationic peptide antibiotics (Materials and Methods, section L.4j. Enhanced uptake of NPN was measured by an increase in  fluorescence due to the partitioning of NPN in the hydrophobic membrane. The data was plotted as arbitrary fluorescence units as a function of peptide concentration.  133  D.  Dansyl Polymyxin B Displacement Assays.  Another proposal of the self-promoted uptake model is the ability of the compounds that access this pathway to bind to the divalent cation binding sites of LPS. This is proposed to promote membrane destabffization, leading to the uptake of the molecule.  The above experiments in this study provided  suggestive evidence that cationic peptides might bind to LPS to initiate their antimicrobial effects.  MIC assays on mutants with altered LPS anionicity  (Chapter 3.B.), and Mg 2 inhibition of the peptide’s antibacterial (Chapter 3.C.)  and permeabiizing (Chapter 4.B.) activities were consistent with the proposal that the sites at which the cationic peptides bind are also the ones at which 2 binds to form cross bridges between adjacent LPS molecules. Mg To further investigate this question, dansyl polymyxtn B displacement assays were performed using purified LPS or whole cells. Dansyl polymyxin B has been shown to bind LPS, resulting in enhanced fluorescence of the dansyl group (Moore et al., 1984). This property led to the development of an assay for determining the LPS-binding affinities of certain antibiotics (Materials and Methods, section L.4.c.; Moore et aL, 1986). Dansyl polymyxin B was added to a sample of LPS until approximately 90% of the binding sites were occupied as indicated by 90% of maximal fluorescence enhancement. Cationic peptides or other polycations were then titrated in and the displacement of dansyl polymyxin B monitored by the decrease in fluorescence. The results, which were plotted as the fraction of dansyl polymyxin B bound versus the compound concentration (Figure 33), indicated that all the compounds, with the exception of gentamicin, had high binding affinities for purified LPS. To quantify these affinities, the 150 value, which was the concentration of compound that resulted in 50% maximal displacement of the dansyl polymyxin B, was calculated for  134  0  I  I Compound Concentration (uM)  Figure 33: Inhibition of dansyl-polymyxin B binding to P. aerugthosa H103 LPS by various compounds. Cationic antibiotics were titrated into cuvettes containing LPS that had dansyl polymyxin B bound to it (Materials and Methods, section L.5.c.). Displacement of the dansyl polymyxin B from the LPS was measured as a decrease in fluorescence. The fraction of dansyl polymyxin B bound at a given compound concentration was calculated as l-{(maximum fluorescence fluorescence at compound concentration)/maximum fluorescence}. The data was plotted as the fraction of dansyl polymyxin B bound as a function of compound concentration. —  135  each compound (Table XII). These values were read directly from graphs such as the one in Figure 33. The values showed that CEMA had the highest affinity for purified LPS, followed closely by polymyxin B, and then CEME and melittin. To test whether these compounds bind to LPS in native outer membranes, the assay was repeated using P. aerugthosa H309 whole cells instead of purified LPS (Figure 34). It was clear from the graph that all three cationic peptides showed a slightly higher affinity for cellular LPS than polymyxin B, which was confirmed by the calculated I5 values (Table XII). In contrast only CEMA (and CEME at low concentrations) was shown to be a better permeabiizer than polymyxin B. This indicated that the initial binding affinity of the compound to the LPS and the subsequent ability to permeabiize the outer membrane are not strictly related.  Nevertheless, one must be  cautious of any conclusions drawn from these whole cell experiments because of the complexity of the system. The levels of competing divalent cations, the possible release of LPS molecules, the influence of dansyl polymyxin B which itself perturbs the permeabffity barrier, potential conformational changes in the peptides themselves, and the effects of the cationic peptides on membrane structure are all aspects that may affect the results. Nevertheless, the peptides were apparently able to bind LPS in the context of whole cells.  E.  Summary.  The membrane permeabilizing activities and LPS binding affinities of CEME, CEMA and melittin were investigated. CEMA was found to be a potent perrneabiizer of outer membranes to both lysozyme and NPN in P. aeruginosa and F. cloacae.  CEME also demonstrated strong permeabilizing activity,  although not as good as CEMA. Different results obtained in the two assays  136  Table XII: 150 Values (in jiM) for Various Compounds Against P. aerugtrtosa LPS and Whole Cells.a Compound  P. aerugiriosaHl03 LPS  P. aerugthosa H309 Whole Cells  Polymyxin  0.93 ± 0.03  0.85 ± 0.13  Gentanilcin  12.17 ± 0.58  19.0 ± 5.2  0 2 2 •6H MgC1  850 ± 132  127 ± 31  CEME  1.30 ± 0.37  0.41 ± 0.08  CEMA  0.70± 0.10  0.33 ± 0.03  Melittin  1.41 ± 0.05  0.43 ± 0.06  a Each value is the average of at least three trials ± the standard deviation.  137  ‘  0.75  C  I  I  0.5  0.25  Compound Concentration (uM) Figure 34: Inhibition of dansyl-polymyxin B binding to P. aemginosa H309 whole cells by various compounds. Cationic antibiotics were titrated into cuvettes containing whole cells that had dansyl polymyxin B bound to them (Materials and Methods, section L.5.c.). Displacement of the dansyl polymyxin B from the whole cells was measured as a decrease in fluorescence. The fraction of dansyl polymyxin B bound at a given compound concentration was calculated as l-{(maximum fluorescence fluorescence at compound concentration)/maximum fluorescence). The data was plotted as the fraction of dansyl polymyxin B bound as a function of compound concentration.  —  138  suggested there may be degrees of permeabilizing activity, with polymyxin B and melittin showing minor perturbations at low concentrations and larger disruptions at high concentrations, while CEME and CEMA showed major disruptions even at low concentrations.  Dansyl polymyxin B displacement  assays with pure LPS demonstrated that the LPS binding affinities of the compounds (CEMA> polymyxin B  >  CEME> melittin) correlated well with their  membrane permeabilizing activities as determined by the NPN uptake assay. This correlation was not maintained in dansyl polymyxin B displacement assays which used whole cells instead of purified LPS.  Nonetheless, all the cationic  peptides showed high LPS binding affinities and strong membrane permeabilizing activities, which are both required of compounds proposed to be taken up by the self-promoted uptake pathway.  139  DISCUSSION  A.  General.  This study describes the establishment of a bacterial expression system that allows the production of antimicrobial cationic peptides in bacteria.  A  number of different systems were investigated, including direct expression and the expression of fusion proteins. In the latter systems, different proteolytic cleavage methods were used to remove the carrier protein.  Various fusion  proteins required different purification techniques, and during these studies, a novel method for the purification of inclusion bodies was developed. Two ahelical peptides, CEME and CEMA, were produced as fusion proteins to S.  aureus protein A, and, after being cleaved from the affinity tag, were purified to homogeneity. These peptides were shown to be biologically active, possessing a broad host range of antibacterial activities. The peptides, together with other antibiotic controls, were also tested for their ability to permeabilize the outer membranes of Gram-negative bacteria. Overall, the data from the killing and membrane permeabilization studies indicated that cationic peptides cross the outer membrane by the self-promoted uptake pathway. This work is the first report of the successful production of an a-helical, antimicrobial peptide in bacteria. During these studies, a unique method of purifying inclusion bodies was developed.  Although many previous studies  have focused on the interaction of a-helical antimicrobial peptides with the cytoplasmic membrane, none have investigated the effects of these molecules with the outer membrane. The experiments in this thesis, therefore, represent  new information regarding the mechanism of action of antibacterial cationic peptides on Gram-negative bacteria.  140  B.  Direct Expression.  My first attempt at producing catiomc peptides in bacteria, was to clone the HNP- 1 gene into the direct expression vector pT7-5. Intuitively, it did not seem feasible to produce an antibacterial peptide directly in bacteria because of the potential for host toxicity. It was hypothesized that by exporting the peptide to the periplasm, and thus removing the peptide from any potential cytoplasmic targets, this threat could be minimized. Therefore, the signal sequence of E. coil alkaline phosphatase was included in the genetic construct to drive this export. This hypothesis was highly speculative since the mechanism of action of defensins was, at the time of these experiments, largely unknown.  In fact,  exporting the peptide to the periplasm may enhance host toxicity since defensins were subsequently shown to form ion channels in planar lipid membranes (Kagan et al., 1990). Nonetheless, the alkaline phosphatase signal sequence was included, since the export of the peptide to the periplasm had other potential advantages such as proper formation of disulfide bonds (which is necessary for defensin activity; Selsted and Harwig, 1989), an increased chance of stability and solubility, and simplification of the purification procedure. All of these advantages proved to be irrelevant since no HNP- 1 was detected in any of the expression attempts using the p17-5 system. Since translation in the p97-5 system was driven by a synthetic ribosome binding site included in the cloned fragment that encoded the alkaline phosphatase signal sequence and the HNP- 1 peptide, it was possible that it was not recognized by the E. coil translation machinery.  Therefore the alkaline  phosphatase signal sequence and the HNP- 1 gene were transferred to the p17-7 vector which contained a strong ribosome binding site that was known to function in E. coli (Tabor and Richardson, 1985). This, however, did not result  141  in the production of any HNP- 1 peptide, despite the fact that a transcript that hybridized to a portion of the HNP- 1 gene was being produced. These results could be explained by one of two scenarios. First, the peptide was not produced at all, perhaps due to a non functional translational start site. Second, and more plausible, the peptide was produced, but rapidly degraded by proteases in the cytoplasm or periplasm.  Indeed, only one report of successful direct  expression of a disulfide-containing cationic peptide has been documented, but the isolated peptide possessed no biological activity (Pang et al., 1992).  C.  Comparison of Different Fusion Protein Systems.  The initial affinity tag fusion protein system that was used in this study was that of GST.  It was chosen since it provided a quick method of fusion  protein purification by affinity chromatography and since it had a specific proteolytic cleavage site that allowed for the release of the target protein (Smith  and Johnson, 1988). As well, many fusion proteins produced by this system are soluble although some do form inclusion bodies (Smith and Johnson, 1988; Hartman et al., 1992).  When HNP- 1 was produced as a GST fusion protein  (Figure 13), two interesting observations were made. First, most of the protein was found in the insoluble pellet as inclusion bodies.  Since inclusion bodies  are believed to be formed by the aggregation of improper folding pathway intermediates (Mitraki and King, 1989), it is possible that the addition of the 30 amino acids of HNP- 1 to the GST carrier protein interfered with the proper folding of the protein, which resulted in aggregation.  On the basis of this  argument, however, one would expect that most GST fusion proteins would form inclusion bodies, due to interference by the target sequence in proper folding mechanisms. This, however, is not the case. Another explanation for  142  the formation of these aggregates is that the cysteine residues of HNP- 1 and GST formed incorrect disulfide bonds and thus obstructed the proper folding pathway of the fusion protein that normally leads to a soluble product. This latter explanation is more likely since many cysteine-containing eukaryotic peptides form inclusion bodies in E. coli (Fischer et al., 1993).  The second  observation on the expression of GST/HNP- 1 was that the small amount of soluble protein detected was degraded. The presence of a protein band in the sample of soluble, purified fusion protein that comigrated with GST, indicated that the GST moiety retained its proteolysis-resistant nature even when produced as a fusion protein.  This further implied that the soluble fusion  protein consisted of two distinct protein domains that were differentially susceptible to proteolysis. The fact that some intact fusion protein was still present, suggested that the conformation adopted by the HNP- 1 moiety was partially resistant to proteolytic degradation, or that more than one conformation was adopted by the fusion protein. An attempt was made to increase the stability and solubility of the GST/HNP- 1 protein by inserting the prepro defensin gene cartridge at the fusion joint.  The anionic prepro region is believed to stabilize the cationic  defensin peptide during its synthesis and compartmentalization in the eukaryotic host (Michailson et al., 1992). Therefore it was hypothesized that the presence of the prepro region in GST/proHNP- 1 might interact with and protect the HNP- 1 peptide from proteolytic degradation. There is evidence that the alteration of amino acid sequences in the region linking the carrier and target proteins can abolish the formation of inclusion bodies (Strandberg and Enfors, 1991). It was possible, therefore, that the inclusion of the prepro region would also enhance the solubility of the fusion protein.  The production of  GST/proHNP- 1 (Figure 19) revealed that the prepro region had no effect on the  143  solubiity of the fusion protein since it was still primarily found in the insoluble pellet.  This result showed that the structural features of HNP- 1 that  contributed to inclusion body formation were unaffected by the prepro sequence.  This indicated that the positive charge density of HNP- 1, which  might have been neutralized in GST/proHNP- 1, may not have been a contributing factor in the aggregation process. Alternatively, the prepro region may not have neutralized the positive charges on the HNP- 1 peptide.  In  contrast to the solubility of the fusion protein, the stability of the soluble protein was enhanced by the prepro region. This enhancement could reflect the different conformation adopted by the HNP- 1 peptide in response to the presence of the prepro region.  It must be emphasized that the effects on  stability applied only to the soluble protein since it appeared as though the protein contained in inclusion bodies was completely stable. The GST system was also used to produce the x—helical peptide CEME (Figure 20).  GST/CEME had different properties than GST/HNP- 1.  First, it  was found almost exclusively in the soluble fraction of lysed cells. Since CEME and HNP- 1 are similar in size and have similar charge densities, this result provided even more evidence that the cysteine residues played a key role in the formation of GST/HNP- 1 inclusion bodies. Second, while purified GST/HNP- 1 was found to be partially degraded, GST/CEME was found to be completely degraded. This extensive degradation may have been due to the structure of the CEME moiety. Since CEME has a random coil configuration in an aqueous environment (Wade et aL, 1990), it may be present as a peptide appendage protruding out from the proteolysis-resistant GST carrier protein, thus making it highly susceptible to proteolytic degradation by E. coU proteases. This is in contrast to HNP- 1, whose tight, j3-sheet structure may contribute to its partial resistance of cellular proteases.  144  Using the same logic as for GST/proHNP- 1, the prepro defensin gene cartridge was inserted into pGEX-CEME in an attempt to stabilize the soluble fusion protein.  Unlike GST/proHNP- 1, the production of GST/proCEME  (Figure 21) revealed that the prepro region had no effect on the stability of the fusion protein.  The inability of the prepro region to protect CEME from  proteolysis could be a reflection of the ultrasensitivity of the CEME peptide to cellular proteases. Part of the problem may lie in the prepro sequence itself, since it was derived from mammalian defensins. In contrast to the pro region of defensins, the cecropin A pro region is quite short and is charge neutral (Gudmundsson et al., 1991).  It is possible, therefore that a cecropin-like  peptide such as CEME is unable to interact with a defensin pro region in a way that would protect it from proteolytic degradation.  The other interesting  observation in the production of GST/pr0CEME was that it formed inclusion bodies. In an indirect way, this was an advantage since the inclusion bodies provided a source of stable GST/pr0CEME that could be purified. Nonetheless, since GST/CEME was able to fold properly into a soluble product, the prepro region must have interfered with that process in GST/pr0CEME. In contrast, the formation of GST/proHNP- 1 inclusion bodies could not be attributed directly to the presence of the pro region since the GST/HNP- 1 fusion protein already formed inclusion bodies. An interesting result was obtained when the GST fusion protein system was used to produce the CEMA peptide (data obtained by Dr. M. Brown in our laboratory). The GST/CEMA fusion protein was found to be both soluble and stable when purified on glutathione agarose beads. This is interesting when compared to CEME which differs from CEMA by three amino acids and two positive charges at the C-terminus. Taken by itself, this result suggests that  145  there are only fine lines that separate insolubility from solubility, which can determine whether a fusion protein is stable or unstable. The other affinity tag fusion protein system that was used in this study was that of protein A from S. aureus (Nilsson et at, 1985a). The vector chosen for this study was pRIT5 since it could be propagated in both E. colt and S. aureus. When E. colt was used as a host to produce PA/CEME, no stable protein was detected (Figure 24). This instability was also observed when the same vector was used to produce human IGF-I in E. colt (Nilsson et al., 1985b; Moks et al., 1987a).  Recently, shorter protein A fragments and synthetic  fragments that maintained IgG binding capabilities were used as affinity tags. Fusion protein produced in these systems have been shown to leak into the external medium when grown in E. coU (Abrahmsén et at, 1986; Moks et al., 1987b). These vectors were not used in the present study, but were no more successful when used by Dr. M. Brown in our laboratory. A number of different cationic peptides, including CEME, CEMA, and HNP- 1 were produced in S. aureus using the pRIT5 system. The peptides were exported to the culture supernatant in a stable, soluble form (Figure 24). Some degradation products were seen in samples of PA/CEME, but this has been shown to occur with other fusion protein produced by this system in S. aureus (Nilsson et al., 1985a; Moks et at, 1987a). The production of cationic peptides as fusion proteins has a number of advantages.  First, purification can be performed in a single step when the  carrier protein is an affinity tag (Sassenfeld, 1990). Second, the presence of a fusion molecule can prevent the antibacterial peptide from being active against the host organism (as was shown for PA/CEME, Figure 27).  Third, the  heterologous protein can be used to elicit an antibody response without prior conjugation to a hapten (LOwenadler et at, 1987). Fourth, the fusion partner  146  can be manipulated to improve peptide stability, as seen above in certain instances with the insertion of the defensin prepro region.  Fifth, the peptide  can be fused to the carrier molecule in such a way that it can be released by chemical or enzymatic proteolytic cleavage without leaving any extra amino acids on the N-terminus (see below).  This is important with respect to  functional studies using the peptide since it has been shown that the addition of one or more amino acids can alter its biological activity (Bessalle et al., 1992; Pangetal., 1992). The use of specific fusion protein systems provide additional advantages. The GST system had a high expression level of fusion protein, especially when used in different E. coiL hosts (Table VII). The problem with this system is its unpredictability with respect to the stability and solubility of the produced fusion protein. This is clearly unacceptable when trying to establish a general expression system that can be used for the production of many different cationic peptides. The protein A system overcomes many of these problems, primarily by exporting the fusion protein out of the cytoplasm. It has generally been shown that protein A fusion proteins directed to the external medium in either F. coli or S. aureus are both stable and soluble (Nilsson et al., 1985b; Abrahmsén et al., 1986; Moks et al., 1987b). This was not true for the cationic peptide fusion proteins in this study, since only when produced in S. aureus were the fusion proteins stable. One drawback to the protein A system is its low expression level. This is in part due to the systems promoter which is not very strong and cannot be induced.  Nonetheless, extracellular protein  accumulations of 75 ig/mL (Moks et al., 1987b) and 100 .tg/mL (this study) can be obtained. These expression levels can undoubtedly be improved upon by manipulating the type of promoter and growth conditions.  147  D. A New Strategy for Solubiizing Inclusion Bodies.  When insoluble inclusion bodies are formed, there are different methods that can be used to solubilize them (Marston, 1986; Fischer et al., 1993). Traditionally, inclusion body purification procedures consist of a series of solubiization steps that will selectively solubilize the inclusion bodies while leaving many of the contaminating proteins in the insoluble pellet.  Such  extractions often employ a chaotropic agent or detergent to denature the inclusion bodies.  There are several disadvantages associated with this  procedure. First, it can be difficult to obtain a pure sample of fusion protein since conditions required to solubilize the inclusion bodies will also bring contaminants into solution (Schoner et al., 1985; Cheng et aL, 1990). This is not a problem if the solubilized inclusion bodies are to be further purified by conventional techniques (Jayaram et al., 1989; Cheng et at, 1990).  It is,  however, a problem when the protein is to be immediately refolded and used for functional studies. In addition, if the solubffized fusion protein is to be cleaved by site-specific proteases, the denaturant must be removed carefully to avoid re-precipitation of the protein (Stein, 1990; Claassen et al., 1991). Second, the solubilization procedure is protein specific and can even vary for a single protein depending on the growth conditions under which the inclusion bodies are formed (Stein, 1989).  Therefore, the solubilization conditions for each  protein must be empirically determined. Third, due to the heterogeneity of the inclusion body composition, a single solubiization condition will not necessarily dissolve all of the inclusion bodies (Schoner et al., 1985). This was the case for the solubiization procedure of GST/HNP- 1 inclusion bodies which resulted in the loss of significant amounts of the protein (Figure 14). Fourth, due to the  148  harsh conditions necessary to solubilize the inclusion bodies, the fusion protein may be irreversibly modified (Marston and Hartley, 1990). Theoretically, another method of purifying inclusion bodies would be to solubilize preferentially all the contaminating proteins in the insoluble pellet prior to solubilizing the inclusion bodies. To date, there has been no report of such an approach, possibly because the washing conditions used in the past either solubilize the inclusion bodies, or do not selectively remove the contaminating proteins.  This problem was observed with urea in the  solubiization of GST/HNP- 1. In this study, a novel solubiization scheme was developed for GST/pr0CEME inclusion bodies based on the observation that the major contaminating proteins in inclusion bodies are outer membrane proteins (Veeraragavan, 1989). The initial washes with Triton X- 100, Tris-HC1 pH 8.0,  and EDTA remained the same as those described for the GST/HNP- 1 inclusion bodies. The novel extraction used 3% 0-POE, a detergent known to solubilize outer membrane proteins (Siehnel et al., 1992). Analysis of the supernatants and pellets after these extractions revealed that not only were the contaminating proteins removed completely, but the 3% 0-POE did not solubilize any of the fusion protein (determined by Western immunoblotting, Figure 21). This procedure resulted in a preparation of GST/pr0CEME protein that had only minor amounts of contaminating proteins. This method could be applied to any inclusion body preparation, regardless of how they are eventually to be solubilized.  For those preparations of fusion proteins that are to be  proteolytically cleaved by chemical methods such as CNBr, the inclusion bodies  can be solubiized directly in 70% formic acid since the preparation is relatively pure. One of the key advantages of this solubiization protocol is that it avoids the loss of fusion protein through premature solubifization.  149  E.  Comparison of Fusion Protein Cleavage Methods.  In many instances, a purified fusion protein must be specifically cleaved to release the target protein of interest. Two different cleavage methods were used in the study, one enzymatic (factor Xa) and one chemical (CNBr). Solubiized GST/HNP- 1 inclusion bodies were cleaved with factor Xa to release HNP- 1 without any extra N-terminal amino acids (Figure 15).  The  release of HNP- 1 by factor Xa at 4°C did not occur, even though factor Xa has been shown to be active at this temperature (Ellinger et al., 1989).  Even at  temperatures as high as 37°C, the reaction required 60 h and an enzyme to substrate ratio of 1:25 to cleave the protein. Conditions similar to these have been shown to be necessary for other fusion proteins (Nambiar et al., 1987; Baldwin and Schultz, 1989), but in other cases, the conditions were much milder (Nagai and Thøgersen, 1984; Ellinger et al., 1989). This suggests that the accessibility of the cleavage site varies between fusion proteins, and that this may have contributed to the inefficient cleavage of GST/HNP- 1. Furthermore, it may have been the aggregation of the fusion partner and the peptide that was preventing the factor Xa enzyme from reaching its target sequence.  In addition to the inefficiency of the reaction, some non-specific  cleavage of the fusion protein occurred (Figure 16).  Although the factor Xa  cleavage site has a consensus sequence of Ile-Glu-Gly-Arg, there have been reports of other sequences at which cleavage can occur (Carter, 1990; Greenwood, 1993). In all of these examples, the cleavage site was on the C terminal side of an arginine residue. The proteolytic cleavage of GST/HNP- 1 resulted in three distinct peptide products.  Upon further analysis, it was  discovered that these peptide fragments corresponded to internal fragments of GST.  Based on N-terminal amino acid sequence analysis, it was determined  150  that the cleavages giving rise to these fragments occurred after specific arginine residues.  The four amino acid residue sequences preceding these cleavage  sites, Asp-Lys-Trp-Arg and Ala-lie-lie-Mg, had not previously been reported as factor Xa recognition sites (Carter, 1990; Greenwood, 1993). In GST that had been previously denatured and renatured, these same two sites were susceptible to factor Xa cleavage (Figure 18), suggesting that these internal sites were made accessible to factor Xa as a consequence of the inability of GST to refold properly under these conditions. It is interesting to note that there are many other arginine residues in the GST amino acid sequence that were not cleaved to any large extent by factor Xa, indicating that even the non-specific” cleavage was not random.  Due to the inefficient and the expensive nature of  the factor Xa cleavage reaction, this was not the method of choice for the production of large quantities of cationic proteins.  Furthermore, the biggest  advantage of enzymatic cleavage, namely its high specificity, could not be utffized in the purification of HNP-1 from GST/HNP-1. The gene encoding CEME was preceded directly by a methionine codon which enabled the release of the peptide from a fusion protein by CNBr cleavage. Biologically active CEME was released from both GST/proCEME and PA/CEME fusion proteins (Figures 22 and 27).  The major disadvantage of  using CNBr on large fusion proteins is the generation of other peptide fragments due to the presence of methionine residues in the carrier molecule. Unlike the recognition site for factor Xa, the methionine residues are rarely inaccessible since CNBr is a small chemical molecule and the reaction is carried out in conditions under which most proteins are denatured. This problem was evident in both fusion protein systems since GST (Smith et al., 1986) and protein A (Uhién et al., 1984; Nilsson et al., 1985a) both contain several methionine residues. The difficulty of purifying the target protein from a CNBr  151  digest depends on the size and p1 of the various peptide fragments produced by the reaction.  In the GST/pr0CEME digest, such peptide fragments made  further purification of the cationic peptide impractical.  In contrast, all the  contaminating peptide fragments in the PA/CEME digest could be separated from CEME by gel exclusion and reverse phase chromatographies. Since this cleavage method is both inexpensive and efficient, it can be used in a large scale process, as described for PA/CEME.  F.  Do Cationic Peptides Cross the Outer Membrane via the Self-Promoted  Uptake Pathway?  The self-promoted uptake model was originally proposed as a mechanism of uptake for polycationic antibiotics such as polymyxin B and gentamicin (Hancock, 1984). It has been shown that peptides of the defensin family were able to bind LPS (Sawyer et al., 1988) and permeabilize outer membranes of various bacteria (Sawyer et al., 1988; Lehrer et al., 1989), two activities that are observed for compounds proposed to cross the outer membrane via this pathway.  The hypothesis that cationic peptides are taken up via the self-  promoted uptake pathway was strengthened by the fact that several different cationic peptides such as defensins (Sawyer et al., 1988), magainins (Rana et al., 1990) and melittin (David et al., 1992) are able to interact directly with LPS. Furthermore, the ability to permeabilize outer membranes has been demonstrated for various defensins (Sawyer et al., 1988; Lehrer et al., 1989) as well as bactenicins (Skerlavaj et al., 1990).  There have been, however, no  studies to elucidate the interaction of cecropins and melittin with the outer membrane, despite their documented Gram-negative bactericidal activity (Wade et al., 1990). Therefore, this study set out to obtain evidence to support the  152  hypothesis that these cationic peptide antibiotics cross the outer membrane permeability barrier by promoting their own uptake. The self-promoted uptake of a compound is proposed to be initiated by its interaction with the negatively charged sites on LPS molecules that are normally occupied by Mg ÷ ions which form stabilizing cross bridges between 2 adjacent LPS molecules. Using dansyl polymyxin B as a probe, the LPS binding capabilities of CEME, CEMA and melittin were examined and compared to those of other cations including polymyxin B, which has been shown to bind very tightly to LPS (Moore et at, 1986). Indeed the cationic peptides all showed high binding affinities for pure LPS (Figure 33) or LPS in the context of the whole cell environment (Figure 34).  The calculated 150 values even showed that with  whole cells, all the cationic peptides could displace dansyl polymyxin B more readily than polymyxin B. This, however, may not reflect the affinities of the compounds for LPS per se, but rather the accessibility of the sites to the different compounds. For instance, since the a-helical peptides consist mainly of random coil in an aqueous environment, they may more easily penetrate a slightly perturbed membrane (due to the bound dansyl polymyxin B) than polymyxin B, which has a constrained, cyclic structure.  Regardless, these  experiments clearly demonstrated the ability of these peptides to bind LPS. These studies also provided evidence that the peptides were binding to the divalent cation binding sites on the LPS.  First, dansyl polymyxin B that  was displaced from LPS by the cationic peptides could also be displaced by , which was consistent with a common binding site for all of these 2 Mg 2 in MIC assays rendered the bacteria compounds. Second, the presence of Mg more resistant to the action of cationic peptides (Table X, presumably due to its saturation of divalent cation binding sites and the resulting stabilization of the outer membrane. Third, the ability of the cationic peptides to permeabiize the  153  outer membrane to compounds such as lysozyme was inhibited by Mg ÷. 2 Taken together, these data suggest that the initial interaction of cationic peptides with Gram-negative bacteria occurs at the divalent cation binding sites on the LPS. In the self-promoted uptake model, the binding of cationic compounds to the LPS is proposed to accompany a localized destabilization of the outer membrane. It has been shown in this study that CEME, CEMA and melittJn all have the ability to permeabiize the outer membrane of P. aerugthosa and E.  cloacae to lysozyme and NPN (Figures 29-32). In fact, under some conditions CEMA and CEME are better permeabilizers that polymyxin B, whose potent outer membrane disrupting ability has been well documented (Vaara, 1992). This permeabilization of the outer membrane, although necessary for selfpromoted uptake, is not sufficient. The molecule must be able to dissociate from the LPS to which it is bound and move through the disrupted outer membrane into the periplasm. This may occur as a result of changes in the structure of LPS or the peptide itself, once the outer membrane has been destabilized.  It is very difficult to examine the nature of such post-  destabilization events, but some indirect evidence is available which supports the hypothesis that these peptides are, in fact, taken up. First, studies have shown that defensins (Lehrer et al., 1989) and bactenicins (Skerlavaj et al., 1990) sequentially permeabiize outer and inner membranes.  Second, many  peptides have been shown to form ion channels in planar lipid membranes (Hanke et al., 1983; Christensen et al., 1988; Kagan et al., 1990) which led to the hypothesis that the disruption of cytoplasnitc membrane integrity was the cause of cell death (Christensen et al., 1988; Lehrer et al., 1989). Third, studies on the interaction of melittin with lipid A revealed that when bound to LPS, melittin had no hemolytic activity (David et al., 1992).  This suggested that  154  melittin must be released from the LPS before it can exert its bactericidal activity, and therefore it must be taken up into the periplasm.  These data,  together with the findings that CEME, CEMA and melittin caused outer membrane permeabiization at concentrations that are not bacteriolytic, suggest that the disruption of the outer membrane is not sufficient to kill Gramnegative bacteria, and that killing requires both uptake and further action of the peptides. The evidence provided in this thesis strongly implies that these cationic peptides are taken up by self-promoted uptake. Self-promoted uptake involves certain basic steps that all compounds taken up by this pathway are thought to go through.  This thesis provides  evidence that different compounds proceed through these steps in various ways.  For example, CEME and CEMA showed different permeabilizing  properties when compared to polymyxin B and melittin. It seems reasonable that a more profound disruption of the outer membrane would be required to permeabilize it to lysozyme (a 14 kDa protein) than to NPN (a small hydrophobic chemical). While all four compounds, at low concentrations, enabled NPN to enter the membrane environment (Figure 31), only CEME and CEMA could promote the uptake of lysozyme at those same concentrations (Figure 29). Polymyxin B and melittin, on the other hand, required higher concentrations for this, suggesting that they could only induce major outer membrane disruptions at high concentrations. While this may not be surprising for polymyxin B, given its different secondary structure, it is for melittin, since it has a similar secondary structure to CEME and CEMA.  The only difference in secondary  structure that the latter two peptides may have compared to melittin, is an additional hinge region, but this has not been confirmed and therefore remains speculative.  It is also interesting to note that the concentrations of melittin  required to permeabiize the outer membrane to lysozyme, were only slightly  155  lower than those that lysed cells (Figure 29). This implies that the rate-limiting step in the bactericidal mechanism of melittin was its ability to cross the outer membrane permeability barrier. This has also been suggested for polymyxin B (Vaara and Vaara, 1983) as well as human (Viljanen et al., 1988) and rabbit (Sawyer et al., 1988) defensins. In contrast, CEMA was able to permeabiize the membrane to lysozyme at concentrations >10-fold lower than its MIC, demonstrating that it could breach the permeability barrier relatively easily, but could not kill cells unless a sufficient concentration accumulated in the periplasm. Therefore, while all these cationic compounds are proposed to be taken up by the self-promoted uptake pathway, differences exist in their interactions with the outer membrane.  G.  Cationic Peptides As Therapeutic Agents.  Cationic peptides have been referred to as “natural peptide antibiotics”, reflecting their broad range of antimicrobial activity.  Work in the last few  decades has focused on isolating and characterizing dozens of different peptides in an effort to understand how they function. As this understanding increases, a logical extension of this work is to begin to develop them as therapeutic agents that can be used to combat various infectious diseases. One property common to many of the cationic peptides that prevents them from being used as antibiotics, is their cytolytic activity against mammalian cells. Melittin has been shown to have potent hemolytic activity (Habermann and Jentsch, 1967; Wade et al., 1990), and defensins demonstrate a broad range of cytotoxicity against mammalian cells (Lehrer et at, 1993). In an attempt to identify structural regions within proteins that are responsible for cytolytic activity, Kini and Evans (1989) compared the sequences of over 30  156  cytolysins. They concluded that a cationic site flanked by a hydrophobic region was a common feature to all these proteins. This conclusion, however, remains too general to aid in the design of antibiotic peptides without cytolytic activity. More helpful have been the studies in which analogues of various peptides have been synthesized that maintain high antibacterial activity but do not possess hemolytic activity (Boman et al., 1989a; Wade et al., 1990; Andreu et aL, 1992; Bessalle et al., 1992; Wade et at, 1992). Another problem that these peptides may encounter is proteolytic degradation inside the host. One potential solution to this problem is to make D-enantiomers of the peptides which would increase their resistance to host  proteases resulting in a longer in vivo half-life. It has already been shown that D-forms of certain antibacterial peptides are as biologically active as their naturally occurring L-form counterparts (Wade et al., 1990). One drawback to this solution is that the D-forms of the peptides could not be produced in a bacterial expression system.  Other solutions could include the alteration of  flanking amino acids, which can influence proteolysis, or the encapsultion of the peptide in either liposomes or polymers to protect it during delivery. An alternative solution to the problem of peptide degradation would be to concentrate on the 13-sheet, disulfide bond-containing peptides, since their tightly packed tertiary structure renders them quite resistant to proteolytic degradation (Fujll et at, 1993). Another aspect that must be addressed before the peptides can be used as therapeutic agents is their size. There are a number of reasons why it is of interest to develop peptides that are smaller.  First, the marketing of the  peptides would be enhanced if their molecular weight was in the range of other conventional antibiotics. For example, CEMA, with a molecular weight of 2800 daltons, is almost double that of polymyxin B. Second, a smaller peptide may  157  have improved solubility properties, which could have ramifications for delivery and bioavailabiity in clinical trials. Third, when creating analogues of a certain  peptide in order to improve it, the task is significantly simplified by starting with a shorter parent peptide. Therefore, one of the challenges of designing these compounds would be to decrease the size of the peptides without compromising antimicrobial activity. Andreu et al. (1992) investigated how many C-terminal amino acids could be deleted from CEME without affecting the bactericidal activity. They managed to bring the length of the peptide down to 18 amino acids (from 26) with no significant loss of antibacterial activity or increase in hemolytic activity and suggested that this was possible because the flexible hinge region between the two x-helices was retained.  When the  deletions brought the peptide down to 15 amino acids, there was a marked increase in the lethal concentration against certain bacteria. It was suggested that this hinge containing pentadecapeptide no longer had the ability to span the apolar portion of the membrane and form ion channels (Andreu et al., 1992). The antibacterial activity of other 15 mers that did not have the flexible hinge region was almost as good as the 18 and 20 mers. This suggested that either, (1) the peptide formed a 3 rn CL-helix that was able to span the membrane, (2) the peptide associated as multimers that were able to span the membrane, or (3) these short peptides have a mechanism of action that has not yet been adequately described (Andreu et al., 1992; Wade et aL, 1992).  It remains  abundantly clear that reducing these peptides to a therapeutically useful size cannot be done by indiscriminately deleting residues from an active peptide without considering the structural ramifications. Another focus of future research may be to design peptides with improved specific activity (LPS binding, membrane permeabilization, channel formation), which could be used in conjunction with conventional antibiotics.  158  An example of this is PMBN, which is not antibacterial (MIC >1 OOjig/mL), but possesses potent membrane permeabilizing activity that can increase the sensitivity of various Gram-negative bacteria to different antibiotics (Vaara, 1992). This thesis has described a CEME variant, CEMA, which has a 2-5-fold increase in permeabiizing activity as compared to CEME. Synergy studies with CEMA and hydrophobic antibiotics showed that the peptide was unable to enhance bacterial susceptibility to these antibiotics. This could be because the MIC of CEMA is relatively low and since concentrations required to open the membrane to hydrophobic antibiotics would kill the cell, the permeabilizing effect would be masked. This phenomenon has previously been documented for polymyxin B (Vaara and Vaara, 1983).  It would be interesting to create  shortened CEMA analogues and examine whether they can retain the membrane permeabilization activity of CEMA regardless of the effects on antibacterial activity. By doing this, it may be possible to derive a peptide that is short enough to use as a therapeutic, and yet still be useful in conjunction  with other antibiotics. Indeed, there is a precedent for in vitro synergy between cationic peptides and conventional antibiotics. Darveau et aL (1991) found that sub-inhibitory concentrations of f3-lactam antibiotics such as cefepime were able to potentiate the activity of magainin-2 (or vica versa) against E. coil in vitro  and in an in vivo mouse model.  Magainins have also been shown to have a  synergistic effect with erythromycin on P. aeruginosa (MacDonald et al., 1991). In light of such studies it seems very possible that the next few decades will see the emergence of cationic peptides as boni fide therapeutic agents.  159  REFERENCES  Abrahmsén, L., T. Moks, B. Nilsson and M. Uhlén. 1986. Secretion of heterologous gene products to the culture medium of Escherichia coiL Nuci. Acids Res. 14: 7487-7500. Amsterdam, D. 1991. Susceptibility testing of antimicrobials in liquid media. In ‘Antibiotics in Laboratory Medicine”, V. Lorian (ed.). Williams and Wilkins, Baltimore, 72-78. Andersons, D., A. Engstrom, S. Josephson, L. Hansson and H. Steiner. 1991. Biologically active and amidated cecropin produced in a baculovirus expression system from a fusion construct containing the antibodybinding part of protein A. Biochem. J. 280: 219-224. Andreu, D., J. Ubach, A. Boman, B. Wählin, D. Wade, R.B. Merrifield and H.G. Boman. 1992. Shortened cecropin A-melittin hybrids. Significant size reduction retains potent antibiotic activity. FEBS Lett. 296: 190-194. Angus, B.L., A.M. Carey, D.A. Caron, A.M.B. Kropinski and R.E.W. Hancock. 1982. Outer membrane permeability in Pseudomonas aeruginosa: Comparison of a wild type with an antibiotic supersusceptible mutant. Antimicrob. Agents Chemother. 21: 299-309. Anzai, K., M. Hamasuna, H. Kadono, S. Lee, H. Aoyagi and Y. Kirino. 1991. Formation of ion channels in planar lipid bilayer membranes by synthetic basic peptides. Biochim. Biophys. Acta 1064: 256-266. Atkinson, T. and M. Smith. 1984. Purification of oligonucleotides obtained by small scale (0.2 iimol) automated synthesis by gel electrophoresis. In “Oligonucleotide Synthesis: A Practical Approach”, M.J. Gait (ed.). IRL Press, Oxford, 35-81. Ausubel, F.M., R. Brent, R.E. Kingston, D.D. Moore, J.G. Seidman, J.A. Smith and K. Struhi. 1987. Current Protocols in Molecular Biology. Greene Publishing Associates and Wiley-Interscience, New York, New York. Bader, J. and M. Teuber. 1973. Binding action of polymyxin B on bacterial membranes to the 0-antigenic lipopolysaccharide of Salmonella typhimurturn. Z. Naturforsch. Teil C. 28: 422-430. Baldwin, E. and P.G. Schultz. 1989. Generation of a catalytic antibody by sitedirected mutagenesis. Science 245: 1104-1107. Bell, A., M. Baths and R.E.W. Hancock. 1991. Outer membrane protein OprH of Pseudomonas aeruginosa: Expression from the cloned gene and function in ethylenediaminetetraacetate resistance. J. Bacteriol. 173: 4970-4976. Bessalle, R., H. Haas, A. Goria, I. Shalit and M. Fridkin. 1992. Augmentation of the antibacterial activity of magainin by positive-charge chain extension. Antiniicrob. Agents Chemother. 36: 313-317.  160  Blondelle, SE. and R.A. Houghten. 1991. Hemolytic and antimicrobial activities of the twenty-four individual omission analogues of melittin. Biochem. 30: 4671-4678. Blondelle, SE. and R.A. Houghten. 1992. Design of model amphipathic peptides having potent antimicrobial activities. Biochem. 31: 1268812694. Boman, H.G. and D. Huitmark. 1987. Cell-free immunity in insects. Ann. Rev. Microbiol. 41: 103-126. Boman, H.G., D. Wade, l.A. Boman, B. Wãhlin and R.B. Merrifield. 1989a. Antibacterial and antimalarial properties of peptides that are cecropin melittin hybrids. FEBS Lett. 259: 103-106. Boman, H.C., l.A. Boman, D. Andreu, Z.Q. Li, R.B. Merrifield, G. Schlenstedt and R. Zimmermann. 1989b. Chemical synthesis and enzymatic processing of precursor forms of cecropins A and B. J. Biol. Chem. 264: 5852-5860. Boman, H.G., I. Faye, G.H. Gudmundsson, J.-Y. Lee and D.-A. Lidhoim. 1991. Cell-free immunity in Cecropia. A model system for antibacterial proteins. Eur. J. Biochem. 201: 23-31. Boman, H.G., B. Agerberth and A. Boman. 1993. Mechanisms of action on EscherichLa coiL of cecropin P1 and PR-39, two antibacterial peptides from pig intestine. Infect. Immun. 61: 2978-2984. Borenstein, L.A., M.E. Selsted, R.I. Lehrer and J.N. Miller. 1991. Antimicrobial activity of rabbit leukocyte defensins against Treponema pallidum subsp. pallidum. Infect. Immun. 59: 1368-1377. Bryan, L.E. 1979. Resistance to antimicrobial agents: The general nature of the problem and the basis of resistance. In “Pseudomonas aeruginosa: Clinical Manifestations of Infection and Current Therapy”, R.G. Doggett (ed.). Academic Press, New York, 2 19-270. Carter, P. 1990. Site-specific proteolysis of fusion proteins. In “Protein Purification: From Molecular Mechanisms to Large-Scale Processes” ACS Symposium Series No. 427, M.R. Ladisch et al. (eds.). American Chemical Society, Washington, D.C., 181-193. Casteels, P., C. Ampe, F. Jacobs, M. Vaeck and P. Tempst. 1989. Apidaecins: antibacterial peptides from honeybees. EMBO J. 8: 2387-2391. Casteels, P., C. Ampe, F. Jacobs and P. Tempst. 1993. Functional and chemical characterization of hymenoptaecirt, an antibacterial polypeptide that is infection-inducible in the honeybee (Apis mellifera). J. Biol. Chem. 268: 7044-7054. Chen, H.C., J.H. Brown, J.L. Morell and C.M. Huang. 1988. Synthetic magainin analogues with improved antimicrobial activity. FEBS Lett. 236: 462-466.  161  Cheng, Y.E., D. Kwoh, T.J. Kwoh, B.C. Soltvedt and D. Zipser. 1981. Stabilization of a degradable protein by its overexpression in Escherichia coiL Gene 14: 121-130. Cheng, Y.E., M.H. McGowan, C.A. Kettner, J.V. Schloss, S. Erickson-Viitanen and F.H. Yin. 1990. High-level synthesis of recombinant HIV- 1 protease and the recovery of active enzyme from inclusion bodies. Gene 87: 243248. Christensen, B., J. Fink, R.B. Merrifield and D. Mauzerall. 1988. Channelforming properties of cecropins and related model compounds incorporated into planar lipid membranes. Proc. Natl. Acad. Sci. USA 85: 5072-5076. Chung, C.T., S.L. Niemela and R.H. Miller. 1989. One-step preparation of competent Escherlchia coiL transformation and storage of bacterial cells in the same solution. Proc. Natl. Acad. Sci. USA 86: 2172-2175. Claassen, L.A., B. Ahn, H.-S. Koo and L. Grossman. 1991. Construction of deletion mutants of the Escherichia coil UvrA protein and their purification from inclusion bodies. J. Biol. Chem. 266: 11380-11387. Compagnone-Post, P., U. Malyankar and S.A. Khan. 1991. Role of host factors in the regulation of the enterotoxin B gene. J. Bacteriol. 173: 18271830. Couto, M.A., S.S.L. Harwig, J.S. Cullor, J.P. Hughes and R.I. Lehrer. 1992. Identification of eNAP-1, an antimicrobial peptide from equine neutrophils. Infect. Immun. 60: 3065-307 1. Cronan, J.E., R.B. Gennes and S.R. Maloy. 1987. Cytoplasmic membrane. In “Escherichia coil and Salmonella typhlmurium: Cellular and Molecular Biology”, F.C. Neidhardt (ed.). ASM Publications, Washington, D.C., 3155. Daher, K.A., R.I. Lehrer, T. Ganz and M. Kronenberg. 1988. Isolation and characterization of human defensin cDNA clones. Proc. Nail. Acad. Sd. USA 85: 7327-7331. Dahlman, K., P.-E. Strömstedt, C. Rae, H. Jörnvall, J.-I. Flock, J. Carlstedt Duke and J.-A. Gustafsson. 1989. High level expression in Escherichia coil of the DNA-binding domain of the glucocorticoid receptor in a functional form utilizing domain-specific cleavage of a fusion protein. J. Biol. Chem. 264: 804-809. Darveau, R.P. and R.E.W. Hancock. 1983. Procedure for isolation of bacterial lipopolysaccharides from both smooth and rough Pseudomortas aeruginosa and Salmonella typhimurlum strains. J. Bacteriol. 155: 831838. Darveau, R.P., M.D. Cunningham, C.L. Seachord, L. Cassiano-Clough, W.L. Cosand, J. Blake and C.S. Watkins. 1991. 13-lactam antibiotics  162  potentiate magainin 2 antimicrobial activity in vitro and in vivo. Antimicrob. Agents Chemother. 35: 1153-1159. David, S.A., V.1. Mathan and P. Balaram. 1992. Interaction of melittin with endotoxic lipid A. Biochim. Biophys. Acta 1123: 269-274. DeGrado, W.F., G.F. Musso, M. Lieber, E.T. Kaiser and F.J. Kezdy. 1982. Kinetics and mechanism of hemolysis induced by melittin and by a synthetic melittin analogue. Biophys. J. 37: 329-338. Dempsey, C.E. 1990. The actions of melittin on membranes. Biophys. Acta 1031: 143-161.  Biochim.  Deutscher, M.P. 1990. Maintaining protein stability. In “Guide to Protein Purification”, M.P. Deutscher (ed.). Academic Press, San Diego, 83-89. Dimarcq, J.-L., E. Keppi, B. Dunbar, J. Lambert, J.-M. Reichhart, D. Hoffmann, S.M. Rankine, J.E. Fothergill and J.A. Hoffmann. 1988. Insect immunity. Purification and characterization of a family of novel inducible antibacterial proteins from immunized larvae of the dipteran Phormia terrartovae and complete amino-acid sequence of the predominant member, diptericin A. Eur. J. Biochem. 171: 17-22. Doring, G., M. Maier, E. Muller, Z. Bibi, B. TümmLer and A. Kharazmi. 1987. Virulence factors of Pseuclomonas aeruginosa. In “Basic Research and Clinical Aspects of Pseudomonas aeruginosa”, G. Döring, l.A. Holder and K. Botzenhart (eds.). Karger, Basel, Switzerland, 136-148. Donaldson, L. and J.P. Capone. 1992. Purification and characterization of the carboxyl-terminal transactivation domain of Vmw65 from herpes simplex virus type 1. J. Biol. Chem. 267: 1411-1414. Durell, S.R., G. Raghunathan and H.R. Guy. 1992. Modeling the ion channel structure of cecropin. Biophys. J. 63: 1623-163 1. Eisenhauer, P.B., S.S. Harwig, D. Szklarek, T. Ganz, M.E. Selsted and R.I. Lehrer. 1989. Purification and antimicrobial properties of three defensins from rat neutrophils. Infect. Immun. 57: 2021-2027. Cryptdins: Eisenhauer, P.B., S.S.L. Harwig and R.I. Lehrer. 1992. antimicrobial defensins of the small intestine. Infect. Immun. 60: 35563565. Elish, M.E., J.R. Pierce and C.F. Earhart. 1988. Biochemical analysis of spontaeous fepA mutants of Escherichia coli. J. Gen. Microbiol. 134: 1355-1364. Ellinger, S., R. Glockshuber, G. Jahn and A. Plückthun. 1989. Cleavage of procaryotically expressed human immunodeficiency virus fusion proteins by factor Xa and application in western blot (immunoblot) assays. J. Clin. Microbiol. 27: 97 1-976.  163  Fields, P.1., E.A. Groisman and F. Heffron. 1989. A Salmonella locus that controls resistance to microbicidal proteins from phagocytic cells. Science 243: 1059-1062. Fink, J., A. Boman, H.G. Boman and R.B. Merrifield. 1989. Design, synthesis and antibacterial activity of cecropin-like model peptides. Internat. J. Peptide Prot. Res. 33: 412-421. Fischer, B., I. Sumner and P. Goodenough. 1993. Isolation, renaturation, and formation of disulfide bonds of eukaryotic proteins expressed in Eschertchia colt as inclusion bodies. Biotech. Bioeng. 41: 3-13. Fletcher, J.E. and M.-S. Jiang. 1993. Possible mechanisms of action of cobra snake venom cardiotoxins and bee venom melittin. Toxicon 31: 669695. Forsgren, A. and J. Sjoquist. 1966. “Protein A” from S. aureus. Pseudoimmune reaction with human y-globulin. J. Immunol. 97: 822-827. Frank, R.W., R. Gennaro, K. Schneider, M. Przybylski and D. Romeo. 1990. Amino acid sequences of two proline-rich bactenecins. J. Biol. Chem. 265: 18871-18874. Frorath, B., C.C. Abney, H. Berthold, M. Scanariril and W. Northemann. 1992. Production of recombinant rat interleukin-6 in Eschertchta colt using a novel highly efficient expression vector pGEX-3T. BioTechniques 12: 558-563. Fujll, G., M.E. Selsted and D. Eisenberg. 1993. Defensins promote fusion and lysis of negatively charged membranes. Protein Science 2: 1301-1312. Ganz, T., M.E. Selsted, D. Szklarek, S.S. Harwig, K. Daher, D.F. Bainton and R.I. Lehrer. 1985. Defensins. Natural peptide antibiotics of human neutrophils. J. Clin. Invest. 76: 1427-35.  Ganz, T., J.A. Metcalf, J.I. Gallin, L.A. Boxer and R.I. Lehrer. 1988. Microbicidal/cytotoxic proteins of neutrophils are deficient in two disorders: Chediak-Higashi syndrome and “specific” granule deficiency. J. Clin. Invest. 82: 552-556. Ganz, T., M.E. Selsted and R.I. Lehrer. 1990. Defensins. Eur. J. Haematol. 44: 1-8. Gearing, D.P., N.A. Nicola, D. R.L. Williams. 1989. Escherichta colt by a embryonic stem cells in  Metcalf, S. Foote, T.A. Willson, N.M. Gough and Production of leukemia inhibitory factor in novel procedure and its use in maintaining culture. Bio/Technol. 7: 1157-1161.  Germino, J. and D. Bastia. 1984. Rapid purification of a cloned gene product by genetic fusion and site-specific proteolysis. Biotechnol. Lett. 10: 377382.  164  Goff, S.A., L.P. Casson and A.L. Goldberg. 1984. Heat shock regulatory gene htpR influences rates of protein degradation and expression of the ion gene in Escherichia coiL Proc. Nati. Acad. Sci. USA 81: 6647-6651. Greenwood, J.M. 1993. Use of the cellulose-binding domain of a cellulase from Celluiomortas fimi for affinity purification of fusion proteins. Ph.D., University of British Columbia. Gudmundsson, G.H., D.A. Lidhoim, B. Asling, R. Gan and H.G. Boman. 1991. The cecropin locus. Cloning and expression of a gene cluster encoding three antibacterial peptides in Hyaiophora cecropia. J. Biol. Chem. 266: 11510-11517. Habermann, E. and J. Jentsch. 1967. Sequenzanalyse des Melittins aus den tryptischen und peptischen Spaltstucken. Hoppe Seyler’s Z. Physiol. Chem. 348: 37-50. Hanahan, D. 1983. Studies on transformation of Escherlchia coil with plasmids. J. Mol. Biol. 166: 557-580. Hancock, R.E.W. 1984. Alterations in outer membrane permeability. Ann. Rev. Microbiol. 38: 237-264. Hancock, R.E.W. and A.M. Carey. 1979. Outer membrane of Pseudomonas aeruginosa. Heat- and 2-mercaptoethanol-modifiable proteins. J. Bacteriol. 140: 902-9 10. Hancock, R.E.W. and P.G.W. Wong. 1984. Compounds which increase the permeability of the Pseudomonas aeruglnosa outer membrane. Antirnicrob. Agents Chemother. 26: 48-52. Hancock, R.E.W. and A. Bell. 1989. Antibiotic uptake into Gram-negative bacteria. In “Perspectives in Anti-Infective Therapy”, G.G. Jackson, H.D. Schiumberger and H.J. Zefler (eds.). Vieweg and Sohn, Braungshweig, 21-28. Hancock, R.E.W., V.J. Raffle and T.I. Nicas. 1981. Involvement of the outer membrane in gentamicin and streptomycin uptake and killing in Pseudomonas aeruglnosa. Antimicrob. Agents Chemother. 19: 777-785. Hancock, R.E.W., R. Siehnel and N. Martin. 1990. Outer membrane proteins of Pseudomonas. Mol. Microbiol. 4: 1069-1075. Hanke, W., C. Methfessel, H.-U. Wilmsen, E. Katz, G. Jung and G. Boheim. 1983. Melittin and a chemically modified trichotoxin form alamethicin type multi-state pores. Biochim. Biophys. Acta 727: 108-114. Harlow, E. and D. Lane. 1988. Antibodies. A Laboratory Manual. Cold Spring Harbor Laboratory Press, Cold Spring Harbor, New York. Hartman, J., P. Daram, R.A. Frizzell, T. Rado, D.J. Benos and E.J. Sorscher. 1992. Affinity purification of insoluble recombinant fusion proteins containing glutathione-S-transferase. Biotech. Bioeng. 39: 828-832.  165  Harwig, S.S., A.S. Park and R.I. Lehrer. 1992. Characterization of defensin precursors in mature human neutrophils. Blood 79: 1532-1537. Hellers, M., H. Gunne and H. Steiner. 1991. Expression of post-translational processing of preprocecropin A using a baculovirus vector. Eur. J. Biochem. 199: 435-439. Hider, R.C., F. Khader and A.S. Tatham. 1983. LyUc activity of monomeric and oligomeric melittin. Biochim. Biophys. Acta 728: 206-214. Hill, C.P., J. Yee, M.E. Seisted and D. Eisenberg. 1991. Crystal structure of defensin HNP-3, an amphiphilic dimer: mechanisms of membrane permeabiization. Science 251: 1481-1485. Hobot, J.A., E. Carlemaim, W. Villiger and E. Kellenberger. 1984. Periplasmic gel: new concept resulting from the reinvestigation of bacterial cell envelope ultrastructure by new methods. J. Bacteriol. 160: 143-152. Hochuli, E., W. Bannwarth, H. Döbeli, R. Gentz and D. Stüber. 1988. Genetic approach to facilitate purification of recombinant proteins with a novel metal chelate adsorbent. Bio/Technol. 6: 1321-1325. Hoffmann, J.A. and C. Hetru. 1990. Insect defensins: inducible antibacterial peptides. Immunol. Today 13: 411-415. Holak, T.A., A. Engstrom, P.J. Kraulis, G. Lindeberg, H. Bennich, T.A. Jones, A.M. Gronenborn and G.M. Clore. 1988. The solution conformation of the antibacterial peptide cecropin A: a nuclear magnetic resonance and dynamical simulated annealing study. Biochem. 27: 7620-7629. Hopp, T.P., K.S. Prickett, V.L. Price, R.T. Libby, C.J. March, D.P. Cerretti, D.L. Urdal and P.J. Conlon. 1988. A short polypeptide marker sequence useful for recombinant protein identification and purification. Bio/Technol. 6: 1204-1210. Hultmark, D. 1993. Immune reactions in Drosophila and other insects: model for innate immunity. Trends Genet. 9: 178-183.  a  Huitmark, D., H. Steiner, T. Rasmuson and H.G. Boman. 1980. Insect immunity. Purification and properties of three inducible bactericidal proteins from hemolymph of immunized pupae of Hyalophora cecropia.. Eur. J. Biochem. 106: 7-16. Huitmark, D., A. Engstrom, H. Bennich, R. Kapur and H.G. Boman. 1982. Insect immunity: isolation and structure of cecropin D and four minor antibacterial components from cecropia pupae. Eur. J. Biochem. 127: 207-217. Hultmark, D., A. Engstrom, K. Andersson, H. Steiner, H. Bennich and H.G. Boman. 1983. Insect immunity: Attacins, a family of antibacterial proteins from Hyalophora cecropia. EMBO J. 2: 57 1-576.  166  Itakura, K., T. Hirose, R. Crea and A.D. Riggs. 1977. Expression in Escherlchia coil of a chemically synthesized gene for the hormone somatostatin. Science 198: 1056-1063. Jayaram, B., R. Devos, Y. Guisez and W. F’iers. 1989. Purification of human interleukin-4 produced in Escherichia coiL Gene 79: 345-354. Kagan, B.L., M.E. Seisted, T. Ganz and R.I. Lehrer. 1990. Antimicrobial defensin peptides form voltage-dependent ion-permeable channels in planar lipid bilayer membranes. Proc. Nati. Acad. Sci. USA 87: 210214. Kane, J.F. and D.L. Hartley. 1988. Formation of recombinant protein inclusion bodies in Escherlchia coiL Trends Biotechnol. 6: 95-101. Karunaratne, D.N., J.C. Richards and R.E.W. Hancock. 1992. Characterization of lipid A from Pseudomonas aeruginosa 0-antigenic B band lipopolysaccharide by 1D and 2D NMR and mass spectral analysis. Arch. Biochem. Biophys. 299: 368-376. Kini, R.M. and H.J. Evans. 1989. A common cytolytic region in myotoxins, hemolysins, cardiotoxins and antibacterial peptides. Internat. J. Peptide Prot. Res. 34: 277-286. The isolation and Knott, J.A., C.A. Sullivan and A. Weston. 1988. characterization of human atrial natriuretic factor produced as a fusion protein in Escherlchia coiL Eur. J. Biochem. 174: 405-4 10. Koland, J.G., K.M. O’Brien and R.A. Cerione. 1990. Expression of epidermal growth factor receptor sequences as E. coil fusion proteins: applications in the study of tyrosine kinase function. Biochem. Biophys. Res. Commun. 166: 90-100. Kreiswirth, B.N., S. Lofdahl, M.J. Betley, M. O’Reilly, P.M. Schlievert, M.S. Bergdoll and R.P. Novick. 1983. The toxic shock syndrome exotoxin structural gene is not detectably transmitted by a prophage. Nature 305: 709-712. Kropinski, A.M., B. Jewell, J. Kuzio, F. Milazzo and D. Berry. 1985. Structure and functions of Pseudomorias aerugiriosa lipopolysaccharide. In “Pseudomonas aeruginosa: New Therapeutic Approaches from Basic Research”, D.P. Speert and R.E.W. Hancock (eds.). Karger, Basel, Switzerland, 58-73. Lambert, J., E. Keppi, J.-L. Dimarcq, C. Wicker, J.-M. Reichhart, B. Dunbar, P. Lepage, A. Van Dorsselaer, J. Hoffmann, J. Fothergill and D. Hoffmann. 1989. Insect immunity: isolation from immune blood of the dipteran Phormia terrartovae of two insect antibacterial peptides with sequence homology to rabbit lung macrophage bactericidal peptides. Proc. Natl. Acad. Sci. USA 86: 262-266. Lee, J.—Y., A. Boman, C.X. Sun, M. Andersson, H. Jörnvall, V. Mutt and H.G. Boman. 1989. Antibacterial peptides from pig intestine: isolation of a mammalian cecropin. Proc. Nati. Acad. Sci. USA 86: 9159-9162. 167  Lehrer, RI., M.E. Seisted, D. Szklarek and J. Fleishmann. 1983. Antibacterial activity of microbicidal cationic proteins 1 and 2, natural peptide antibiotics of rabbit lung macrophages. Infect. Immun. 42: 10-14. Lehrer, R.I., K. Daher, T. Ganz and M.E. Selsted. 1985. Direct inactivation of viruses by MCP-1 and MCP-2, natural peptide antibiotics from rabbit leukocytes. J. Virol. 54: 467-472. Lehrer, R.I., A. Barton, K.A. Daher, S.S. Harwig, T. Ganz and M.E. Seisted. 1989. Interaction of human defensins with Escherichia coiL Mechanism of bactericidal activity. J. Clin. Invest. 84: 553-56 1. Lehrer, R.I., T. Ganz and M.E. Seisted. 1990. Defensins: antibiotics from neutrophils. ASM News 56: 315-318.  natural peptide  Lehrer, R.I., A.K. Lichtenstein and T. Ganz. 1993. Defensins: antimicrobial and cytotoxic peptides of mammalian cells. Ann. Rev. Immunol. 11: 105-128. Leive, L. 1965. Release of lipopolysaccharide by EDTA treatment of Escherichia coiL Biochem. Biophys. Res. Commun. 21: 290-296. Lepage, P., F. Bitsch, D. Roecklin, E. Keppi, J.-L. Dimarcq, J.-M. Reichhart, J.A. Hoffmann, C. Roitsch and D.A. Van. 1991. Determination of disulfide bridges in natural and recombinant insect defensin A. Eur. J. Biochem. 196: 735-742. Lindahl, L. and J.M. Zengel. 1979. Operon-specific regulation of ribosomal protein synthesis in Escherichia coiL Proc. Natl. Acad. Sci. USA 76: 6542-6546. LOfdahl, S., B. Guss, M. Uhlén, L. Phiipson and M. Lindberg. 1983. Gene for staphylococcal protein A. Proc. Nati. Acad. Sd. USA 80: 697-701. Loh, B., C. Grant and R.E.W. Hancock. 1984. Use of the fluorescent probe 1-Nphenylnaphthylamine to study the interactions of aminoglycoside antibiotics with the outer membrane of Pseudomortas aerugiriosa. Antimicrob. Agents Chemother. 26: 546-55 1. Löwenadler, B., B. Jansson, S. Paleus, E. Holmgren, B. Nilsson, T. Moks, G. Palm, S. Josephson, L. Phiipson and M. Uhién. 1987. A gene fusion system for generating antibodies against short peptides. Gene 58: 8797. Mäkelä, P.H., M. Sarvas, S. Calcagno and K. Lounatmaa. 1978. Isolation and characterization of polymyxin resistant mutants of Salmonella. FEMS Microbiol. Lett. 3: 323-326. MacDonald, D.L., C.J. Messier, W.L. Maloy and L.S. Jacob. 1991. Synergistic combination of magainins and erythromycin on Pseudomonas aeruginosa. Program Abstr. 31st Intersci. Conf. Antimicrob. Agents Chemother., abstr. 422.  168  Mama, C.V., P.D. Riggs, A.G. Grandea III, B.E. Slatko, L.S. Moran, J.A. Tagliamonte, L.A. McReynolds and C. di Guan. 1988. An Escherichta coIl vector to express and purify foreign proteins by fusion to and separation from maltose-binding protein. Gene 74: 365-373. Marchou, B., F. Bellido, R. Charnas, C. Lucain and J.-C. Pechère. 1987. Contribution of 13-lactamase hydrolysis and outer membrane permeability to ceftriaxone resistance in Enterobacter cloacae. Antimicrob. Agents Chemother. 31: 1589-1595. Maroux, S., J. Baratti and P. Desnuelle. 1971: Purification and specificity of porcine enterokinase. J. Biol. Chem. 246: 503 1-5039. Marston, F.A.O. 1986. The purification of eukaryotic polypeptides synthesized in Escherichia colt Biochem. J. 240: 1-12. Marston, F.A.O. and D.L. Hartley. 1990. Solubiization of protein aggregates. In “Guide to Protein Purification”, M.P. Deutscher (ed.). Academic Press, San Diego, 264-276. Matsuyama, K. and S. Natori. 1988. Purification of three antibacterial proteins from the culture medium of NIH-Sape-4, an embryonic cell line of Sarcophagaperegrina. J. Biol. Chem. 263: 17112-17116. Menéndez-Ariau, L., M. Young and S. Oroszlan. 1992. Purification and characterization of the mouse mammary tumor virus protease expressed in Escherlchia colt J. Biol. Chem. 267: 24134-24 139. Meyers, E., W.L. Parker and W.E. Brown. 1974. EM49: A new polypeptide antibiotic active against cell membranes. Ann. New York Acad. Sci. 235: 493-501. Michailson, D., J. Rayner, M. Couto and T. Ganz. 1992. Cationic defensins arise from charge-neutralized propeptides: a mechanism for avoiding leukocyte autocytotoxicity? J. Leuk. Biol. 51: 634-639. Miller, C., E. Moczydlowski, R. Latorre and M. Phffips. 1985. Charybdotoxin, a +activated K channels from mammalian 2 protein thhibitor of single Ca skeletal muscle. Nature 313: 316-318. Miller, S.I., A.M. Kukral and J.J. Mekalanos. 1989. A two-component regulatory system (phoP phoQ) controls Salmonella typhimurium virulence. Proc. Natl. Acad. Sci. USA 86: 5054-5058. Miller, S.I., W.S. Pulkkinen, M.E. Selsted and J.J. Mekalanos. 1990. Characterization of defensin resistance phenotypes associated with mutations in the phoP virulence regulon of Salmonella typhimurium. Infect. Immun. 58: 3706-37 10. Mitraki, A. and J. King. 1989. Protein folding intermediates and inclusion body formation. Bio/Technol. 7: 690-696.  169  Mizuno, T. 1979. A novel peptidoglycan-associated lipoprotein found in the cell envelope of Pseudomonas aeruginosa and Escherlchia coil. J. Biochem. 86: 991-1000. Mizuno, T. and M. Kageyama. 1979. Isolation and characterization of major outer membrane proteins of Pseudomonas aeruginosa strain PAO with special reference to peptidoglycan-associated protein. J. Biochem. 86: 979-989. Moks, T., L. Abrahmsén, E. Homgren, M. Bilich, A. Olsson, M. Uhlén, G. Pohi, C. Sterky, H. Hultberg, S. Josephson, A. Holmgren, H. Jornvall and B. Nilsson. 1 987a. Expression of human insulin-like growth factor I in bacteria: use of optimized gene fusion vectors to facilitate protein purification. Biochem. 26: 5239-5244. Moks, T., L. Abrahmsén, B. Osterlof, S. Josephson, M. Ostling, S. Enfors, I. Persson, B. Nilsson and M. Uhlén. 1987b. Large-scale affinity purification of human insulin-like growth factor I from culture medium of Escherlchia coiL Bio/Technol. 5: 379-382. Monaco, L., H.M. Bond, K.E. Howell and R. Cortese. 1987. A recombinant apoA- 1-protein A hybrid reproduces the binding parameters of HDL to is receptor. EMBO J. 6: 3253-3260. Moore, R.A., L. Chan and R.E.W. Hancock. 1984. Evidence for two distinct mechanisms of resistance to poiymyxin B in Pseudomonas aeruginosa. Antimicrob. Agents Chemother. 26: 539-545. Moore, R.A., N.e. Bates and R.E.W. Hancock. 1986. Interaction of polycationic antibiotics with Pseudomortas aeruginosa lipopolysaccharide and lipid A studied by using dansyl-polymyxin. Antimicrob. Agents Chemother. 29: 496-500. Mutharia, L.M. and R.E.W. Hancock. 1983. Surface localization of Pseudomonas aeruginosa outer membrane porin protein F using monoclonal antibodies. Infect. Immun. 42: 1027-1033. Nagai, K. and H.C. Thøgersen. 1984. Generation of 3-globulin by sequencespecific proteolysis of a hybrid protein produced in Escherichia coli. Nature 309: 8 10-812. Synthesis and sequence-specific Nagai, K. and H.C. Thøgersen. 1987. proteolysis of hybrid proteins produced in Escherichta coil. Meth. Enzymol. 153: 461-481. Nagal, K., H.C. Thøgersen and B.F. Luisi. 1988. Refolding and crystallographic studies of eukaryotic protein produced in Escherichia coil. Biochem. Soc. Trans. 16: 108-110. Nambiar, K.P., J. Stackhouse, S.R. Presnell and S.A. Benner. 1987. Expression of bovine pancreatic ribonuclease A in Escherlchia coil. Eur. J. Biochem. 163: 67-71.  170  Nicas, T.I. and R.E.W. Hancock. 1980. Outer membrane protein Hi of Pseudomorias aerugin.osa : Involvement in adaptive and mutational resistance to ethylenediaminetetraacetate, polymyxin B and gentamicin. J. Bacteriol. 143: 872-878. Nicas, T.I. and R.E.W. Hancock. 1983a. Alteration of susceptibility to EDTA, polymyxin B and gentamicin in Pseudomonas aerugirtosa by divalent cation regulation of outer membrane protein Hi. J. Gen. Microbiol. 129: 509-517. Nicas, T.I. and R.E.W. Hancock. i983b. Pseudornonas aerugthosa outer membrane permeability: isolation of a porin protein F-deficient mutant. J. Bacteriol. 153: 281-285. Nicas, T.I. and B.H. Iglewski. 1985. The contribution of exoproducts to virulence of Pseudomonas aeruginosa.. Can. J. Microbiol. 31: 387-392. Nikaido, H. and M. Vaara. 1985. Molecular basis of bacterial outer membrane permeability. Microbiol. Rev. 49: 1-32. Nikaido, H. and R.E.W. Hancock. 1986. Outer membrane permeability of Pseudomonas aeruginosa. In “The Bacteria”, J.R. Sokatch (ed.). Academic Press, New York, 145-193. Nilsson, B. and L. Abrahmsén. 1990. Meth. Enzymol. 185: 144-161.  Fusions to staphylococcal protein A.  Immobilization and Nilsson, B., L. Abrahmsén and M. Uhlén. i985a. purification of enzymes with staphylococcal protein A gene fusion vectors. EMBO J. 4: 1075-1080. Nilsson, B., E. Holmgren, S. Josephson, S. Gatenbeck, L. Philipson and M. Uhlén. 1985b. Efficient secretion and purification of human insulin-like growth factor I with a gene fusion vector in Staphylococci. Nucl. Acids Res. 13: 1151-1162. Nilsson, B., T. Moks, B. Jansson, L. Abrahmsén, A. Elmblad, E. Holmgren, C. Henrichson, T.A. Jones and M. Uhlén. 1987. A synthetic IgG-binding based on staphylococcal protein A. Prot. Eng. 1: 107-i 13. Ohno, N. and D.C. Morrison. 1989. Lipopolysaccharide interaction with lysozyme. Binding of lipopolysaccharide to lysozyme and inhibition of lysozyme enzymatic activity. J. Biol. Chem. 264: 4434-4441. Okada, M. and S. Natori. 1983. Purification and characterization of an antibacterial protein from hemolymph of Sarcophaga peregrina (flesh-fly) larvae. Biochem. J. 211: 727-734. Oliver, D.B. 1987. Periplasm and protein secretion. In “Escherichia coil and Salmonella typhimuriunt Cellular and Molecular Biology”, F.C. Neidhardt (ed.). ASM Publications, Washington, D.C., 56-69.  171  Olsen, E. and S.S. Mohapatra. 1992. Expression and thrombin cleavage of Poa pIX recombinant allergens fused to glutathione-S-transferase. Internat. Arch. Allergy Immunol. 98: 343-348. Ong, E., N.R. Gilkes, R.A.J. Warren, R.C. Miller and D.G. Kilburn. 1989. Enzyme immobilization using the cellulose-binding domain of a CeUulomonasflmi exoglucanase. Bio/Technol. 7: 604-607. Otoda, K., S. Kimura and Y. Imanishi. 1992. Interaction of melittin derivatives with lipid bilayer membrane. Role of basic residues at the C-tenninal and their replacement with lactose. Biochim. Biophys. Acta 1112: 1-6. Pang, S.-Z., S.M. D.H. Dean, encoding a Gene 116:  Oberhaus, J.L. Rasmussen, D.C. Knipple, J.R. Bloomquist, K.D. Bowman and J.C. Sanford. 1992. Expression of a gene scorpion insectotoxin peptide in yeast, bacteria and plants. 165-172.  Panyim, S. and R. Chalkey. 1969. High resolution acrylamide gel electrophoresis of histones. Arch. Biochem. Biophys. 130: 337-346. Pardi, A., D.R. Hare, M.E. Selsted, R.D. Morrison, D.A. Bassolino and A.2. Bach. 1988. Solution structures of the rabbit neutrophil defensin NP-S. J. Mol. Biol. 201: 625-636. Park, C.-S., S.F. Hausdorif and C. Miller. 1991. Design, synthesis, and functional expression of a gene for charybdotoxin, a peptide blocker of K channels. Proc. Nati. Acad. Sci. USA 88: 2046-2050. Park, J.T. 1987. The murein sacculus. In “Escherichia coiL and Salmonella typhLmuriurit Cellular and Molecular Biology”, F.C. Neidhardt (ed.). ASM Publications, Washington, D.C., 23-30. Peterson, A.A., S.W. Fesik and E.J. McGroarty. 1987. Decreased binding of antibiotics to lipopolysaccharides from polymyxin-resistant strains of Escherichia coIl and Salmonella typhtmurium. Antimicrob. Agents Chemother. 31: 230-237. Pier, G.B., R.B. Markham and D. Eardley. 1981. Correlation of the biological responses of C3H/HEJ mice to endotoxin with the chemical and structural properties of the lipopolysaccharides from Pseudomonas aemginosa and Escherlchia colL J. Immunol. 127: 184-191. Pollack, M. 1990. Pseudomonas aeruginosa. In “Principles and Practice of Infectious Diseases”, G.L. Mandell, R.G. Douglas and J.E. Bennett (eds.). Churchill Livingstone, New York, 1673-169 1. Rana, F.R., C.M. Sultany and J. Blazyk. 1990. Interactions between Salmonella typhimurlum lipopolysaceharide and the antimicrobial peptide, magainin 2 amide. FEBS Lett. 261: 464-467. Rao, A.G., T. Rood, J. Maddox and J. Duvick. 1992. Synthesis and defensin Internat. Peptide Prot. Res. 40: characterization of NP-i. J. 507-514.  172  Redfern, C.P.F’. and K.E. Wilson. 1993. Ligand binding properties of human cellular retinoic acid binding protein II expressed in F. coil as a glutathione-S-transferase fusion protein. FEBS Lett. 321: 163-168. Reichhart, J.-M., I. Petit, M. Legrain, J.-L. Dimarcq, E. Keppi, J.-P. Lecocq, J.A. Hoffmann, and T. Achstetter. 1992. Expression and secretion in yeast of active insect defensin, an inducible antibacterial peptide from the fleshfly Phormia terranovae. Invert. Reproduct. Devel. 21: 15-24. Rice, W.G., T. Ganz, J.J. Kinkade, M.E. Selsted, R.I. Lehrer and R.T. ParmLey. 1987. Defensin-rich dense granules of human neutrophils. Blood 70: 757-765. Richmond, M.G., D.C. Clark and S. Wotton. 1976. Indirect method for assessing the penetration of beta-lactamase-nonsusceptible penicihins and cephalosporins in Escherichia coil strains. Antimicrob. Agents Chemother. 10: 215-218. Rivera, M., L.E. Bryan, R.E.W. Hancock and E.J. McGroarty. 1988a. Heterogeneity of lipopolysaccharides from Pseudomonas aerugirtosa: analysis of lipopolysaccharide chain length. J. Bacteriol. 170: 512-521. Rivera, M., R.E.W. Hancock, J.G. Sawyer, A. Haug and E.J. McGroarty. 1988b. Enhanced binding of polycationic antibiotics to lipopolysaccharide from an aminoglycoside-supersusceptible, tolA mutant strain of Pseudomon.as aeruginosa. Antimicrob. Agents Chemother. 32: 649-655. Rocque, W.J., S.W. Fesik, A. Haug and E.J. McGroarty. 1988. Polycation binding to isolated hipopolysaccharide from antibiotic-hypersusceptible mutant strains of Escherlchia coiL Antimicrob. Agents Chemother. 32: 308-313. Rowe, P., 5, N. and P.M. Meadow. 1983. Structure of the core from the lipopolysaccharide of Pseudomon.as aerugirlosa PACIR and its defective mutants. Eur. J. Biochem. 132: 329-337. Russel, M. and P. Model. 1984. Replacement of the ftp gene of Escherlchia coil by an inactive gene cloned on a plasmid. J. Bacteriol. 159: 1034-1039. Sambrook, J., E.F. Fritisch and T. Maniatis. 1989. Molecular Cloning. A Laboratory Manual. Cold Spring Harbor Laboratory Press, Cold Spring Harbor, New York. 55 C Sandermann and Strominger. 1972. Purification and properties of Isoprenoid alcohol phosphokinase from Staphylococcus aureus. J. Biol. Chem. 247: 5123-5131. Sassenfeld, H.M. 1984. A polypeptide fusion designed for the purification of recombinant proteins. Bio/Technol. 2: 76-81. Engineering proteins for purification. Sassenfeld, H.M. 1990. Biotechnol. 8: 88-93.  Trends  173  Sawyer, J.G., N.L. Martin and R.E.W. Hancock. 1988. The interaction of macrophage cationic proteins with the outer membrane of Pseudomonas aeruginosa. Infect. Immun. 56: 693-698. Saya, H., P.S.Y. Lee, T. Nishi, I. Izawa, M. Nakajima, G.E. Gallick and V.A. Levin. 1993. Bacterial expression of an active tyrosine kinase from a protein A/truncated c-src fusion protein. FEBS Lett. 327: 224-230. Stein, C.H. 1989. Production of soluble recombinant proteins in bacteria. Bio/Technol. 7: 1141-1149. Stein, C.H. 1990. Solubility as a function of protein structure and solvent components. Bio/Technol. 8: 308-317. Stein, C.H. and M.H.M. Noteborn. 1988. Formation of soluble recombinant proteins in Escherichia colt is favored by lower growth temperature. Bio/Technol. 6: 29 1-294. Schindler, M. and M.J. Osborn. 1979. Interaction of divalent cations and polymyxin B with lipopolysaccharide. Biochem. 18: 4425-4430. Schindler, P.R.G. and M. Teuber. 1975. Action of polymyxin B on bacterial membranes: morphological changes in the cytoplasm and in the outer membrane of Salmonella typhtmurium and Eschertchta colt B. Antimicrob. Agents Chemother. 8: 94-104. Schoner, R.G., L.F. Ellis and B.E. Schoner. 1985. Isolation and purification of protein granules from Escherichta colt cells overproducing bovine growth hormone. Bio /Technol. 2: 151-154. Sekar, V. 1987. A rapid screening procedure for the identification of recombinant bacterial clones. 5: 11-13. Seisted, M.E. and S.S. Harwig. 1987. Purification, primary structure, and antimicrobial activities of a guinea pig neutrophil defensin. Infect. Immun. 55: 2281-2286. Seisted, M.E. and S.S. Harwig. 1989. Determination of the disulfide array in the human defensin HNP-2. A covalently cydlized peptide. J. Biol. Chem. 264: 4003-4007. Selsted, M.E., D. Szklarek and R.I. Lehrer. 1984. Purification and antibacterial activity of antimicrobial peptides of rabbit granulocytes. Infect. Immun. 45: 150-154. Selsted, M.E., D. Szklarek, T. Ganz and R.I. Lehrer. 1985. Activity of rabbit leukocyte peptides against Candtda albtcans. Infect. Immun. 49: 202206. Selsted, M.E., M.J. Novotny, W.L. Morris, Y.-Q. Tang, W. Smith and J.S. Cullor. 1992. Indolicidin, a novel bactericidal tridecapeptide amide from neutrophils. J. Biol. Chem. 267: 4292-4295.  174  Seisted, M.E., Y.-Q. Tang, W.L. Morris, P.A. McGuire, M.J. Novotny, W. Smith, A.H. Henschen and J.S. Cullor. 1993. Purification, primary structures, and antibacterial activities of (3-defensins, a new family of antimicrobial peptides from bovine neutrophils. J. Biol. Chem. 268: 6641-6648. Shine, J., I. Fettes, N.C.Y. Lan, J.L. Roberts and J.D. Baxter. 1980. Expression of cloned f3-endorphin gene sequences by Escherlchia coiL Nature 285: 456-461. Siehnel, R.J., C. Egli and R.E.W. Hancock. 1992. Polyphosphate-selective porin OprO of Pseudomonas aeruglnosa: expression, purification and sequence. Mol. Microbiol. 6: 2319-2326. Sipos, D., K. Chandrasekhar, K. Arvidsson, A. Engstrom and A. Ehrenberg. 1991. Two-dimensional proton-NMR studies on a hybrid peptide between cecropin A and melittin. Resonance assignments and secondary structure. Eur. J. Biochem. 199: 285-291. Skerlavaj, B., D. Romeo and R. Gennaro. 1990. Rapid membrane permeabilization and inhibition of vital functions of Gram-negative bacteria by bactenecins. Infect. Immun. 58: 3724-3730. Smit, J., Y. Kamio and H. Nikaido. 1975. Outer membrane of Salmonella typhimurium: chemical analysis and freeze-fracture studies with lipopolysaccharide mutants. J. Bacteriol. 124: 942-958. Smith, D.B. and K.S. Johnson. 1988. Single-step purification of polypeptides expressed in Escherichia colt as fusions with glutathione-S-transferase. Gene 67: 3 1-40. Smith, D.B., K.M. Davern, P.G. Board, W.U. Tiu, E.G. Garcia and G.F. Mitchell. 1986. Mr 26,000 antigen of Schistosoma japonlcum recognized by resistant WEHI 1 29/J mice is a parasite glutathione-S-transferase. Proc. Natl. Acad. Sd. USA 83: 8703-8707. Smith, D.B., M.R. Rubira, R.J. Simpson, K.M. Davem, W.U. Tiu, P.G. Board and G.F. Mitchell. 1988. Expression of an enzymatically active parasite molecule in Escherichia colt: Schistosoma japonicum glutathione-S transferase. Mol. Biochem. Parasitol. 27: 249-256. Stahl, S., A. Sjölander, M. Hansson, P.-A. Nygren and M. Uhlén. 1990. A general strategy for polymerization, assembly and expression of epitope carrying peptides applied to the Plasmodium falciparum antigen Pf155/RESA. Gene 89: 187-193. Stark, G.R. 1965. Reactions of cyanate with functional groups of proteins. III. Reactions with amino and carboxyl groups. Biochem. 4: 1030-1036. Steiner, H. 1982. Secondary structure of the cecropins: antibacterial peptides from the moth Hyalophora cecropia. FEBS Lett. 137: 283-287.  175  Steiner, H., D. Hultmark, A. Engstrom, H. Bennich and H.G. Boman. 1981. Sequence and specificity of two antibacterial proteins involved in insect immunity. Nature 292: 246-248. Steiner, H., D. Andreu and R.B. Merrifield. 1988. Binding and action of cecropin and cecropin analogues: antibacterial peptides from insects. Biochim. Biophys. Acta 939: 260-266. Stirling, D.A., A. Petrie, D.J. Pulford, D.T.W. Paterson and M.J.R. Stark. 1992. Protein A-calmodulin fusions: a novel approach for investigating calmodulin function in yeast. Mol. Microbiol. 6: 703-7 13. Strandberg, L. and S.-L. Enfors. 1991. Factors influencing inclusion body formation in the production of a fused protein in Escherichia coil. Appi. Environ. Microbiol. 57: 1669-1674. Stringer, K.F., C.J. Ingles and J. Greenblatt. 1990. Direct and selective binding of an acidic transcriptional activation domain to the TATA-box factor TFIID. Nature 345: 783-786. Studier, F.W. and B.A. Moffatt. 1986. Use of bacteriophage 17 RNA polymerase to direct selective high-level expression of cloned genes. J. Mol. Biol. 189: 113-130. Swamy, K.H.S. and A.L. Goldberg. 1981. E. coil contains eight soluble proteolytic activities, one being ATP dependent. Nature 292: 652-654. Szoka, P.R., A.B. Schrieber, H. Chan and J. Murthy. 1986. A general method for retrieving the components of a genetically engineered fusion protein. DNA5: 11-20. Tabor, S. and C.C. Richardson. 1985. A bacteriophage T7 RNA polymerase/promoter system for controlled exclusive expression of specific genes. Proc. Nail. Acad. Sci. USA 82: 1074-1078. Teuber, M. and J. Bader. 1976. Action of polymyxin on bacterial membranes. Binding capacities for polymyxin B of inner and outer membranes isolated from Salmonella typhimurlum G30. Arch. Microbiol. 109: 51-58. Theil, R. and K.H. Scheit. 1983. Amino acid sequence of seminaiplasmin, and antimicrobial protein from bull semen. EMBO J. 2: 1159-1163. Tosteson, M.T. and D.C. Tosteson. 1981. The sting. Melittin forms channels in lipid bilayers. Biophys. J. 36: 109-116. Trias, J. and H. Nikaido. 1990a. Outer membrane protein D2 catalyzes facilitated diffusion of carbapenems and penems through the outer membrane of Pseudomonas aerugirtosa. Antimicrob. Agents Chemother. 34: 52-57. Trias, J. and H. Nikaido. 1990b. Protein D2 channel of the Pseudomonas aeruginosa outer membrane has a binding site for basic amino acids and peptides. J. Biol. Chem. 265: 15680-15684.  176  Uhlén, M. and T. Moks. 1990. Gene fusions for purpose of expression: introduction. Meth. Enzymol. 185: 129-143.  an  Uhlén, M., B. Nilsson, B. Guss, M. Lindberg, S. Gatenbeck and L. Philipson. 1983. Gene fusion vectors based on the gene for staphylococcal protein A. Gene 23: 369-378. Uhlén, M., B. Guss, B. Nilsson, S. Gatenbeck, L. Philipson and M. Lindberg. 1984. Complete sequence of the staphylococcal gene encoding protein A. A gene evolved through multiple duplications. J. Biol. Chem. 259: 1695-1702. Ullman, A. 1984. One-step purification of hybrid proteins which have galactosidase activity. Gene 29: 27-31.  I  Vaara, M. 1991. The outer membrane permeability-increasing action of linear analogues of polymyxin B nonapeptide. Drugs Exp. Clin. Res. 17: 437444. Vaara, M. 1992. Agents that increase the permeability of the outer membrane. Microbiol. Rev. 56: 395-411. Vaara, M. and T. Vaara. 1983. Polycations sensitize enteric bacteria to antibiotics. Antimicrob. Agents Chemother. 24: 107-113. Vaara, M., T. Vaara, M. Jensen, I. Helander, M. Nurminen, E.T. Rietschel and P.H. Mäkelä. 1981. Characterization of the lipopolysaccharide from the polymyxin-resistant mutants of Salmonella typhimurtum. FEBS Lett. 129: 145-149. Veeraragavan, K. 1989. Studies on two major contaminating proteins of the cytoplasmic inclusion bodies in Escherichia coiL FEMS Microbiol. Lett. 61: 149-152. Viljanen, P., P. Koski and M. Vaara. 1988. Effect of small cationic leukocyte peptides (defensins) on the permeability barrier of the outer membrane. Infect. Immun. 56: 2324-2329. Vogel, H. and F. Jahnig. 1986. Biophys. J. 50: 573-582.  The structure of melittin in membranes.  von Gabain, A., J.G. Belasco, J.L. Schottel, A.C.Y. Chang and S.N. Cohen. 1983. Decay of mRNA in Escherichia coiL: investigation of the fate of specific segments of transcripts. Proc. Nati. Acad. Sci. USA 80: 653657. Wade, D., A. Boman, B. Wahlin, C.M. Drain, D. Andreu, H.G. Boman and R.B. Merrifield. 1990. AU-D amino acid-containing channel-forming antibiotic peptides. Proc. Nail. Acad. Sci. USA 87: 476 1-4765. Wade, D., D. Andreu, S.A. Mitchell, A.M.V. Silveira, A. Boman, H.G. Boman and R.B. Merrifield. 1992. Antibacterial peptides designed as analogs or  177  hybrids of cecropins and melittin. 429-436.  Internat. J. Peptide Prot. Res. 40:  Werkmeister, J.A., A. Kirkpatrick, J.A. McKenzie and D.E. Rivett. 1993. The effect of sequence variations and structure on the cytolytic activity of melittin peptides. Biochim. Biophys. Acta 1157: 50-54. Wilkinson, S.G. 1983. Composition and structure of lipopolysaccharides from Pseudomona.s aerugthosa. Rev. Infect. Dis. 5: S941-S949. Winberg, G. and M.-L. Hammarskjord. 1980. Isolation of DNA from agarose gels using DEAE-paper. Application to restriction site mapping of adenovirus type 16 DNA. Nuci. Acids Res. 8: 253-264. Xanthopoulos, K.G., J.Y. Lee, R. Gan, K. Kockum, I. Faye and H.G. Boman. 1988. The structure of the gene for cecropin B, an antibacterial immune protein from Hyaiophora cecropia. Eur. J. Biochem. 172: 371-376. Yoshimura, F. and H. Nikaldo. 1982. Permeability of Pseudomonas aeruginosa outer membrane to hydrophiic solutes. J. Bacteriol. 152: 636-642. Young, L.S. 1984. The clinical challenge of infections due to Pseudomonas aemginosa. Rev. Infect. Dis. 6: S603-S607. Yu, A., E.V. Knirel, N.A. Kocharova, N.A. Paramonov, N.K. Kochetkov, B.A. Dmitriev, E.S. Stanislavsky and B. Lanyi. 1988. The structure of 0specific polysaccharides and serological classification of Pseudomonas aerugirtosa. Acta Microbiol. Hung. 35: 3-24. Zasloff, M. 1987. Magainins, a class of antimicrobial peptides from Xenopus skin: isolation, characterization of two active forms and partial eDNA sequence of a precursor. Proc. NatL Acad. Sci. USA 84: 5449-5453. Zeya, H.I. and J.K. Spitznagel. 1966. Cationic proteins of polymorphonuclear leukocyte lysosomes. I. Resolution of antibacterial and enzymatic activities. J. Bacteriol. 91: 750-754. Zimmermann, W. and A. Rosselet. 1977. Function of the outer membrane of Escherlchia coil as a permeability barrier to 13-lactam antibiotics. Antimicrob. Agents Chemother. 12: 368-372.  178  

Cite

Citation Scheme:

        

Citations by CSL (citeproc-js)

Usage Statistics

Country Views Downloads
China 28 19
United States 27 5
Russia 4 0
Canada 4 0
Japan 2 0
Sweden 2 0
Germany 2 13
France 2 0
Australia 2 0
Bulgaria 2 0
Indonesia 1 0
Italy 1 0
United Kingdom 1 0
City Views Downloads
Beijing 22 0
Unknown 11 34
Washington 8 0
Ashburn 8 0
Shenzhen 3 19
Mountain View 3 0
Saint Petersburg 2 0
Vancouver 2 0
Redmond 2 0
Stockholm 2 0
University Park 2 0
Putian 2 0
Melbourne 2 0

{[{ mDataHeader[type] }]} {[{ month[type] }]} {[{ tData[type] }]}
Download Stats

Share

Embed

Customize your widget with the following options, then copy and paste the code below into the HTML of your page to embed this item in your website.
                        
                            <div id="ubcOpenCollectionsWidgetDisplay">
                            <script id="ubcOpenCollectionsWidget"
                            src="{[{embed.src}]}"
                            data-item="{[{embed.item}]}"
                            data-collection="{[{embed.collection}]}"
                            data-metadata="{[{embed.showMetadata}]}"
                            data-width="{[{embed.width}]}"
                            async >
                            </script>
                            </div>
                        
                    
IIIF logo Our image viewer uses the IIIF 2.0 standard. To load this item in other compatible viewers, use this url:
http://iiif.library.ubc.ca/presentation/dsp.831.1-0099224/manifest

Comment

Related Items