Open Collections

UBC Theses and Dissertations

UBC Theses Logo

UBC Theses and Dissertations

Molecular characterization of the interaction between cucumber necrosis virus and zoospores of the fungal… Robbins, Marjorie Ann 2000

Your browser doesn't seem to have a PDF viewer, please download the PDF to view this item.

Item Metadata


831-ubc_2000-487024.pdf [ 6.94MB ]
JSON: 831-1.0089783.json
JSON-LD: 831-1.0089783-ld.json
RDF/XML (Pretty): 831-1.0089783-rdf.xml
RDF/JSON: 831-1.0089783-rdf.json
Turtle: 831-1.0089783-turtle.txt
N-Triples: 831-1.0089783-rdf-ntriples.txt
Original Record: 831-1.0089783-source.json
Full Text

Full Text

Molecular Characterization of the Interaction Between Cucumber Necrosis Virus and Zoospores of the Fungal Vector Olpidium bornovanus By MARJORIE ANN ROBBINS B.Sc. (Honours Biology), Dalhousie University, 1991 M.Sc, McGill University, 1994 A THESIS SUBMITTED IN PARTIAL FULFILLMENT OF THE REQUIREMENTS FOR THE DEGREE OF DOCTOR OF PHILOSOPHY In THE FACULTY OF GRADUATE STUDIES (Plant Science) We accept this thesis as conforming to the required standard THE UNIVERSITY OF BRITISH COLUMBIA April 2000 © Marjorie Ann Robbins, 2000 in presenting this thesis in partial fulfilment of the requirements for an advanced degree at the University of British Columbia, 1 agree that the Library shall make it freely available for reference and study. I further agree that permission for extensive copying of this thesis for scholarly purposes may be granted by the head of my department or by his or her representatives. It is understood that copying or publication of this thesis for financial gain shall not be allowed without my written permission. Department of [fvCjuVVuiAJiJ The University of British Columbia Vancouver, Canada DE-6 (2/88) Abstract I n t h i s t h e s i s , t h e m o l e c u l a r b i o l o g y o f t h e i n t e r a c t i o n b e t w e e n Cucumber necrosis tombusvirus ( C N V ) a n d z o o s p o r e s o f i t s f u n g a l v e c t o r , Olpidium bornovanus, w a s e x a m i n e d . S e r i a l p a s s a g e i n t h e a b s e n c e o f O. bornovanus p r o d u c e d a p o o l o f C N V v a r i a n t s d e f i c i e n t i n f u n g u s t r a n s m i s s i o n . V a r i a n t s o f C N V h a d m u t a t i o n s a n d / o r d e l e t i o n s i n g e n o m i c R N A t h a t a f f e c t e d v a r i o u s s t a g e s o f t h e v i r u s m u l t i p l i c a t i o n - c y c l e , t h e r e b y d e c r e a s i n g t r a n s m i s s i b i l i t y . O n e t r a n s m i s s i o n m u t a n t , L L 5 , w a s s e l e c t e d f o r f u r t h e r c h a r a c t e r i z a t i o n s i n c e t h i s m u t a n t r e t a i n e d s t a b l e , i n t a c t p a r t i c l e s a n d w a s as i n f e c t i o u s as w i l d - t y p e C N V . S e q u e n c i n g o f t h e L L 5 c o a t p r o t e i n ( C P ) a n d s u b s e q u e n t s i t e - d i r e c t e d m u t a g e n e s i s o f t h e C N V C P i n d i c a t e d t h a t a s i n g l e n u c l e o t i d e s u b s t i t u t i o n r e s u l t i n g i n a G l u t o L y s s u b s t i t u t i o n i n t h e C N V C P s h e l l d o m a i n w a s r e s p o n s i b l e f o r t h e r e d u c e d t r a n s m i s s i o n o f L L 5 . A n in vitro b i n d i n g a s s a y w a s d e v e l o p e d t o d e t e r m i n e i f L L 5 w a s d e f i c i e n t at t h e l e v e l o f a t t a c h m e n t t o f u n g a l z o o s p o r e s . L L 5 b o u n d z o o s p o r e s at a p p r o x i m a t e l y 5 0 % t h e l e v e l o f w i l d - t y p e C N V i n d i c a t i n g t h a t t h e r e d u c e d a b i l i t y t o b i n d z o o s p o r e s w a s at l e a s t p a r t i a l l y r e s p o n s i b l e f o r t h e r e d u c e d t r a n s m i s s i o n . F u r t h e r e x a m i n a t i o n o f t h e b i n d i n g o f s e v e r a l O. Z w m o v a n w s - t r a n s m i t t e d v i r u s e s t o O. bornovanus z o o s p o r e s i n d i c a t e d t h a t t h e a b i l i t y t o b i n d z o o s p o r e s in vitro c o r r e l a t e s w i t h t h e k n o w n b i o l o g i c a l s p e c i f i c i t y o f t r a n s m i s s i o n . A d d i t i o n a l l y , i t w a s f o u n d t h a t b i n d i n g o f C N V t o O. bornovanus w a s s a t u r a b l e , w i t h a m a x i m u m o f 1.75 X 1 0 4 v i r u s p a r t i c l e s b o u n d p e r z o o s p o r e . It w a s a l s o d e t e r m i n e d t h a t C N V c a n c o m p e t i t i v e l y i n h i b i t b i n d i n g o f a n o t h e r O. bo rnovanus-tr msmitted v i r u s , Melon necrotic spot carmovirus. T a k e n t o g e t h e r , t h e s e r e s u l t s s u g g e s t t h a t O. bornovanus z o o s p o r e s c o n t a i n s p e c i f i c r e c e p t o r m o l e c u l e ( s ) f o r a t t a c h m e n t o f C N V p a r t i c l e s . i i A m i n o a c i d s e q u e n c e r e l a t i o n s h i p s a m o n g t h e c o a t p r o t e i n s o f s e v e r a l s m a l l s p h e r i c a l p l a n t R N A v i r u s e s i n c l u d i n g f o u r k n o w n t o b e t r a n s m i t t e d b y O. bornovanus w e r e e x a m i n e d . I n t e r e s t i n g l y , t h e c o a t p r o t e i n s e q u e n c e s o f t h e f o u r O. bornovanus t r a n s m i t t e d v i r u s e s w e r e c l o s e l y r e l a t e d , d e s p i t e t h e a f f i n i t i e s o f t h e s e v i r u s e s t o d i s t i n c t t a x o n o m i c g r o u p s . T w o r e g i o n s w i t h i n t h e o t h e r w i s e n o n - c o n s e r v e d c o a t p r o t e i n p r o t r u d i n g d o m a i n w e r e p a r t i c u l a r l y c o n s e r v e d . T h e s e d a t a f u r t h e r s u g g e s t t h e i n v o l v e m e n t o f s p e c i f i c c o a t p r o t e i n s e q u e n c e s i n t h e f u n g u s t r a n s m i s s i o n p r o c e s s . i i i T a b l e o f C o n t e n t s A b s t r a c t i i T a b l e o f C o n t e n t s i v L i s t o f T a b l e s •. v i i L i s t o f F i g u r e s . . v i i i L i s t o f A b b r e v i a t i o n s i x A c k n o w l e d g e m e n t s x i i i 1 C H A P T E R O N E : L I T E R A T U R E R E V I E W 1 1.1 I n t r o d u c t i o n 1 1.2 M o d e s o f p l a n t v i r u s t r a n s m i s s i o n 3 1.2.1 A r t h r o p o d t r a n s m i s s i o n 7 N o n - c i r c u l a t i v e a p h i d t r a n s m i s s i o n 8 V i r u s r e t e n t i o n 8 C o a t p r o t e i n 9 H e l p e r c o m p o n e n t 11 C i r c u l a t i v e a p h i d t r a n s m i s s i o n 14 C o a t p r o t e i n 15 C h a p e r o n i n s 17 R e c e p t o r - m e d i a t e d e n d o c y t o s i s 17 T h r i p s t r a n s m i s s i o n ( c i r c u l a t i v e , r e p l i c a t i v e ) 2 0 1.2.2 N e m a t o d e t r a n s m i s s i o n ( n o n - c i r c u l a t i v e ) 2 1 1.2.3 F u n g u s t r a n s m i s s i o n 2 5 Olpidium l i f e - c y c l e 2 9 In vitro ( n o n - c i r c u l a t i v e ) t r a n s m i s s i o n 3 2 S p e c i f i c i t y o f in vitro f u n g a l t r a n s m i s s i o n 3 3 In vivo ( c i r c u l a t i v e ) f u n g a l t r a n s m i s s i o n 3 4 In vivo t r a n s m i s s i o n b y Olpidium brassicae 3 5 In vivo t r a n s m i s s i o n b y Polymyxa a n d Spongospora s p p 3 6 1.3 C u c u m b e r n e c r o s i s v i r u s 3 8 1.3.1 T a x o n o m i c s t a t u s o f C N V 3 8 1.3.2 G e n o m i c o r g a n i z a t i o n : 3 9 1.3.3 C N V d e f e c t i v e i n t e r f e r i n g R N A s 4 0 1.3.4 C o a t p r o t e i n m u t a n t s 4 1 1.3.5 P a r t i c l e s t r u c t u r e 4 2 1.3.6 T h e r o l e o f t h e C N V c o a t p r o t e i n i n f u n g u s t r a n s m i s s i o n 4 3 1.4 B r i e f o v e r v i e w o f v i r u s - r e c e p t o r i n t e r a c t i o n s 4 4 1.5 S u m m a r y a n d T h e s i s O b j e c t i v e s 4 6 2 C H A P T E R T W O : M A T E R I A L S A N D M E T H O D S 4 9 i v 2.1 M a i n t e n a n c e o f v i r u s c u l t u r e s 4 9 2.2 P u r i f i c a t i o n o f v i r u s 4 9 2.2.1 C s C l p u r i f i c a t i o n 4 9 2.2.2 D i f f e r e n t i a l c e n t r i f u g a t i o n 5 0 2.2.3 M i n i p r e p p u r i f i c a t i o n 5 1 2.3 M a i n t e n a n c e o f f u n g a l c u l t u r e s 51 • 2.4 P r o d u c t i o n o f a n t i b o d i e s 5 3 2.4.1 P o l y c l o n a l a n t i b o d y p r o d u c t i o n 5 3 2.4.2 M o n o c l o n a l a n t i b o d y p r o d u c t i o n 5 3 2.4.3 P u r i f i c a t i o n o f I g G a n d p r o d u c t i o n o f a l k a l i n e p h o s p h a t a s e c o n j u g a t e 5 4 2.5 E n z y m e - l i n k e d I m m u n o a s s a y ( E L I S A ) 5 5 2.6 I m m u n o b l o t t i n g 5 6 2.7 I s o l a t i o n o f t r a n s m i s s i o n - d e f i c i e n t C N V v a r i a n t s 5 7 2.8 F u n g u s t r a n s m i s s i o n a s s a y 5 7 2.9 R T - P C R a n d c l o n i n g o f t h e L L 5 c o a t p r o t e i n 5 8 2.10 In vitro t r a n s c r i p t i o n a n d i n o c u l a t i o n o f p l a n t s 5 8 2.11 In vitro m u t a g e n e s i s 5 9 2.12 B i n d i n g A s s a y s 5 9 2.13 I n t r o d u c t i o n o f a f r a m e s h i f t m u t a t i o n i n t o t h e C L S V CP O R F 6 0 2.14 A n a l y s i s o f J R 3 A X h o 6 1 2.15 L e c t i n l a b e l l i n g o f f u n g a l z o o s p o r e s 6 1 3 C H A P T E R T H R E E : I D E N T I F I C A T I O N A N D M O L E C U L A R C H A R A C T E R I Z A T I O N OF N A T U R A L C N V V A R I A N T S W I T H R E D U C E D TRANSMISSmnJTY 6 2 3.1 I n t r o d u c t i o n 6 2 3.2 R e s u l t s 6 4 3.2.1 M e c h a n i c a l l y p a s s a g e d CNV c o n t a i n s v a r i a n t s d e f i c i e n t i n f u n g u s t r a n s m i s s i o n 6 4 3.2.2 A G l u t o L y s m u t a t i o n i n t h e L L 5 c o a t p r o t e i n S d o m a i n i s r e s p o n s i b l e f o r r e d u c e d f u n g a l t r a n s m i s s i o n 6 6 3.2.3 T h e G l u t o L y s s u b s t i t u t i o n i n t h e L L 5 s h e l l d o m a i n i s d i r e c t l y r e s p o n s i b l e f o r t h e l o s s o f t r a n s m i s s i b i l i t y 6 9 M 5 a n d M 5 / L L 5 S p a r t i c l e s c o n t a i n i n t a c t RNA b u t h a v e a l t e r e d e l e c t r o p h o r e t i c m o b i l i t i e s o n a g a r o s e g e l s 7 0 M 5 / L L 5 a n d M 5 / L L 5 s p a r t i c l e s a r e s t a b l e a n d as i n f e c t i o u s as W T 7 2 M 5 / L L 5 a n d M 5 / L L 5 S a c c u m u l a t e t o W T l e v e l s i n i n f e c t e d p l a n t s 7 3 3.2.4 M 5 / L L 5 a n d M 5 / L L 5 s p a r t i c l e s b i n d z o o s p o r e s l e s s e f f i c i e n t l y t h a n W T v i r u s 7 5 3.3 D i s c u s s i o n 7 6 4 C H A P T E R F O U R : C O M P A R A T I V E S E Q U E N C E A N A L Y S I S O F T H E C O A T P R O T E I N S OF FOUR OLPIDIUM BORNOVANUS T R A N S M I T T E D VIRUSES 81 4.1 I n t r o d u c t i o n 8 1 4.1.1 P r o p e r t i e s o f O. bornovanus t r a n s m i t t e d v i r u s e s u s e d i n t h i s s t u d y 8 2 Cucumber leaf spot virus 8 2 v Melon necrotic spot virus 8 3 Red clover necrotic mosaic virus 8 3 Cucumber necrosis virus 8 4 4.2 R e s u l t s 8 4 4.2.1 C o m p a r a t i v e s e q u e n c e a n a l y s i s o f t h e C N V , M N S V , a n d R C N M V c o a t p r o t e i n s 8 4 4.2.2 T h e C L S V c o a t p r o t e i n i s n o t r e q u i r e d f o r c e l l - t o - c e l l m o v e m e n t b u t i s r e q u i r e d f o r s y s t e m i c m o v e m e n t i n N. benthamiana 9 0 4.3 D i s c u s s i o n 9 5 4.3.1 C o m p a r a t i v e s e q u e n c e a n a l y s i s 9 5 4.3.2 R o l e o f t h e C L S V C P i n v i r u s m o v e m e n t 9 6 5 C H A P T E R F I V E : E V I D E N C E T H A T F U N G A L Z O O S P O R E S C O N T A I N S P E C I F I C R E C E P T O R S F O R T R A N S M I S S I O N O F C N V 9 8 5.1 I n t r o d u c t i o n 9 8 5.2 R e s u l t s 1 0 0 5.2.1 D e v e l o p m e n t o f a n in vitro a s s a y f o r b i n d i n g o f C N V t o O. bornovanus z o o s p o r e s 1 0 0 5.2.2 B i n d i n g o f v i r u s t o z o o s p o r e s i s s p e c i f i c 1 03 5.2.3 B i n d i n g o f v i r u s t o z o o s p o r e s i s s a t u r a b l e 1 0 4 5.2.4 C N V c a n c o m p e t e w i t h M N S V a n d T N V b u t n o t w i t h C L S V f o r b i n d i n g s i t e s 1 0 7 5.3 D i s c u s s i o n 1 0 9 6 C H A P T E R S I X : U S E O F F I T C - L E C T I N S T O I D E N T I F Y S U G A R S O N T H E S U R F A C E O F O. BORNOVANUS A N D O. BRASSICAE Z O O S P O R E S 113 6.1 I n t r o d u c t i o n 113 6.2 R e s u l t s 1 1 5 6.2.1 C o n c a n a v a l i n A - F I T C b i n d s t o Olpidium z o o s p o r e s 1 1 5 6.2.2 Triticum vulgaris l e c t i n - F I T C d o e s n o t b i n d t o s e c o n d a r y z o o s p o r e s o f Olpidium b u t d o e s b i n d t o t o p r i m a r y z o o s p o r e s o f Olpidium 117 6.2.3 Bauhinia purpurea l e c t i n - F I T C b i n d s t o O. brassicae b u t n o t O. bornovanus z o o s p o r e s 1 2 4 6.2.4 Erythrina corallodendron l e c t i n - F I T C d o e s n o t b i n d Olpidium z o o s p o r e s . 1 25 6.2.5 Tetragonolobuspurpureas l e c t i n - F I T C b i n d s t o Olpidium zoospores........ 1 25 6.2.6 D i s c u s s i o n 1 2 6 7 C H A P T E R S E V E N : G E N E R A L D I S C U S S I O N 1 3 0 R e f e r e n c e s 1 3 7 v i L i s t o f T a b l e s T a b l e 1.1 P r i n c i p a l v e c t o r s o f p l a n t v i r u s g e n e r a a n d t h e i r m e c h a n i s m o f t r a n s m i s s i o n . 4 T a b l e 1.2 K n o w n a n d p u t a t i v e f u n g a l v e c t o r s f o r v i r u s e s a n d v i r u s - l i k e a g e n t s 2 6 T a b l e 1.3 S o m e k n o w n r e c e p t o r s f o r a n i m a l v i r u s e s 4 5 T a b l e 3.1 P h e n o t y p e s o f C N V t r a n s m i s s i o n m u t a n t s 6 6 T a b l e 3.2 B i n d i n g o f C N V t o O. bornovanus z o o s p o r e s in vitro 7 6 T a b l e 4.1 V i r u s e s u s e d i n t h e C P s e q u e n c e a l i g n m e n t s a n d d e n d o g r a m 8 5 T a b l e 6.1 L e c t i n s u s e d i n b i n d i n g a s s a y s w i t h Olpidium z o o s p o r e s 1 1 5 T a b l e 6.2 B i n d i n g o f F T T C - l e c t i n c o n j u g a t e s t o Olpidium z o o s p o r e s in vitro 1 2 4 v i i L i s t o f F i g u r e s F i g u r e 1.1 L i f e c y c l e o f Olpidium brassicae 2 7 F i g u r e 1.2 G e n o m i c o r g a n i z a t i o n o f C N V 3 9 F i g u r e 1.3 S t r u c t u r e o f t h e T B S V p a r t i c l e 4 2 F i g u r e 3.1 L o c a t i o n o f m u t a t i o n s i n t h e L L 5 C P g e n e 6 7 F i g u r e 3.2 S u m m a r y o f f u n g u s t r a n s m i s s i o n a s s a y s 6 8 F i g u r e 3.3 A g a r o s e g e l e l e c t r o p h o r e s i s o f m u t a n t a n d W T v i r u s 7 0 F i g u r e 3.4 A g a r o s e g e l e l e c t r o p h o r e s i s o f R N A e x t r a c t e d f r o m m u t a n t a n d W T v i r i o n s 7 1 F i g u r e 3.5 A c c u m u l a t i o n o f v i r a l R N A o r v i r u s p a r t i c l e s i n i n f e c t e d l e a v e s 7 3 F i g u r e 3.6 S u m m a r y o f in vitro b i n d i n g a s s a y s 7 4 F i g u r e 4.1 D e n d o g r a m d e p i c t i n g r e l a t i o n s h i p s a m o n g t h e C P s o f s e v e r a l i c o s a h e d r a l v i r u s e s 8 6 F i g u r e 4.2 A l i g n m e n t o f t h e C P s o f s e v e r a l s m a l l s p h e r i c a l v i r u s e s 9 0 F i g u r e 4.3 A l i g n m e n t o f t h e C P a m i n o a c i d s e q u e n c e s o f f o u r O. bornovanus-t r a n s m i t t e d v i r u s e s 9 0 F i g u r e 4.4 S y m p t o m s o n N. benthamiana i n o c u l a t e d w i t h t r a n s c r i p t s o f J R 3 o r J R 3 A X h o 9 2 F i g u r e 4.5 S y m p t o m s o n N. benthamiana o f l e a v e s i n o c u l a t e d w i t h t r a n s c r i p t s o f J R 3 A X h o o r J R 3 ( w i l d - t y p e C L S V ) 9 3 F i g u r e 4.6 A g a r o s e g e l o f t o t a l R N A e x t r a c t e d f r o m s i n g l e l e a v e s o f N. benthamiana. 9 4 F i g u r e 5.1 E f f e c t o f t i m e o n b i n d i n g o f C N V t o O. bornovanus z o o s p o r e s 101 F i g u r e 5.2 E f f e c t o f p H o n b i n d i n g o f C N V t o O. bornovanus z o o s p o r e s 1 0 2 F i g u r e 5.3 S p e c i f i c i t y o f v i r u s b i n d i n g t o Olpidium spp 105 F i g u r e 5.4 S a t u r a t i o n b i n d i n g o f v i r u s t o Olpidium s p p 1 0 6 F i g u r e 5.5 C o m p e t i t i o n b i n d i n g e x p e r i m e n t s -. 108 F i g u r e 6.1 B i n d i n g o f C o n A - F I T C t o O. bornovanus z o o s p o r e s 1 18 F i g u r e 6.2 B i n d i n g o f C o n A - F I T C t o O. brassicae z o o s p o r e s 1 1 9 F i g u r e 6.3 B i n d i n g o f W G A - F I T C t o O. bornovanus a n d O. brassicae r e s t i n g s p o r e s 1 2 0 F i g u r e 6.4 B i n d i n g o f B P A - F I T C t o O. brassicae z o o s p o r e s 121 F i g u r e 6.5 E C A - F I T C d o e s n o t b i n d t o O. bornovanus o r O. brassicae z o o s p o r e s 1 2 2 F i g u r e 6.6 B i n d i n g o f T P A - F I T C t o O. bornovanus a n d O. brassicae z o o s p o r e s 1 2 3 v i i i List of Abbreviations 3' t h r e e p r i m e 5' f i v e p r i m e a a r m A a d e n o s i n e i n t h e c o n t e x t o f n u c l e o t i d e s e q u e n c e ; a l a n i n e i n t h e c o n t e x t o f a m i n o a c i d s e q u e n c e aa a m i n o a c i d Ab a n t i b o d y Ala a l a n i n e ALP a l k a l i n e p h o s p h a t a s e Arg a r g i n i n e ArMV Arabis mosaic vims Asn a s p a r a g i n e Asp a s p a r t i c a c i d ATP a d e n o s i n e - 5 - t r i p h o s p h a t e bp b a s e p a i r s BPA Bauhinia purpurea a g g l u t i n i n BNYVV Beet necrotic yellow vein virus BRL B e t h e s d a R e s e a r c h L a b o r a t o r i e s BSA b o v i n e s e r u m a l b u m i n BYDV Barley yellow dwarf virus C c y t i d i n e i n t h e c o n t e x t o f n u c l e o t i d e s e q u e n c e ; c y s t e i n e i n t h e c o n t e x t o f a p r o t e i n s e q u e n c e C a + + c a l c i u m CaMV Cauliflower mosaic virus cDNA c o m p l e m e n t a r y D N A CLRV c u c u m b e r l e a f r o l l v i r u s cm c e n t i m e t r e CMV Cucumber mosaic virus CNV Cucumber necrosis virus ConA c o n c a n a v a l i n A CP c o a t p r o t e i n CsCl c e s i u m c h l o r i d e C-terminal c a r b o x y l - t e r m i n a l cv. c u l t i v a r Cys c y s t e i n e D a s p a r t i c a c i d DI d e f e c t i v e i n t e r f e r i n g DIC d i f f e r e n t i a l i n t e r f e r e n c e c o n t r a s t DNA d e o x y r i b o n u c l e i c a c i d DTT d i t h i o t h r e i t o l E g l u t a m i c a c i d ECA Erythrinia corallodendron a g g l u t i n i n EDTA e t h y l e n e d i a m i n e t e t r a a c e t i c a c i d i x ELISA e n z y m e - l i n k e d i m m u n o s o r b e n t a s s a y F p h e n y l a l a n i n e FMDV Foot and mouth disease virus Fig. F i g u r e FITC f l u o r e s c e i n i s o t h i o c y a n a t e g g r a m ( s ) ; g e n o m i c i n t h e c o n t e x t o f v i r a l R N A G g u a n o s i n e i n t h e c o n t e x t o f a n u c l e o t i d e s e q u e n c e ; g l y c i n e i n t h e c o n t e x t o f a p r o t e i n s e q u e n c e GAP g e n e a c t i v a t o r p r o t e i n Glu g l u t a m i c a c i d Gly g l y c i n e GP g l y c o p r o t e i n h h i n g e H h i s t i d i n e HAT h i g h l y a p h i d t r a n s m i s s i b l e HC-Pro h e l p e r c o m p o n e n t p r o t e i n His h i s t i d i n e HIV Human immunodeficiency virus Hr h o u r HRV Human rhinovirus I i s o l e u c i n e ICAM i n t e r c e l l u l a r a d h e s i o n m o l e c u l e He i s o l e u c i n e K l y s i n e i n t h e c o n t e x t o f a m i n o a c i d s e q u e n c e ; t h o u s a n d i n t h e c o n t e x t o f s i z e kb k i l o b a s e kDa k i l o d a l t o n ( s ) 1 l i t r e ( s ) L l e u c i n e LDL l o w d e n s i t y l i p o p r o t e i n Lys l y s i n e | i m i c r o m m i l l i M m o l a r i n t h e c o n t e x t o f c o n c e n t r a t i o n ; m e t h i o n i n e i n t h e c o n t e x t o f p r o t e i n s e q u e n c e MAb m o n o c l o n a l a n t i b o d y MDMV Maize dwarf mosaic virus min m i n u t e ( s ) MP m o v e m e n t p r o t e i n mRNA m e s s e n g e r R N A N a s p a r a g i n e NAT n o t a p h i d t r a n s m i s s i b l e ng n a n o g r a m NMR n u c l e a r m a g n e t i c r e s o n a n c e nt n u c l e o t i d e x N-terminal a r n i n o - t e r r n i n a l oligo(s) o l i g o n u c l e o t i d e ( s ) ORF o p e n r e a d i n g f r a m e P p r o l i n e i n t h e c o n t e x t o f p r o t e i n s e q u e n c e ; p r o t r u d i n g d o m a i n i n t h e c o n t e x t o f C N V C P PAGE p o l y a c r y l a m i d e g e l e l e c t r o p h o r e s i s PBS p h o s p h a t e b u f f e r e d s a l i n e PCR p o l y m e r a s e c h a i n r e a c t i o n PEBV Pea early browning virus PEG p o l y e t h y l e n e g l y c o l Phe p h e n y l a l a n i n e pK2/M5 f u l l l e n g t h i n f e c t i o u s c D N A c l o n e o f C N V Pro p r o l i n e PVY Potato virus Y Q g l u t a m i n e R a r g i n i n e RNA(s) r i b o n u c l e i c a c i d ( s ) RRSV Raspberry ringspot virus RTD r e a d t h r o u g h d o m a i n RT-PCR r e v e r s e - t r a n s c r i p t i o n P C R S s e r i n e i n t h e c o n t e x t o f p r o t e i n s e q u e n c e ; s h e l l d o m a i n i n t h e c o n t e x t o f C N V C P SDS s o d i u m d o d e c y l s u f a t e sec s e c o n d s Ser s e r i n e T t h y m i d i n e i n t h e c o n t e x t o f a n u c l e o t i d e s e q u e n c e ; t h r e o n i n e i n t h e c o n t e x t o f p r o t e i n s e q u e n c e TAE T r i s a c e t a t e E D T A TBE T r i s b o r a t e E D T A TBRV Tomato blackring virus TBS T r i s b u f f e r e d s a l i n e TBSV-Ch t h e c h e r r y s t r a i n o f t o m a t o b u s h y s t u n t v i r u s TEV Tobacco etch virus Thr t h r e o n i n e TMV Tobacco mosaic virus TNV Tobacco necrosis virus TPA Tetragonobolus purpureas a g g l u t i n i n Tris T r i s - h y d r o x y m e t h y l a m i n o m e t h a n e Trp T r y p t o p h a n TRV Tobacco rattle virus TSWV Tomato spotted wilt virus TuMV Turnip mosaic virus TVMV Tobacco vein mottling virus Tyr T y r o s i n e x i u u r i d i n e i n t h e c o n t e x t o f n u c l e o t i d e s e q u e n c e ; u n i t s w h e n r e f e r r i n g t o a m o u n t o f e n z y m e V v o l t s i n t h e c o n t e x t o f e l e c t r o p h o r e s i s ; v a l i n e i n t h e c o n t e x t o f p r o t e i n s e q u e n c e V a l v a l i n e V A P v i r a l a t t a c h m e n t p r o t e i n W t r y p t o p h a n W G A w h e a t g e r m a g g l u t i n i n W T w i l d - t y p e Y t y r o s i n e Z Y M V Zucchini yellow mosaic virus x i i A c k n o w l e d g e m e n t s I w o u l d l i k e t o t h a n k D r . D ' A n n R o c h o n f o r h e r g e n e r o u s g u i d a n c e c o n c e r n i n g a l l t h e o r e t i c a l a n d t e c h n i c a l a s p e c t s o f t h i s p r o j e c t a n d a l s o f o r h e r i n c r e d i b l e p a t i e n c e as m y i n t e l l e c t u a l p a r e n t d u r i n g t h o s e t u m u l t u o u s a d o l e s c e n t y e a r s . I w o u l d a l s o l i k e t o t h a n k th e N a t u r a l S c i e n c e s a n d E n g i n e e r i n g R e s e a r c h C o u n c i l a n d t h e U n i v e r s i t y o f B r i t i s h C o m u m b i a f o r f i n a n c i a l a s s i s t a n c e . M a n y t h a n k s t o m y s u p e r v i s o r y c o m m i t t e e , D r . C a r o l i n e A s t e l l , D r . J i m K r o n s t a d , a n d D r . B r i a n E l l i s f o r t h e i r h e l p f u l i n p u t o n t h e p r o j e c t . I e s p e c i a l l y w o u l d l i k e t o t h a n k D r . B r i a n E l l i s f o r t h e g e n e r o u s u s e o f l a b o r a t o r y s p a c e a n d e q u i p m e n t d u r i n g p a r t o f t h i s s t u d y . I w o u l d a l s o l i k e t o t h a n k t h e P a c i f i c A g r i c u l t u r e R e s e a r c h C e n t r e f o r t h e u s e o f t h e i r f a c i l i t i e s a n d e x p e r t i s e , e s p e c i a l l y M i c h a e l W e i s f o r p h o t o g r a p h y , c o m p u t e r , a n d m i c r o s c o p y a d v i c e . M a n y t h a n k s t o t h e R o c h o n L a b ; D r . T i m S i t w h o t a u g h t m e h o w t o c l o n e a n d h o w t o c o o l a c o c a - c o l a t o p e r f e c t n e a r - f r e e z i n g t e m p e r a t u r e s , D r . R e n e e F i n n e n , w h o s h o w e d m e h o w t o b e n i c e t o m y R N A , D r . J u l i e J o h n s t o n , f o r m a n y l a t e n i g h t e x p e r i m e n t s a n d l a u g h t e r a n d D r . H o w a r d D a m u d e f o r m a n y f u n a d v e n t u r e s . I w o u l d l i k e t o t h a n k R o n R e a d e f o r a l l h i s t e c h n i c a l h e l p a n d f o r b e i n g m y f r i e n d i n S u m m e r l a n d . I w o u l d a l s o l i k e t o t h a n k D r . J a n e M i l l e r , K i m M a c D o n a l d , S h a n n o n W a r d , S t e v e O r b i n , D r . J o a n M a c P h e r s o n , D r . M a y n a r d a n d M i c h e l l e M i l k s , J a n e T h e i l m a n n , B e r e n d - J a n B o s c h a n d K i s h o r e K a k a n i f o r t h e i r f r i e n d s h i p i n S u m m e r l a n d . I w o u l d l i k e t o t h a n k D r . J u l i e J o h n s t o n , E l i a n e U b a l i j o r o , S h a n n o n M c L e a n , D r . C l a i r e H u g u e n o t , D r . K a r m a C a r r i e r a n d m y f a m i l y f o r t h e i r e m o t i o n a l s u p p o r t w h i l e I w a s i n S u m m e r l a n d . I w o u l d e s p e c i a l l y l i k e t o t h a n k m y p a r t n e r , A n d r e w P a r k e r , w h o , a s i d e f r o m b e i n g m y b e s t f r i e n d , h a s b e e n t h e m a j o r i n s t i g a t o r a n d s u p p o r t e r o f m y s c i e n t i f i c c a r e e r t h u s far . x i i i 1 C H A P T E R O N E : L I T E R A T U R E R E V I E W 1.1 Introduction T r a n s m i s s i o n o f m o s t p l a n t v i r u s e s i s a h i g h l y s p e c i f i c p r o c e s s i n w h i c h p a r t i c u l a r i n v e r t e b r a t e s a n d f u n g i a c t as v e c t o r s ( M a t t h e w s , 1 9 9 1 ) . V e c t o r s o f p l a n t v i r u s e s a i d i n b r e a c h i n g t h e p l a n t c e l l w a l l e n t r y b a r r i e r a n d a l s o c o n t r i b u t e t o t h e s p e c i f i c i t y o f t r a n s m i s s i o n . I n a n i m a l v i r u s - h o s t c e l l i n t e r a c t i o n s , a t t a c h m e n t t o s p e c i f i c r e c e p t o r s o n t h e p l a s m a m e m b r a n e o f s u s c e p t i b l e c e l l s i s a n e c e s s a r y s t e p i n t h e i n f e c t i o n p r o c e s s a n d i s a m a j o r d e t e r m i n a n t o f v i r u s - t i s s u e t r o p i s m ( T a r d i e u , 1982; M a r s h a n d H e l e n i u s , 1 9 8 9 ) . T h e r e h a v e b e e n n o r e p o r t s o f r e c e p t o r - m e d i a t e d r e c o g n i t i o n o f p l a n t c e l l s b y v i r u s e s . T h e s p e c i f i c i t y o f n a t u r a l p l a n t v i r u s i n f e c t i o n i s p r o b a b l y c o n t r o l l e d v i a r e c e p t o r s , b u t m o r e l i k e l y b y r e c e p t o r s a s s o c i a t e d w i t h t h e v e c t o r r a t h e r t h a n t h e p l a n t c e l l m e m b r a n e . A l t h o u g h t h e r e i s c o n s i d e r a b l e k n o w l e d g e c o n c e r n i n g t h e b i o l o g y o f p l a n t v i r u s -v e c t o r i n t e r a c t i o n s , l i t t l e i s k n o w n a b o u t s u c h i n t e r a c t i o n s at t h e m o l e c u l a r l e v e l . A n u n d e r s t a n d i n g o f t h e s p e c i f i c i n t e r a c t i o n s t h a t o c c u r b e t w e e n v i r u s p a r t i c l e s a n d t h e p u t a t i v e r e c e p t o r s o f t h e v e c t o r s w h i c h t r a n s m i t t h e m s h o u l d p r o v i d e f u n d a m e n t a l k n o w l e d g e c o n c e r n i n g v i r u s - v e c t o r r e l a t i o n s , a n d , m o r e o v e r , m a y l e a d t o t h e d e v e l o p m e n t o f n e w s t r a t e g i e s f o r v i r u s d i s e a s e c o n t r o l . I n t e r a c t i o n s b e t w e e n Cucumber necrosis virus ( C N V ) a n d t h e f u n g u s Olpidium bornovanus a r e b e i n g s t u d i e d t o d e t e r m i n e h o w p l a n t v i r u s e s a n d t h e i r v e c t o r s i n t e r a c t at 1 t h e m o l e c u l a r l e v e l . C N V i s n a t u r a l l y t r a n s m i t t e d t o c u c u m b e r t h r o u g h t h e s o i l v i a z o o s p o r e s o f O. bornovanus ( C a m p b e l l , 1996; C a m p b e l l a n d S i m , 1994; D i a s , 1 9 7 0 a ) . P r e v i o u s w o r k i n t h i s l a b o r a t o r y h a s s h o w n t h a t t h e C N V c o a t p r o t e i n d e t e r m i n e s t h e s p e c i f i c i t y o f f u n g u s t r a n s m i s s i o n ( M c L e a n et al, 1 9 9 4 ) . D e l i n e a t i o n o f r e g i o n s o f c o a t p r o t e i n s i n v o l v e d i n v e c t o r - t r a n s m i s s i o n h a s b e e n f a c i l i t a t e d b y t h e p r e s e n c e o f n a t u r a l v i r a l v a r i a n t s w h i c h h a v e l o s t t h e i r a b i l i t y t o b e t r a n s m i t t e d v i a l o n g t e r m m e c h a n i c a l p a s s a g e ( s e e C a m p b e l l , 1996; G r a y , 1996). P r i o r t o t h e w o r k d e s c r i b e d i n t h i s t h e s i s , n o v a r i a n t s o f C N V h a d p r e v i o u s l y b e e n i d e n t i f i e d w h i c h h a d l o s t t h e i r a b i l i t y t o b e f u n g u s - t r a n s m i t t e d . F u r t h e r m o r e , n o s p e c i f i c r e g i o n s o f t h e C N V c o a t p r o t e i n (i.e. p o t e n t i a l r e c e p t o r b i n d i n g s i t e s ) h a d y e t b e e n d e l i n e a t e d i n t h e s p e c i f i c i t y o f f u n g u s t r a n s m i s s i o n . Z o o s p o r e s o f O. bornovanus h a v e b e e n s h o w n b y D i a s ( 1 9 7 0 a ) t o t r a n s m i t C N V t o c u c u m b e r r o o t s . T r a n s m i s s i o n o f v i r u s e s b y O. bornovanus i s s p e c i f i c , w i t h p a r t i c u l a r s t r a i n s o f t h e f u n g u s f r o m m e l o n , s q u a s h o r c u c u m b e r b e i n g a b l e t o t r a n s m i t o n l y s p e c i f i c v i r u s e s ( C a m p b e l l et al, 1 9 9 5 ) . T h e b a s i s f o r t h e s p e c i f i c i t y o f i n t e r a c t i o n i s u n k n o w n , b u t I h y p o t h e s i z e t h a t s p e c i f i c r e c e p t o r m o l e c u l e s o n t h e s u r f a c e o f f u n g a l z o o s p o r e s i n t e r a c t w i t h s p e c i f i c s i t e s o n t h e v i r u s t o e n a b l e t r a n s m i s s i o n . T h i s l i t e r a t u r e r e v i e w i s o r g a n i z e d i n t o t h r e e s e c t i o n s . T h e f i r s t s e c t i o n d e a l s w i t h p l a n t v i r u s t r a n s m i s s i o n . G e n e r a l a s p e c t s o f n e m a t o d e , i n s e c t , a n d f u n g a l t r a n s m i s s i o n w i l l b e r e v i e w e d f o l l o w e d b y a r e v i e w o f Olpidium t r a n s m i s s i o n w i t h p a r t i c u l a r e m p h a s i s o n w h a t i s k n o w n a b o u t t r a n s m i s s i o n o f C N V b y O. bornovanus a n d T N V b y O. brassicae. I n t h e s e c o n d s e c t i o n , t h e b i o l o g i c a l a n d m o l e c u l a r p r o p e r t i e s o f C N V as w e l l 2 as i t s c a p s i d a r c h i t e c t u r e w i l l b e d e s c r i b e d . I n t h e t h i r d s e c t i o n , g e n e r a l i n f o r m a t i o n a b o u t r e c e p t o r - m e d i a t e d a n i m a l v i r u s c e l l r e c o g n i t i o n a n d e n t r y w i l l b e p r o v i d e d . 1.2 Modes of plant virus transmission V i r u s e s a r e o b l i g a t e p a r a s i t e s a n d m o v e m e n t f r o m o n e s u s c e p t i b l e h o s t t o a n o t h e r i s n e c e s s a r y f o r v i r u s p e r p e t u a t i o n i n n a t u r e ( M a t t h e w s , 1 9 9 1 ) . P l a n t v i r u s e s a r e u n a b l e to p e n e t r a t e t h e i n t a c t p l a n t c u t i c l e . T o o v e r c o m e t h i s b a r r i e r , v i r u s e s e i t h e r a v o i d t h e n e e d t o p e n e t r a t e t h e c e l l w a l l b y n o n s p e c i f i c m e a n s s u c h as m e c h a n i c a l t r a n s m i s s i o n , s e e d t r a n s m i s s i o n , v e g e t a t i v e p r o p a g a t i o n , g r a f t i n g , o r d o d d e r , o r v i r u s e s f o r m s p e c i f i c a s s o c i a t i o n s w i t h i n v e r t e b r a t e o r f u n g a l v e c t o r s w h i c h p e n e t r a t e p l a n t c u t i c l e s t o e n a b l e t h e i r e n t r y ( M a t t h e w s , 1 9 9 1 ; T a b l e 1.1). F o r a n i n v e r t e b r a t e o r f u n g u s t o f u n c t i o n as a v e c t o r , v i r u s p a r t i c l e s f r o m a n i n f e c t e d p l a n t m u s t a s s o c i a t e w i t h t h e v e c t o r a n d b e r e t a i n e d i n a n i n f e c t i o u s f o r m l o n g e n o u g h t o s u b s e q u e n t l y d i s s o c i a t e a n d b e i n o c u l a t e d i n t o a n e w h o s t p l a n t . P l a n t v i r u s e s , l i k e a n i m a l v i r u s e s , h a v e e v o l v e d m e c h a n i s m s t o u s e e x i s t i n g s t r u c t u r e s a n d p a t h w a y s a s s o c i a t e d w i t h t h e i r v e c t o r s ( o r h o s t s i n t h e c a s e o f a n i m a l v i r u s e s ) i n o r d e r t o p e r f o r m t h e t h r e e p h a s e s o f t h e t r a n s m i s s i o n p r o c e s s : a c q u i s i t i o n , r e t e n t i o n , a n d i n o c u l a t i o n ( G r a y , 1996; P i r o n e a n d B l a n c , 1 9 9 6 ) . 3 Table 1.1 P r i n c i p a l v e c t o r s o f p l a n t v i r u s g e n e r a a n d t h e i r m e c h a n i s m o f t r a n s m i s s i o n 1,2 Vector Virus Transmission Mechanism Aphids Thrips Beetles Mealybugs Leafhoppers Treehoppers Whiteflies Mites Nematodes Fungi Caulimovirus Faba virus Potyvirus Carlavirus Cucumovirus Alfamovirus Potexvirus Closterovirus Sequiviurs Trichovirus Waikavirus Luteovirus Nanavirus Umbravirus Enamovirus Machlomovirus Tospovirus Machlomovirus Bromo virus Carmovirus Comovirus Sobemovirus Tymovirus Badnavirus Closterovirus Trichovirus Badnavirus Waikavirus Monogeminivirus Marafivirus Phytoreovirus Hybrigeminivirus Closterovirus Bigemini virus Potexvirus Trichovirus Rymovirus Nepovirus Tobravirus Necrovirus Tombusvirus Aureusvirus Dianthovirus Varicosavirus Bymovirus Furovirus Non-circulative Circulative Non-circulative Circulative Non-circulative Circulative Non-circulative Non-circulative Circulative Circulative Non-circulative Circulative Non-circulative Non-circulative Non-circulative (In vitro) a Circulative (In vivo) This table was abstracted and modified from Gray and Rochon (1999). 2It should be noted that in some cases, not all members of a genus are transmitted by the indicated vector. 4 S e v e r a l m e c h a n i s m s o f p l a n t v i r u s t r a n s m i s s i o n h a v e b e e n p r o p o s e d b a s e d o n i n f o r m a t i o n f r o m s t u d i e s o v e r t h e l a s t 5 0 y e a r s ( G r a y a n d R o c h o n , 1999; C a m p b e l l , 1996; G r a y , 1996; P i r o n e a n d B l a n c , 1 9 9 6 ) . T h e s e m o d e l s o f t r a n s m i s s i o n r a n g e f r o m t h o s e b a s e d o n b i o l o g i c a l s t u d i e s t o m o r e r e c e n t o n e s u t i l i z i n g r e s u l t s o b t a i n e d f r o m m o l e c u l a r s t u d i e s . U l t i m a t e l y , a k n o w l e d g e o f t h e p r e c i s e s t r u c t u r e s o f v i r u s a n d v e c t o r w h i c h m e d i a t e t h e s p e c i f i c i t y o f t r a n s m i s s i o n at t h e m o l e c u l a r l e v e l w i l l a i d i n c l a r i f i c a t i o n o f t h e s e m o d e l s . E a r l y e x a m i n a t i o n s o f a p h i d - a n d l e a f h o p p e r - t r a n s m i s s i o n o f p l a n t v i r u s e s p r o d u c e d c r i t e r i a f o r v i r u s c l a s s i f i c a t i o n b a s e d o n t h e l e n g t h o f t i m e t h a t i n f e c t i v e v i r u s r e s i d e d i n t h e v e c t o r b e f o r e l o s i n g i t s a b i l i t y t o b e t r a n s m i t t e d t o a h e a l t h y p l a n t ( G r a y a n d R o c h o n , 1 9 9 9 ) . N o n - p e r s i s t e n t v i r u s e s a r e r e t a i n e d i n t h e i r v e c t o r f o r s e v e r a l h o u r s , s e m i - p e r s i s t e n t v i r u s e s f o r d a y s a n d s o m e t i m e s w e e k s , a n d p e r s i s t e n t v i r u s e s f o r t h e l i f e o f t h e v e c t o r ( G r a y a n d R o c h o n , 1 9 9 9 ) . N o n - p e r s i s t e n t a n d s e m i - p e r s i s t e n t v i r u s e s a r e a c q u i r e d a n d i n o c u l a t e d w i t h i n s e c o n d s o r m i n u t e s w h i l e p e r s i s t e n t v i r u s e s r e q u i r e h o u r s t o d a y s . T h e u s e o f t h e a b o v e c r i t e r i a t o c a t e g o r i z e v i r u s - v e c t o r a s s o c i a t i o n s b e c a m e p r o b l e m a t i c w i t h t h e d i s c o v e r y o f a d d i t i o n a l a r t h r o p o d , n e m a t o d e a n d f u n g a l v e c t o r s ( G r a y a n d R o c h o n , 1 9 9 9 ) . R e c e n t l y , p l a n t v i r u s e s w i t h k n o w n v e c t o r s h a v e b e e n d i v i d e d i n t o t w o c a t e g o r i e s b a s e d o n t h e i r m o d e o f t r a n s m i s s i o n : c i r c u l a t i v e o r n o n - c i r c u l a t i v e ( G r a y , 1 9 9 6 , T a b l e 1.1). C i r c u l a t i v e v i r u s e s a r e a c t i v e l y t r a n s p o r t e d a c r o s s v e c t o r m e m b r a n e s a n d s u r v i v e i n s i d e t h e v e c t o r . T h e s e v i r u s e s c a n f u r t h e r b e c h a r a c t e r i z e d i n t o p r o p a g a t i v e v i r u s e s , w h i c h r e p l i c a t e i n t h e i r a r t h r o p o d v e c t o r , a n d n o n - p r o p o g a t i v e v i r u s e s , w h i c h d o n o t ( G r a y a n d R o c h o n , 1 9 9 9 ) . N o n - c i r c u l a t i v e v i r u s e s a r e a s s o c i a t e d e x t e r n a l l y a n d d o n o t 5 c r o s s m e m b r a n e b a r r i e r s ( P i r o n e a n d B l a n c , 1 9 9 6 ) . T h e m a j o r i t y o f p l a n t v i r u s e s a r e n o t i n t e r n a l i z e d b y t h e i r v e c t o r s a n d t h e r e f o r e a r e c l a s s i f i e d as n o n - c i r c u l a t i v e . T h e c l a s s i f i c a t i o n o f v i r u s e s as e i t h e r c i r c u l a t i v e o r n o n - c i r c u l a t i v e c a n b e u s e d f o r a l l p l a n t v i r u s e s t h a t r e q u i r e a s p e c i f i c i n v e r t e b r a t e v e c t o r f o r s u r v i v a l i n n a t u r e ( G r a y a n d R o c h o n , 1 9 9 9 ) . H o w e v e r , t h e d e b a t e c o n t i n u e s as t o w h e t h e r t h e t e r m s c i r c u l a t i v e a n d n o n -c i r c u l a t i v e c a n b e u s e d t o d e s c r i b e v i r u s e s w i t h f u n g a l v e c t o r s ( G r a y a n d R o c h o n , 1999; C a m p b e l l , 1996; C a m p b e l l , 1993). It h a s b e e n a r g u e d t h a t t h e i n t e r a c t i o n b e t w e e n v i r u s e s a n d t h e i r f u n g a l v e c t o r s c a n n o t b e c h a r a c t e r i z e d as c i r c u l a t i v e / n o n - c i r c u l a t i v e b e c a u s e f u n g i h a v e n o c i r c u l a t o r y s y s t e m ( C a m p b e l l , 1 9 9 3 ) . T h e t e r m s in vitro a n d in vivo a c q u i s i t i o n a r e u s e d b y t h o s e i n t h e f i e l d t o d e s c r i b e t h e i n t e r a c t i o n b e t w e e n a v i r u s a n d i t s f u n g a l v e c t o r ( C a m p b e l l , 1 9 9 6 ) . In in vitro a c q u i s i t i o n , v i r u s c o m e s i n c o n t a c t w i t h i t s f u n g a l v e c t o r o u t s i d e t h e c e l l s o f l i v i n g p l a n t s a n d c a n s u r v i v e i n t h e s o i l i n d e p e n d e n t o f v e c t o r o r p l a n t . I n in vivo a c q u i s i t i o n , v i r u s i s a c q u i r e d w h i l e t h e f u n g u s i s w i t h i n p l a n t r o o t c e l l s a n d s u r v i v e s o n l y w i t h i n r e s t i n g s p o r e s ( C a m p b e l l , 1 9 9 3 ) . T h e t e r m p e r s i s t e n t ( c i r c u l a t i v e ) h a s b e e n u s e d t o r e f e r t o v i r u s e s t r a n s m i t t e d b y f u n g i i n t h e in vitro m a n n e r w i t h n o n - p e r s i s t e n t ( n o n - c i r c u l a t i v e ) f o r v i r u s e s a c q u i r e d in vivo ( T e a k l e , 1 9 8 3 ) . T h i s a n a l o g y h a s b e e n u s e d b y o t h e r s w i t h t h e c a u t i o n t h a t t h e c o m p a r i s o n i s n o t e n t i r e l y v a l i d d u e t o t h e d i f f e r e n c e s i n b i o l o g y b e t w e e n f u n g i a n d i n v e r t e b r a t e s ( A d a m s , 19 9 1 ) . T h e r e a p p e a r t o b e e n o u g h c o m m o n a l i t i e s b e t w e e n t r a n s m i s s i o n m e c h a n i s m s i n v o l v i n g i n v e r t e b r a t e s a n d f u n g i t o w a r r a n t t h e u s e o f c i r c u l a t i v e / n o n - c i r c u l a t i v e t o d e s c r i b e t h e i n t e r a c t i o n s o f a l l v i r u s e s w i t h t h e i r v e c t o r s as p r o p o s e d b y G r a y a n d R o c h o n ( 1 9 9 9 ) . H o w e v e r , t h e t e r m s in vitro a n d in vivo a r e n e c e s s a r y i n t h e d i s c u s s i o n o f f u n g u s 6 t r a n s m i s s i o n as t h e s e t e r m s g i v e a d d i t i o n a l a n d n e c e s s a r y i n f o r m a t i o n c o n c e r n i n g t h e f u n g a l l i f e - c y c l e a n d m o d e o f t r a n s m i s s i o n ( C a m p b e l l , 1 9 9 6 ) . T h e r e f o r e , b o t h sets o f t e r m s , c i r c u l a t i v e / n o n c i r c u l a t i v e a n d in vivo/in vitro, w i l l b e u s e d i n d i s c u s s i o n s o f f u n g u s t r a n s m i s s i o n i n t h i s t h e s i s . T h e f o l l o w i n g s e c t i o n s d e s c r i b e t h e b i o l o g y o f s p e c i f i c i n t e r a c t i o n s b e t w e e n i n v e r t e b r a t e a n d f u n g a l v e c t o r s w i t h t h e v i r u s e s t h e y t r a n s m i t , m o d e l s o f t r a n s m i s s i o n a r i s i n g f r o m t h i s i n f o r m a t i o n , a n d w h a t i s k n o w n at t h e m o l e c u l a r l e v e l o f t h e s e r e l a t i o n s . T h e i n t e r a c t i o n s o f i n v e r t e b r a t e v e c t o r s s u c h as a p h i d s , w h i t e f l i e s , a n d n e m a t o d e s w i t h t h e v i r u s e s t h e y t r a n s m i t w i l l b e e x a m i n e d i n d e t a i l s i n c e t h e m a j o r i t y o f r e s e a r c h i n t o p l a n t v i r u s t r a n s m i s s i o n h a s d e a l t w i t h t h e s e s y s t e m s . P a r a l l e l s c a n b e d r a w n b e t w e e n p l a n t v i r u s t r a n s m i s s i o n b y i n v e r t e b r a t e a n d f u n g a l v e c t o r s w i t h i n t h e b r o a d e r m o d e l s o f v e c t o r t r a n s m i s s i o n . •1.2.1 A r t h r o p o d t r a n s m i s s i o n A t l e a s t 7 0 % o f p l a n t v i r u s e s a r e k n o w n t o b e t r a n s m i t t e d b y a r t h r o p o d s ( v a n d e n H e u v e l et al., 1 9 9 9 ) . K u n k e l ( 1 9 2 2 ) w a s t h e f i r s t t o r e p o r t t r a n s m i s s i o n o f a v i r u s b y a n i n s e c t ; i n t h i s c a s e t h e t r a n s m i s s i o n o f y e l l o w s t r i p e d i s e a s e b y a p l a n t h o p p e r . T w o c l a s s e s o f t h e A r t h r o p o d a c o n t a i n m e m b e r s w i t h v i r u s v e c t o r s , t h e I n s e c t a a n d A r a c h n i d a ( M a t t h e w s , 1 9 9 1 ) . T h e m a j o r c l a s s i m p o r t a n t f o r p l a n t v i r u s t r a n s m i s s i o n i s t h e I n s e c t a , c o n t a i n i n g t h e o r d e r H o m o p t e r a w h i c h f e e d b y s u c k i n g o n g r e e n p l a n t s a n d i n c l u d e s a p h i d s , w h i t e f l i e s , h o p p e r s , a n d m e a l y b u g s ( M a t t h e w s , 1 9 9 1 ) . I n t h e f o l l o w i n g s e c t i o n , t h e m e c h a n i s m s b y w h i c h i n s e c t s i n t h e H o m o p t e r a t r a n s m i t p l a n t v i r u s e s w i l l b e d e s c r i b e d . 7 N o n - c i r c u l a t i v e a p h i d t r a n s m i s s i o n T h e m a j o r i t y o f t h e 2 5 0 k n o w n a p h i d - t r a n s m i t t e d v i r u s e s a r e t r a n s m i t t e d i n a n o n -c i r c u l a t i v e m a n n e r ( M a t t h e w s , 1 9 9 1 ) . A s p r e v i o u s l y d i s c u s s e d , n o n - c i r c u l a t i v e v i r u s e s d o n o t c r o s s m e m b r a n e b a r r i e r s i n t h e i r v e c t o r a n d s o a r e d e s c r i b e d as a s s o c i a t i n g e x t e r n a l l y ( P i r o n e a n d B l a n c , 1 9 9 6 ) . I n t h e c a s e o f a p h i d s , n o n - c i r c u l a t i v e t r a n s m i s s i o n r e f e r s t o v i r u s e s w h i c h a r e r e t a i n e d i n t h e a p h i d s t y l e t s ( m o u t h p a r t s ) a f t e r f e e d i n g p r o b e s o n i n f e c t e d p l a n t s . V i r u s c a n a l s o b e f o u n d i n t h e a p h i d f o o d c a n a l a n d f o r e g u t b u t d o e s n o t c r o s s m e m b r a n e b a r r i e r s i n t h e a p h i d a n d t h e r e f o r e d o e s n o t e n t e r t h e a p h i d h e m o c o e l ( c i r c u l a t o r y s y s t e m ) . T h e r e t e n t i o n o f v i r i o n s i n t h e a p h i d s t y l e t i s a s p e c i f i c p r o c e s s ( d i s c u s s e d i n t h e f o l l o w i n g s e c t i o n ) i m p l y i n g t h a t s p e c i f i c m o l e c u l e s i n t h e s t y l e t s as w e l l as s p e c i f i c r e g i o n s o f t h e v i r u s p a r t i c l e a r e i n v o l v e d i n t r a n s m i s s i o n . V i r u s r e t e n t i o n A f t e r l a n d i n g o n l e a v e s , a p h i d s m a k e b r i e f p r o b e s t o test t h e s u i t a b i l i t y o f t h e f o o d s o u r c e ( M a t t h e w s , 19 9 1 ) . A p h i d - t r a n s m i s s i o n h a s b e e n s h o w n t o o c c u r d u r i n g b r i e f i n t r a c e l l u l a r f e e d i n g p r o b e s o f 5-10 s e c o n d s o n p l a n t e p i d e r m a l o r m e s o p h y l l c e l l s ( P o w e l l , 1 9 9 1 ; P o l l a r d , 1 9 7 3 ) . S a p s a m p l i n g o n v i r u s - i n f e c t e d p l a n t s c o n t a m i n a t e s t h e a p h i d s t y l e t t i p s , f o o d c a n a l , a n d f o r e g u t w i t h v i r u s ( M a t t h e w s , 19 9 1 ) . A q u e s t i o n d e b a t e d i n r e c e n t y e a r s c o n c e r n s t h e s i t e o f v i r u s i n o c u l u m r e t e n t i o n i n t h e a p h i d . Is t h e s t y l e t , f o o d c a n a l , a n d / o r f o r e g u t t h e p r i m a r y r e s e r v e o f i n f e c t i o u s v i r i o n s f o r n o n -c i r c u l a t i v e t r a n s m i s s i o n b y a p h i d s ? H o g g a n ( 1 9 3 3 ) w a s t h e f i r s t t o s u g g e s t t h a t v i r i o n s i n t h e s t y l e t s p l a y a s i g n i f i c a n t r o l e i n n o n - c i r c u l a t i v e t r a n s m i s s i o n . L a t e r , i t w a s d e m o n s t r a t e d t h a t t h e a b i l i t y o f a p h i d s 8 t o t r a n s m i t P V Y i s r e d u c e d b y c h e m i c a l a n d p h y s i c a l t r e a t m e n t s o f a p h i d s t y l e t t i p s ( B r a d l e y , 1 9 6 4 ) . M e m b r a n e f e e d i n g e x p e r i m e n t s w i t h d y e s s h o w e d t h a t a p h i d s h a v e t h e a b i l i t y t o t r a n s f e r v i r u s f r o m i n f e c t e d t o h e a l t h y p l a n t s v i a a r e g u r g i t a t i o n m e c h a n i s m ( H a r r i s a n d B a t h , 1 9 7 3 ) . B a s e d o n t h i s w o r k , a n ' i n g e s t i o n - e g e s t i o n ' m o d e l o f n o n - c i r c u l a t i v e a p h i d t r a n s m i s s i o n w a s s u g g e s t e d w h e r e v i r u s a c q u i s i t i o n o c c u r s d u r i n g i n g e s t i o n o f p l a n t c e l l c o n t e n t s f o l l o w e d b y i n o c u l a t i o n d u r i n g r e g u r g i t a t i o n o f p r e v i o u s l y i n g e s t e d s a p f r o m t h e a l i m e n t a r y c a n a l a n d f o r e g u t ( H a r r i s , 1 9 7 7 ) . T h i s h y p o t h e s i s i s w i d e l y a c c e p t e d a n d g i v e s t h e i m a g e o f a p h i d s as ' f l y i n g s y r i n g e s ' a c t i v e l y c o n t r i b u t i n g t o a c q u i s i t i o n a n d r e l e a s e o f v i r u s . T h e a p h i d - l o c a t i o n o f v i r i o n s i n v o l v e d i n t r a n s m i s s i o n w a s s t u d i e d b y W a n g et al. ( 1 9 9 6 ) . O f 5 2 3 a p h i d s f e d 1 2 5 I - l a b e l l e d T E V - H A T ( a h i g h l y t r a n s m i s s i b l e i s o l a t e o f Tobacco etch virus), 4 8 % r e t a i n e d l a b e l i n t h e s t y l e t s v e r s u s 0 . 7 7 % f e d T E V - N A T ( n o t t r a n s m i s s i b l e ) . It w a s c o n c l u d e d t h a t v i r i o n s r e t a i n e d w i t h i n t h e f o o d c a n a l ( d i s t a l t h i r d ) o f t h e s t y l e t s w e r e t h o s e w h i c h w e r e p r i m a r i l y i n v o l v e d i n p o t y v i r u s t r a n s m i s s i o n ( W a n g etal., 1 9 9 6 ) . C o a t p r o t e i n T h e r e i s a h i g h d e g r e e o f s p e c i f i c i t y i n t h e i n t e r a c t i o n b e t w e e n n o n c i r c u l a t i v e v i r u s e s a n d t h e i r a p h i d v e c t o r s ( K e n n e d y et al., 1962; M a t t h e w s , 1 9 9 1 ) . S t r a i n s o f t h e s a m e v i r u s m a y d i f f e r i n e f f i c i e n c y o f t r a n s m i s s i o n b y a p a r t i c u l a r a p h i d s p e c i e s . I n a d d i t i o n , a p h i d s p e c i e s v a r y w i d e l y i n t h e n u m b e r o f d i f f e r e n t v i r u s e s t h e y t r a n s m i t . T h i s s p e c i f i c i t y i s b e s t e x p l a i n e d b y s p e c i f i c a d s o r p t i o n b e t w e e n v i r u s e s a n d r e c e p t o r o r r e c e p t o r - l i k e s i t e s i n t h e a p h i d f o o d c a n a l ( W a t s o n a n d P l u m b , 1 9 7 2 ) . 9 T h e m a j o r i t y o f w o r k t h u s f a r h a s f o c u s e d o n t h e v i r u s p a r t i c l e , n a m e l y t h e v i r a l c o a t p r o t e i n ( C P ) , a n d i t s r o l e i n t h e s p e c i f i c i t y o f t r a n s m i s s i o n . N o n - t r a n s m i s s i b l e v i r u s v a r i a n t s h a v e b e e n d e s c r i b e d f o r s e v e r a l v i r u s - v e c t o r c o m b i n a t i o n s a f t e r s e r i a l p a s s a g i n g i n t h e a b s e n c e o f t h e v e c t o r , i.e. d i r e c t l y f r o m p l a n t t o p l a n t v i a m e c h a n i c a l i n o c u l a t i o n ( G r a y , 1 9 9 6 ) . F o r s o m e o f t h e s e v a r i a n t s i t w a s f o u n d t h a t t h e C P o f t h e n o n -t r a n s m i s s i b l e v a r i a n t s w a s d i f f e r e n t f r o m t h a t o f t h e t r a n s m i s s i b l e v i r u s . C o m p a r i s o n s o f C P a m i n o a c i d s e q u e n c e s b e t w e e n t r a n s m i s s i b l e a n d n o n -t r a n s m i s s i b l e p o t y v i r u s e s s h o w e d c h a n g e s i n a n A s p - A l a - G l y ( D A G ) t r i p l e t as a c o n s i s t e n t f e a t u r e o f n o n - t r a n s m i s s i b l e p o t y v i r u s i s o l a t e s ( H a r r i s o n a n d R o b i n s o n , 1 9 8 8 ) . It w a s h y p o t h e s i z e d t h a t t h e p o t y v i r u s D A G s e q u e n c e w a s i n v o l v e d i n b i n d i n g o f v i r i o n s t o a p h i d m o u t h p a r t s ( H a r r i s o n a n d R o b i n s o n , 1 9 8 8 ) . I n t h i s m o d e l , v i r i o n r e l e a s e f o r i n o c u l a t i o n o c c u r r e d b y c l e a v a g e o f t h e N - t e r m i n u s o f t h e c o a t p r o t e i n b y t r y p s i n - l i k e e n z y m e s i n t h e s a l i v a o f t h e a p h i d . T h e N - t e r m i n u s o f t h e C P o f p o t y v i r u s e s i s e x p o s e d o n t h e p a r t i c l e s u r f a c e ( A l l i s o n et al., 1985; S h u k l a et ah, 1 9 8 8 ) . E n z y m a t i c r e m o v a l o f t h e C P N - t e r m i n a l d o m a i n h a s b e e n s h o w n t o r e s u l t i n t h e l o s s o f a p h i d t r a n s m i s s i b i l i t y ( S a l o m o n , 1 9 8 9 ) . D i r e c t e v i d e n c e t h a t t h e D A G s e q u e n c e i s i m p o r t a n t f o r n o n - c i r c u l a t i v e a p h i d t r a n s m i s s i o n o f p o t y v i r u s e s w a s p r o v i d e d i n e x p e r i m e n t s w h e r e c D N A o f t h e C P g e n e f r o m a n o n - t r a n s m i s s i b l e i s o l a t e o f Tobacco vein mottling virus ( T V M V ) ( w i t h a m u t a t i o n i n t h e D A G m o t i f ) w a s c l o n e d i n p l a c e o f t h e C P g e n e o f a t r a n s m i s s i b l e T V M V i s o l a t e c o n t a i n i n g t h e D A G m o t i f ( A t r e y a et al, 1 9 9 0 ) . T h e t r a n s c r i b e d R N A w a s i n o c u l a t e d o n t o t o b a c c o p l a n t s a n d a p h i d s w e r e u n a b l e t o t r a n s m i t t h e r e s u l t a n t D A G m u t a n t ( A t r e y a et al, 1 9 9 0 ) . 10 F u r t h e r s t u d i e s s h o w e d t h a t d e l e t i o n o f t h e D A G t r i p l e t f r o m a p o t y v i r a l C P r e s u l t e d i n t h e l o s s o f a p h i d t r a n s m i s s i b i l i t y ( A t r e y a et ah, 1 9 9 1 ) . D e l e t i o n o f e a c h i n d i v i d u a l a m i n o a c i d o f D A G h a d a s i m i l a r e f f e c t . L a t e r , s e v e r a l s u b s t i t u t i o n s w e r e i n t r o d u c e d b y s i t e - d i r e c t e d m u t a g e n e s i s i n a n d a r o u n d t h e D A G m o t i f ( e x p a n d e d t o D A G X b a s e d o n t h e e f f e c t o f c h a n g i n g r e s i d u e s i n c l o s e p r o x i m i t y t o D A G ) t o d e t e r m i n e a m i n o a c i d s n e c e s s a r y a n d s u f f i c i e n t f o r t r a n s m i s s i o n ( A t r e y a et al., 1 9 9 5 ) . I n t h e f i r s t p o s i t i o n A s p o r A s n a r e r e q u i r e d , i n t h e s e c o n d p o s i t i o n o n l y A l a g i v e s t r a n s m i s s i o n , a n d i n t h e t h i r d p o s i t i o n G l y a p p e a r s c r i t i c a l f o r t r a n s m i s s i o n . S t u d i e s h a v e s h o w n t h a t t h e C P i s s u f f i c i e n t f o r t h e t r a n s m i s s i o n o f c u c u m o v i r u s e s [the t y p e m e m b e r Cucumber mosaic virus ( C M V ) b e i n g t h e m o s t s t u d i e d ( C h e n a n d F r a n c k i , 1 9 9 0 ) ] . P r o p e r t i e s o f t h e C M V C P a f f e c t v a r i a b i l i t y i n t r a n s m i s s i o n e f f i c i e n c y o f t h e v i r u s ( G e r a et al., 1979; P e r r y et al., 1 9 9 8 ) . T h i s n a t u r a l l y o c c u r i n g v a r i a b i l i t y m a y b e s e l e c t e d f o r b y r e p e a t e d m e c h a n i c a l p a s s a g e o f t h e v i r u s i n t h e a b s e n c e o f t h e a p h i d v e c t o r . M u t a g e n e s i s s t u d i e s h a v e i n d i c a t e d t h a t s i n g l e a m i n o a c i d c h a n g e s i n t w o r e g i o n s o f t h e C M V C P c a n a b o l i s h i t s a b i l i t y t o b e a p h i d - t r a n s m i t t e d ( P e r r y et al., 1 9 9 4 ) . S u c h c h a n g e s m a y d i r e c t l y o r i n d i r e c t l y a f f e c t t h e a b i l i t y o f C M V t o i n t e r a c t w i t h i t s v e c t o r . N o l i n e a r a m i n o a c i d s e q u e n c e m o t i f s s u c h as t h e D A G X o f p o t y v i r u s e s h a v e b e e n i d e n t i f i e d f o r C M V . R e p e a t e d m e c h a n i c a l p a s s a g e p r o d u c e d a m u t a n t t h a t i s o n l y t r a n s m i s s i b l e b y o n e o f t h e t w o a p h i d s p e c i e s n o r m a l l y t r a n s m i t t i n g C M V ( N g a n d P e r r y , 1 9 9 9 ) . H e l p e r c o m p o n e n t A p h i d t r a n s m i s s i o n o f p o t y v i r u s e s r e q u i r e s a f u n c t i o n a l v i r a l l y - e n c o d e d n o n -s t r u c t u r a l h e l p e r c o m p o n e n t ( H C - P r o ) p r o t e i n ( G o v i e r a n d K a s s a n i s , 1974; T h o r n b u r y et 11 al., 1985; r e v i e w e d b y P i r o n e a n d B l a n c , 1 9 9 6 ) . H C - P r o a c t i v i t y i s e x c h a n g e a b l e a m o n g p o t y v i r u s s p e c i e s w i t h d i f f e r i n g d e g r e e s o f s p e c i f i c i t y ( P i r o n e , 1 9 8 1 ; S a k o a n d O g a t a , 1 9 8 1 ) . O n e h y p o t h e s i s f o r t h e f u n c t i o n o f t h e p o t y v i r a l H C - P r o i n n o n - c i r c u l a t i v e a p h i d t r a n s m i s s i o n i s t h a t i t m e d i a t e s t h e b i n d i n g o f v i r u s t o s i t e s w i t h i n t h e a p h i d a l i m e n t a r y c a n a l ( B e r g e r a n d P i r o n e , 1 9 8 6 ) . V i r u s - l i k e p a r t i c l e s h a v e b e e n o b s e r v e d i n a m a t r i x a s s o c i a t e d w i t h t h e s t y l e t s a n d f o r e g u t o f a p h i d s f e d o n a m i x t u r e o f v i r u s a n d H C - P r o . N o b o u n d p a r t i c l e s w e r e o b s e r v e d w h e n a p h i d s w e r e f e d o n v i r u s a l o n e o r w h e n v i r a l o r H C - P r o m u t a n t s i n c o m p e t e n t f o r a p h i d t r a n s m i s s i o n w e r e u s e d ( A m m a r et al, 1 9 9 4 ) . T h e a c t i o n o f H C - P r o c o u l d b e d i r e c t , b y l i n k i n g v i r u s v i a t h e C P D A G X s e q u e n c e t o t h e a p h i d ( b r i d g e h y p o t h e s i s ) , o r i n d i r e c t , b y m o d i f y i n g c o m p o u n d s i n t h e a p h i d t o a l l o w v i r u s b i n d i n g ( P i r o n e , 1 9 9 1 ) . T o test w h e t h e r t h e N - t e r m i n u s o f a p o t y v i r u s C P , w h i c h c o n t a i n s t h e D A G X m o t i f d e s c r i b e d a b o v e , w a s i n v o l v e d i n v i r u s r e t e n t i o n i n a p h i d s , r e c o m b i n a n t p r o t e i n c o n t a i n i n g t h e a m i n o - t e r m i n a l r e g i o n o f Maize dwarf mosaic potyvirus ( M D M V ) w a s f e d t o a p h i d s b e f o r e f e e d i n g t h e m M D M V v i r i o n s a n d H C - P r o ( S a l o m o n a n d B e r n a r d i , 1 9 9 5 ) . A p h i d t r a n s m i s s i o n o f M D M V w a s s i g n i f i c a n t l y r e d u c e d i n t h e s e e x p e r i m e n t s . T h e s e d a t a s u g g e s t e d t h a t t h e r e c o m b i n a n t p r o t e i n c o m p e t e d w i t h v i r u s - b i n d i n g s i t e s i n t h e a p h i d , p r e v e n t i n g s u b s e q u e n t v i r u s b i n d i n g . S a l o m o n a n d B e r n a r d i ( 1 9 9 5 ) h y p o t h e s i z e d t h a t t h e a m i n o - t e r m i n a l r e g i o n o f t h e C P , r a t h e r t h a n H C - P r o , a t t a c h e s t o s i t e s a l o n g t h e a p h i d f o o d c a n a l a n d t h a t H C - P r o m e d i a t e s a c o n f o r m a t i o n a l c h a n g e i n t h e c o a t p r o t e i n a l l o w i n g t h e b i n d i n g o f v i r u s t o a p h i d . 12 C u r r e n t e v i d e n c e s u p p o r t s t h e h y p o t h e s i s t h a t H C - P r o a c t s as a ' b r i d g e ' b e t w e e n v i r u s p a r t i c l e a n d a p h i d i n s t e a d o f m e d i a t i n g a c o n f o r m a t i o n a l c h a n g e i n v i r u s C P . I n t h i s m o d e l , H C - P r o b i n d s t o b o t h v i r u s p a r t i c l e a n d t h e s t y l e t f o o d c a n a l , a l l o w i n g v i r i o n s t o b e r e t a i n e d i n t h e s t y l e t s w h e r e t h e y a r e a v a i l a b l e t o b e i n o c u l a t e d i n t o n e w h o s t s ( P i r o n e a n d B l a n c , 1996; W a n g et a l . , 1 996; B l a n c et a l . , 1 9 9 7 ) . B l a n c et al. ( 1 9 9 7 ) s h o w e d a d i r e c t in vitro a s s o c i a t i o n b e t w e e n a p o t y v i r a l H C - P r o a n d t h e C P o f t r a n s m i s s i b l e s t r a i n s , w h e r e n o n - f u n c t i o n a l C P s ( m u t a t e d i n D A G ) f a i l e d t o b i n d H C - P r o . T h e p o s s i b l e r o l e o f H C - P r o i n v e c t o r s p e c i f i c i t y w a s f i r s t s u g g e s t e d b y t h e w o r k o f S a k o et al. ( 1 9 8 4 ) . L a t e r , W a n g et al. ( 1 9 9 8 ) p r o v i d e d d i r e c t e v i d e n c e t h a t t h e s p e c i f i c i t y a n d e f f i c i e n c y o f p o t y v i r u s t r a n s m i s s i o n i s r e g u l a t e d b y H C - P r o . P u n c t u r e s o f t h e e p i d e r m a l p l a s m a l e m m a b y t h e m a x i l l a r y s t y l e t t i p s c a n b e r e c o r d e d as d r o p s i n e l e c t r i c a l p o t e n t i a l ( T j a l l i n g i i , 1 9 8 5 ) . E l e c t r i c a l l y r e c o r d e d i n t r a c e l l u l a r s t y l e t a c t i v i t i e s a p p e a r e d t o b e q u a l i t a t i v e l y s i m i l a r f o r a l l t h r e e a p h i d s p e c i e s e x a m i n e d , i n d i c a t i n g t h a t a p h i d b e h a v i o u r w a s n o t r e s p o n s i b l e f o r t h e d i f f e r e n c e s i n v i r u s t r a n s m i s s i b i l i t y b e t w e e n a p h i d s p e c i e s ( W a n g et al, 1 9 9 8 ) . I n e x p e r i m e n t s t o test t h e h y p o t h e s i s t h a t t h e s o u r c e o f H C - P r o w a s r e s p o n s i b l e f o r t h e d i f f e r e n t i a l a b i l i t y o f L. erysimi t o t r a n s m i t T E V a n d T u M V a n d f o r t h e l e s s e f f i c i e n t t r a n s m i s s i o n o f T u M V b y A. gossypii, a p h i d s w e r e a l l o w e d t o a c q u i r e h e t e r o l o g o u s a n d h o m o l o g o u s v i r i o n - H C - P r o c o m b i n a t i o n s ( W a n g et al, 1 9 9 8 ) . L. erysimi w a s u n a b l e t o t r a n s m i t T E V f r o m i n f e c t e d p l a n t s o r m i x t u r e s w i t h P V Y H C - P r o b u t c o u l d t r a n s m i t T E V at a l e v e l c o m p a r a b l e t o Af. persicae w h e n t h e v i r u s w a s a c q u i r e d i n t h e p r e s e n c e o f t h e T u M V H C - P r o , i n d i c a t i n g t h a t H C - P r o c a n r e g u l a t e t r a n s m i s s i o n s p e c i f i c i t y ( W a n g etal, 1 9 9 8 ) . A c o r r e l a t i o n w a s a l s o s h o w n f o r r e t e n t i o n 13 o f v i r u s i n t h e a p h i d s t y l e t s w i t h t r a n s m i s s i o n , f u r t h e r s t r e n g t h e n i n g t h e i d e a t h a t d i f f e r e n c e s i n r e t e n t i o n e x p l a i n d i f f e r e n c e s i n t r a n s m i s s i o n ( W a n g et al, 1 9 9 8 ) . C o m p a r i s o n s o f H C - P r o s e q u e n c e s f r o m s e v e r a l t r a n s m i s s i b l e a n d n o n -t r a n s m i s s i b l e p o t y v i r u s e s h a v e i d e n t i f i e d t w o h i g h l y c o n s e r v e d d o m a i n s , t h e l y s i n e -i s o l e u c i n e - t h r e o n i n e - c y s t e i n e ( K T T C ) d o m a i n ( T h o r n b u r y et al, 1 9 9 0 ) a n d t h e p r o l i n e -t h r e o n i n e - l y s i n e ( P T K ) d o m a i n ( G r a n i e r et al, 1 9 9 3 ) . A c h a n g e f r o m K to E i n t h e K T T C m o t i f o f t h e H C - P r o o f T V M V r e s u l t e d i n l o s s o f H C - P r o a c t i v i t y ( A t r e y a et al, 1 9 9 2 ) . A s u b s t i t u t i o n o f t h e T t o A i n t h e P T K m o t i f o f Z Y M V H C - P r o v i r t u a l l y e l i m i n a t e d H C -P r o a c t i v i t y ( H u e t et al, 1 9 9 4 ) . It w a s h y p o t h e s i z e d t h a t t h e K T T C m o t i f i s i n v o l v e d i n b i n d i n g o f H C - P r o t o t h e a p h i d m o u t h p a r t s w h i l e t h e P T K m o t i f m a y b i n d t o t h e v i r i o n s ( P e n g etal, 1 9 9 8 ) . T r a n s m i s s i o n o f c a u l i m o v i r u s e s a l s o r e q u i r e s a n o n s t r u c t u r a l v i r a l l y - e n c o d e d h e l p e r ( B l a n c et al, 1 9 9 3 ) . S t u d i e s h a v e s h o w n t h a t t h e c a r b o x y l - t e r m i n u s o f t h e Cauliflower mosaic virus ( C a M V ) h e l p e r f a c t o r ( o r a p h i d t r a n s m i s s i o n f a c t o r ) b i n d s c o a t p r o t e i n in vitro ( B l a n c et al, 1993; S c h m i d t et al, 1 9 9 4 ) . T h e s e s t u d i e s a r e c o n s i s t e n t w i t h t h e h y p o t h e s i s t h a t t h e C a M V h e l p e r f a c t o r m e d i a t e s b i n d i n g o f C P t o i n s e c t m o u t h p a r t s . C i r c u l a t i v e a p h i d t r a n s m i s s i o n C i r c u l a t i v e p l a n t v i r u s e s m u s t c r o s s m e m b r a n e b a r r i e r s i n t h e v e c t o r t o b e t r a n s m i t t e d t o n e w h o s t p l a n t s . L u t e o v i r u s e s a r e c i r c u l a t i v e , n o n - p r o p a g a t i v e p l a n t v i r u s e s w h i c h a r e t r a n s m i t t e d b y a p h i d s ( G r a y et al, 1 9 9 1 ; P o w e r etal, 1 9 9 1 ) . V i r i o n s a r e i s o m e t r i c a n d c o n t a i n a s i n g l e - s t r a n d e d v i r a l g e n o m i c R N A . L u t e o v i r u s e s h a v e a h i g h l e v e l o f v e c t o r s p e c i f i c i t y , w i t h g r e a t e r t h a n 2 0 s p e c i e s o f a p h i d s r e p o r t e d as v e c t o r s , b u t 14 o n l y o n e o r a f e w s p e c i e s o f a p h i d h a v i n g t h e a b i l i t y t o t r a n s m i t a n y o n e l u t e o v i r u s ( J e d l i n s k i , 1 9 8 1 ; G i l d o w a n d G r a y , 1 9 9 3 ) . C o a t p r o t e i n V i r u s t r a n s c a p s i d a t i o n s t u d i e s s u g g e s t e d t h a t v e c t o r s p e c i f i c i t y o f t h e M A V a n d R P V i s o l a t e s o f Barley yellow dwarf luteovirus ( B Y D V ) w a s a f u n c t i o n o f t h e v i r u s c a p s i d ( R o c h o w , 19 7 0 ) . I n t h e s e e x p e r i m e n t s s o m e M A V n u c l e i c a c i d b e c a m e c o a t e d w i t h R P V c o a t p r o t e i n d u r i n g c o - i n f e c t i o n o f a s i n g l e p l a n t . M A V c o u l d t h e n b e t r a n s m i t t e d b y R. padi, w h i c h n o r m a l l y o n l y t r a n s m i t t e d R P V . M A V r e p l i c a t i o n w a s d e t e c t e d i n t h e n e w h o s t p l a n t b u t t h i s v i r u s c o u l d n o t b e t r a n s m i t t e d b y R. padi. T h e s e r e s u l t s s u g g e s t e d t h a t a n i n t e r a c t i o n b e t w e e n t h e v i r u s c a p s i d a n d s p e c i f i c s i t e s w i t h i n t h e a p h i d a r e t h e m a j o r d e t e r m i n a n t s f o r B Y D V - v e c t o r s p e c i f i c i t y ( R o c h o w , 1 9 7 0 ) . T h e l u t e o v i r u s p a r t i c l e i s c o m p o s e d o f t w o c a p s i d p r o t e i n s ( J o l l y a n d M a y o , 19 9 4 ) . F r o m n u c l e o t i d e s e q u e n c e a n a l y s i s , o p e n r e a d i n g f r a m e 3 ( O R F 3), e n c o d i n g t h e C P , i s f o l l o w e d i n - f r a m e b y a l a r g e r 3 ' - t e r m i n a l O R F 5. O R F 5 i s e x p r e s s e d b y r e a d t h r o u g h o f t h e t e r m i n a t i o n c o d o n o f O R F 3, a p r o c e s s w h i c h r e s u l t s i n t h e f o r m a t i o n o f C P s u b u n i t s w i t h a d d i t i o n a l s e q u e n c e at t h e C - t e r m i n u s t e r m e d t h e r e a d t h r o u g h d o m a i n ( R T D ) ( J o l l y a n d M a y o , 199 4 ) . V i r u s p a r t i c l e s o f s e v e r a l l u t e o v i r u s e s w e r e f o u n d t o c o n t a i n s o m e C P m o l e c u l e s w i t h R T D a t t a c h e d ( J o l l y a n d M a y o , 199 4 ) . T h e R T D i s e x p o s e d o n t h e s u r f a c e o f t h e l u t e o v i r u s p a r t i c l e i n a C - t e r m i n a l l y t r u n c a t e d f o r m ( B r a u l t et al., 1 9 9 5 ) a n d i s p r o p o s e d t o b e i n v o l v e d i n a p h i d t r a n s m i s s i o n ( V i n c e n t et al., 1 9 9 0 ) . T r u n c a t e d R T D p r o t e i n h a s b e e n d e t e c t e d i n p u r i f i e d v i r u s a n d c r u d e e x t r a c t s o f p l a n t s a n d p r o t o p l a s t s i n f e c t e d w i t h s e v e r a l l u t e o v i r u s e s ( B a h n e r et al., 1990; M a r t i n et al., 1 9 9 0 ; F i l i c h k i n et al., 1994; W a n g 15 et al, 1 9 9 5 ) , s u g g e s t i n g t h a t R T D c l e a v a g e i s d u e t o a c o n s e r v e d p r o c e s s i n g e v e n t a n d n o t t o r a n d o m d e g r a d a t i o n . I n s e q u e n c e c o m p a r i s o n s b e t w e e n a h i g h l y t r a n s m i s s i b l e a n d a p o o r l y t r a n s m i s s i b l e l u t e o v i r u s , i t w a s f o u n d t h a t t h e m a j o r i t y o f d i f f e r e n c e s o c c u r r e d i n t h e C -t e r m i n a l h a l f o f t h e R T D ( J o l l y a n d M a y o , 1 9 9 4 ) . A m i n o a c i d s e q u e n c e a l i g n m e n t s b e t w e e n s i x l u t e o v i r u s C P s s h o w e d a h i g h e r d e g r e e o f h o m o l o g y i n t h e N - t e r m i n u s o f t h e r e a d t h r o u g h d o m a i n ( R T D ) t h a n i n t h e C - t e r m i n u s ( G u i l l e y et al., 1 9 9 4 ) . T h e s e r e s u l t s r a i s e t h e h y p o t h e s i s t h a t t h e N - t e r m i n u s o f t h e R T D i s i n v o l v e d i n n o n - s p e c i f i c a s p e c t s o f t r a n s m i s s i o n w h i l e t h e C - t e r m i n u s c o n t a i n s t h e d e t e r m i n a n t s f o r v e c t o r s p e c i f i c i t y . A p h i d t r a n s m i s s i o n o f a l u t e o v i r u s w a s r e d u c e d b y d e l e t i n g t h e C - t e r m i n a l h a l f o f i t s R T D , i n d i c a t i n g t h a t t h e R T D p l a y s a r o l e i n t r a n s m i s s i o n ( B r a u l t et al., 1 9 9 5 ) . It w a s s h o w n t h a t R T D - d e f i c i e n t v i r u s i s n o t a p h i d t r a n s m i s s i b l e ( C h a y et al., 1 9 9 6 ) . I n b o t h s t u d i e s , R T D m u t a n t s s h o w e d r e d u c e d a c c u m u l a t i o n i n p l a n t c e l l s s o i t i s p o s s i b l e t h a t t h e l a c k o f t r a n s m i s s i o n o f at l e a s t s o m e o f t h e m u t a n t s w a s d u e t o l o w v i r u s t i t e r r a t h e r t h a n t o a s p e c i f i c d e f e c t i n t r a n s m i s s i o n . D o m a i n s i n t h e l u t e o v i r u s C P a r e s u f f i c i e n t f o r a c q u i s i t i o n o f v i r u s t h r o u g h t h e h i n d g u t e p i t h e l i u m s i n c e v i r u s m u t a n t s w i t h o u t a R T D c a n b e a c q u i r e d i n t h i s m a n n e r ( C h a y et al., 1 9 9 6 ) . T h e f u n c t i o n s o f d i f f e r e n t r e g i o n s o f t h e R T D w e r e e x a m i n e d b y p r o d u c i n g s h o r t i n - f r a m e d e l e t i o n s a l o n g t h e R T D ( B r u y e r e et al, 1 9 9 7 ) . A p r e l i m i n a r y m a p o f f u n c t i o n s o f d i f f e r e n t p a r t s o f t h e R T D w a s p r o d u c e d b u t t h e a s s o c i a t i o n o f m u l t i p l e a n d p o t e n t i a l l y i n t e r a c t i n g f u n c t i o n s o f t h e R T D m a k e h i g h - r e s o l u t i o n a n a l y s i s o f t h i s p r o t e i n d i f f i c u l t ( B r u y e r e et al, 1 9 9 7 ) . 16 C h a p e r o n i n s C h a p e r o n i n s h a v e b e e n p r o p o s e d t o p l a y a r o l e i n a p h i d t r a n s m i s s i o n o f l u t e o v i r u s e s , p o l e r o v i r u s e s , e n a m o v i r u s e s ( v a n d e n H e u v e l et al, 1994, 1 9 9 7 ; F i l i c h k i n et al., 1 9 9 7 ) a n d m o r e r e c e n t l y i n w h i t e f l y t r a n s m i s s i o n o f t o m a t o y e l l o w l e a f c u r l b e g o m o v i r u s ( M o r i n et al., 1 9 9 9 ) . C h a p e r o n i n s b i n d t o a n d s t a b i l i z e n e w l y t r a n s l a t e d o r t r a n s l o c a t e d a g g r e g a t i o n - p r o n e p r o t e i n s a n d a i d i n t h e i r f o l d i n g a n d a s s e m b l y v i a a n A T P -d e p e n d a n t p r o c e s s ( H a i t i , 1 9 9 6 ) . T h e l u t e o v i r u s R T D d e t e r m i n e s i t s i n t e r a c t i o n w i t h a G r o E L h o m o l o g u e ( s y m b i o n i n ) , a c h a p e r o n i n s e c r e t e d i n t o t h e a p h i d h e m o c o e l b y t h e e n d o s y m b i o t i c b a c t e r i u m , Buchnera ( v a n d e n H e u v e l et al, 1 9 9 7 ) . V i r i o n s w i t h o u t a R T D a r e s i g n i f i c a n t l y l e s s p e r s i s t e n t a f t e r i n j e c t i o n i n t o t h e a p h i d h e m o l y m p h t h a n w i l d -t y p e v i r u s ( v a n d e n H e u v e l et al, 1 9 9 7 ) . T r e a t m e n t o f a p h i d l a r v a e w i t h a n t i b i o t i c s s i g n i f i c a n t l y r e d u c e s Buchnera G r o E L l e v e l s . T r a n s m i s s i o n i s i n h i b i t e d d u e t o a p o s t u l a t e d l o s s o f v i r a l c a p s i d i n t e g r i t y i n t h e a p h i d h e m o l y m p h i n t h e a b s e n c e o f G r o E L ( v a n d e n H e u v e l et al, 1 9 9 4 ) . B a s e d o n t h e s e s t u d i e s , t h e l u t e o v i r u s - G r o E L i n t e r a c t i o n i s p o s t u l a t e d t o b e a n e c e s s a r y c o m p o n e n t o f v i r a l s t a b i l i t y i n t h e a p h i d h e m o l y m p h , r e d u c i n g p r o t e o l y t i c b r e a k d o w n a n d t h e r e b y a l l o w i n g v i r u s m o v e m e n t t h r o u g h t h e a p h i d a n d s u b s e q u e n t t r a n s m i s s i o n . R e c e p t o r - m e d i a t e d e n d o c y t o s i s T h e m o v e m e n t o f l u t e o v i r u s e s t h r o u g h t h e a p h i d h a s b e e n e l u c i d a t e d u s i n g u l t r a s t r u c t u a l s t u d i e s o f s e c t i o n s o f a p h i d s i n j e c t e d w i t h B Y D V ( G i l d o w , 1 9 8 7 ; G i l d o w , 1993; G i l d o w a n d G r a y , 1 9 9 3 ) . V i r u s i s a c q u i r e d b y t h e a p h i d t h r o u g h i n g e s t i o n o f i n f e c t e d p h l o e m c o n t e n t s d u r i n g f e e d i n g ( G i l d o w , 1 9 8 7 ) . V i r u s i s t h e n t r a n s p o r t e d t h r o u g h t h e h i n d g u t e p i t h e l i u m a n d r e l e a s e d i n t o t h e h e m o c o e l ( G i l d o w , 1 9 9 3 ) . T h e r e i s 17 l i t t l e s e l e c t i v i t y at t h e h i n d g u t m e m b r a n e b a r r i e r , w i t h t h e m a j o r i t y o f l u t e o v i r u s e s h a v i n g t h e a b i l i t y t o p a s s t h r o u g h t h e h i n d g u t e p i t h e l i u m o f a l l k n o w n a p h i d v e c t o r s w h i l e o t h e r v i r u s e s c a n n o t . T h e h i g h l e v e l o f s e l e c t i v i t y a m o n g l u t e o v i r u s e s i s b e l i e v e d t o o c c u r at t h e n e x t s t a g e , w h e n v i r u s i n t h e h e m o c o e l m u s t p a s s t h r o u g h t h e b a s a l l a m i n a a n d b a s a l p l a s m a l e m m a i n o r d e r t o e n t e r t h e s a l i v a r y g l a n d a n d b e t r a n s m i t t e d d u r i n g s u b s e q u e n t f e e d i n g p r o b e s ( G i l d o w a n d R o c h o w , 1980; G i l d o w a n d G r a y , 1 9 9 3 ) . A f t e r e n t e r i n g t h e s a l i v a r y g l a n d , v i r u s i s t r a n s p o r t e d i n c o a t e d v e s i c l e s a n d r e l e a s e d i n t o t h e s a l i v a r y c a n a l w h e r e i t f l o w s w i t h s a l i v a t h r o u g h t h e s a l i v a r y d u c t a n d i n t o n e w h o s t p l a n t s d u r i n g f e e d i n g ( P o n s e n , 1 9 7 7 ) . M o v e m e n t o f B Y D V i n t o t h e a p h i d a c c e s s o r y s a l i v a r y g l a n d w a s s t u d i e d t o d e t e r m i n e i f t h i s i s a s i t e o f s p e c i f i c i t y a n d a l s o t o i d e n t i f y p o s s i b l e m e c h a n i s m s o f v i r u s m o v e m e n t t h r o u g h t h e a p h i d l e a d i n g t o t r a n s m i s s i o n ( G i l d o w a n d G r a y , 1 9 9 3 ) . V i r i o n s w e r e o b s e r v e d a t t a c h e d t o t h e s a l i v a r y b a s a l p l a s m a l e m m a a n d i n c o a t e d p i t s i n t h e p r o c e s s o f b e i n g t r a n s p o r t e d i n t o t h e c y t o p l a s m b y e n d o c y t o s i s . T h e r e w a s s p e c i f i c i t y i n t h i s p r o c e s s i n t h a t t h e M A V i s o l a t e o f B Y D V c o u l d o n l y p e n e t r a t e t h e a c c e s s o r y s a l i v a r y g l a n d b a s a l l a m i n a o f s p e c i f i c a p h i d s p e c i e s . T h r e e t y p e s o f v i r u s - b a s a l l a m i n a i n t e r a c t i o n s w e r e d e s c r i b e d b y G i l d o w a n d G r a y ( 1 9 9 3 ) ; n o n p e n e t r a t i n g - n o n t r a n s m i t t e d , p e n e t r a t i n g - n o n t r a n s m i t t e d , a n d p e n e t r a t i n g - t r a n s m i t t e d . I n t h e t w o t y p e s o f n o n t r a n s m i t t e d l u t e o v i r u s e s , v i r u s c o u l d n o t b e t r a n s m i t t e d e i t h e r b e c a u s e i t c o u l d n o t c r o s s t h e b a s a l l a m i n a ( n o n p e n e t r a t i n g ) o r b e c a u s e i t c o u l d c r o s s b u t w a s t h e n p r e v e n t e d f r o m e n t e r i n g t h e s a l i v a r y g l a n d at t h e c e l l m e m b r a n e ( p e n e t r a t i n g ) ( G i l d o w a n d G r a y , 1 9 9 3 ) . 18 A m o d e l f o r t h e m o v e m e n t o f v i r i o n s t h r o u g h t h e a p h i d a c c e s s o r y s a l i v a r y g l a n d h a s b e e n p r o p o s e d ( G i l d o w a n d G r a y , 1 9 9 3 ) . T r a n s m i s s i b l e l u t e o v i r u s e s a r e s p e c i f i c a l l y r e c o g n i z e d at t h e b a s a l p l a s m a l e m m a , w h e r e t h e y a t t a c h t o t h e m e m b r a n e a n d e n t e r t h e c e l l b y e n d o c y t o s i s . V i r i o n s a c c u m u l a t e i n t u b u l a r v e s i c l e s a d j a c e n t t o t h e a p i c a l p l a s m a l e m m a . C o a t e d v e s i c l e s c o n t a i n i n g i n d i v i d u a l v i r i o n s b u d o f f t h e t u b u l a r v e s i c l e s a n d t r a n s p o r t t h e v i r i o n s t o t h e a p i c a l p l a s m a l e m m a w h e r e t h e y a r e r e l e a s e d b y e n d o c y t o s i s i n t o t h e s a l i v a r y c a n a l . T h e v i r i o n s a r e t h e n a b l e t o m o v e w i t h s a l i v a r y s e c r e t i o n s o u t o f t h e a p h i d a n d t h r o u g h t h e s t y l e t s i n t o n e w p l a n t h o s t s d u r i n g f e e d i n g . T h e r o l e o f t h e a p h i d s a l i v a r y g l a n d i n t r a n s m i s s i o n s p e c i f i c i t y w a s f u r t h e r e x a m i n e d ( P e i f f e r et al, 1 9 9 7 ) . T h e a b i l i t y o f R P V a n d P A V i s o l a t e s o f B Y D V t o a s s o c i a t e w i t h t h e b a s a l l a m i n a o f v e c t o r a n d n o n - v e c t o r a p h i d s p e c i e s w a s e x a m i n e d a n d c o m p a r e d t o t h e b i n d i n g o f v i r u s e s t o t h e i s o l a t e d b a s a l l a m i n a e in vitro. It w a s c o n f i r m e d t h a t t h e b a s a l l a m i n a s e r v e s as a s e l e c t i o n s t e p i n c i r c u l a t i v e a p h i d t r a n s m i s s i o n ( P e i f f e r et al, 1 9 9 7 ) . T h e r e a r e t w o s t a g e s o f r e g u l a t i o n at t h e l e v e l o f t h e b a s a l l a m i n a ; w h e t h e r o r n o t v i r i o n s c a n a t t a c h t o t h e b a s a l l a m i n a a n d w h e t h e r c h a n g e s i n t h e p e r m e a b i l i t y o f t h i s s t r u c t u r e o c c u r t o a l l o w v i r i o n s t o c r o s s t h i s b a r r i e r . T h e a c c e s s o r y s a l i v a r y g l a n d p l a s m a l e m m a i s a s e c o n d d i s t i n c t s e l e c t i o n b a r r i e r t o l u t e o v i r u s t r a n s m i s s i o n ( P e i f f e r et al, 1 9 9 7 ) . M o v e m e n t o f B Y D V s t h r o u g h t h e h i n d g u t e p i t h e l i u m w a s e x a m i n e d u s i n g u l t r a s t r u c t u r a l m e t h o d s a n d i t w a s h y p o t h e s i z e d t h a t r e c e p t o r - m e d i a t e d e n d o c y t o s i s r e g u l a t e d l u t e o v i r u s a c q u i s i t i o n b y a p h i d s ( G i l d o w , 1 9 9 3 ) . F r o m t h i s m o d e l i t w a s p r e d i c t e d t h a t r e c e p t o r - m e d i a t e d a t t a c h m e n t o f v i r i o n s t o m e m b r a n e s c o n t r o l s a c q u i s i t i o n a n d v e c t o r s p e c i f i c i t y . T r a n s m i s s i o n e f f i c i e n c y m a y b e p a r t i a l l y r e g u l a t e d b y v i r u s 19 a f f i n i t y f o r p u t a t i v e r e c e p t o r s o n t h e a c c e s s o r y s a l i v a r y g l a n d b a s a l l a m i n a ( P e i f f e r et al, 1 9 9 7 ) . N o c a n d i d a t e r e c e p t o r s h a v e y e t b e e n i d e n t i f i e d f r o m v e c t o r a p h i d s . T h r i p s t r a n s m i s s i o n ( c i r c u l a t i v e , r e p l i c a t i v e ) Tomato spotted wilt tospovirus ( T S W V ) i s i n t h e f a m i l y Bunyaviridae a n d i s t r a n s m i t t e d i n a c i r c u l a t i v e , p r o p a g a t i v e f a s h i o n b y s e v e r a l s p e c i e s o f t h r i p s , t h e m o s t a b u n d a n t o f w h i c h i s Frankliniella occidentalis ( T h y s a n o p t e r a : T h r i p i d a e ) ( B a n d l a et al., 1 9 9 8 ) . T S W V i s a c q u i r e d b y l a r v a e o f F. occidentalis v i a e n t r y t o m i d g u t e p i t h e l i a l c e l l s ( U l l m a n et al., 1 9 9 5 ) a n d c a n n o t b e a c q u i r e d b y a d u l t s d u e t o a m i d g u t b a r r i e r ( U l l m a n et al, 1 9 9 2 ) . T S W V i s m e m b r a n e - b o u n d e n c o d i n g t w o m e m b r a n e g l y c o p r o t e i n s ( G P s ) ( G P 1 a n d G P 2 ) o n i t s v i r a l R N A ( S h o p e , 1 9 8 5 ) . U l t r a s t r u c t u r a l e v i d e n c e i m p l i c a t e s t h e t w o T S W V e n v e l o p e G P s as v i r a l a t t a c h m e n t p r o t e i n s ( U l l m a n et a l . , 1 9 9 5 ) . I m m u n o l a b e l e d T S W V G P s w e r e o b s e r v e d b o u n d t o t h e b r u s h b o r d e r p l a s m a l e m m a o f s e r i a l s e c t i o n s f r o m l a r v a l m i d g u t s ( U l l m a n et al, 1 9 9 2 ) . A m o r p h o u s m a s s e s o f T S W V n u c l e o c a p s i d p r o t e i n w e r e o b s e r v e d i n t h e c y t o p l a s m o f t h e s e c e l l s as w e r e T S W V - e n c o d e d p r o t e i n s w i t h i n i n c l u s i o n s , v a c u o l e s , a n d v e s i c l e s ( U l l m a n et al, 1 9 9 2 ) . It w a s p r o p o s e d b a s e d o n t h e s e f i n d i n g s t h a t v i r a l G P s i n t e r a c t w i t h a p u t a t i v e r e c e p t o r i n t h e p l a s m a m e m b r a n e o f l a r v a l t h r i p s ' m i d g u t e p i t h e l i a l c e l l s , i n i t i a t i n g v i r u s f u s i o n a n d r e l e a s e o f v i r a l c o m p o n e n t s i n t o t h e c e l l c y t o p l a s m ( U l l m a n et al, 1992; U l l m a n et al, 1 9 9 5 ) . R e p e a t e d m e c h a n i c a l p a s s a g e o f T S W V t o p l a n t s r e s u l t s i n e n v e l o p e - d e f i c i e n t m u t a n t s w h i c h a r e n o l o n g e r t r a n s m i s s i b l e a n d w h i c h l a c k G P - e n c o d i n g s e q u e n c e s ( d e R e s e n d e etal, 1 9 9 1 ) . G P 2 c o n t a i n s a n a r g i n i n e - g l y c i n e - a s p a r t a t e ( R G D ) m o t i f c h a r a c t e r i s t i c o f c e l l - a d h e s i o n m o l e c u l e s ( K o r m e l i n k et al, 1 9 9 2 ) . B a s e d o n t h i s , B a n d l a 2 0 et al. ( 1 9 9 8 ) h y p o t h e s i z e d t h a t t h e T S W V G P s a r e v i r a l a t t a c h m e n t p r o t e i n s i n t e r a c t i n g w i t h p u t a t i v e c e l l u l a r r e c e p t o r s i n t h r i p s m i d g u t c e l l s t o m e d i a t e v i r u s a c q u i s i t i o n . G e l o v e r l a y a s s a y s a n d i m m u n o l a b e l i n g w e r e u s e d t o a s s e s s t h e r o l e o f t h e T S W V G P s as v i r a l a t t a c h m e n t p r o t e i n s a n d t o a t t e m p t t o i d e n t i f y c o r r e s p o n d i n g p u t a t i v e c e l l u l a r r e c e p t o r s f r o m t h r i p s ( B a n d l a et al., 1 9 9 8 ) . T S W V G P s b o u n d s e l e c t i v e l y t o a s i n g l e 5 0 k D a b a n d o f s e p a r a t e d F. occidentalis p r o t e i n s b u t d i d n o t b i n d t o s i m i l a r o v e r l a y s u s i n g s e p a r a t e d p r o t e i n s f r o m n o n - v e c t o r i n s e c t s o r a n o t h e r s p e c i e s f r o m t h e f a m i l y Thripidae ( B a n d l a et al., 1 9 9 8 ) . T h e i n t e n s i t y o f t h e 5 0 k D a b a n d w a s c o n s i s t e n t l y g r e a t e r i n l a r v a e t h a n i n a d u l t s w h i c h i s c o n s i s t e n t w i t h t h e f a c t t h a t l a r v a e t r a n s m i t T S W V b u t a d u l t s don't. A n t i - i d i o t y p i c a n t i b o d i e s t o t h e G P 1 a n d G P 2 b o u n d s p e c i f i c a l l y t o t h e 5 0 k D a p r o t e i n , f u r t h e r i n d i c a t i n g t h e s p e c i f i c i t y o f t h e i n t e r a c t i o n ( B a n d l a et ah, 1 9 9 8 ) . T h e m i d g u t p l a s m a l e m m a w a s s p e c i f i c a l l y l a b e l e d b y f l u o r e s c e n t a n t i - i d i o t y p i c a n t i b o d i e s t o G P 1 a n d G P 2 w i t h n o f l u o r e s c e n c e i n t h e m i d g u t s o f c o n t r o l i n s e c t s , f u r t h e r s u p p o r t i n g t h e h y p o t h e s i s t h a t t h e 5 0 k D a p r o t e i n i s a c e l l u l a r r e c e p t o r i n t h e t h r i p s m i d g u t m e d i a t i n g t h e a c q u i s i t i o n o f T S W V ( B a n d l a et al., 1 9 9 8 ) . F u r t h e r w o r k i s n e c e s s a r y t o d e t e r m i n e i f b i n d i n g o f G P 1 a n d G P 2 t o t h e p u t a t i v e 5 0 k D a r e c e p t o r o c c u r s in vivo a n d i f i t i s s p e c i f i c . T h e l a t t e r c a n b e d o n e b y d e m o n s t r a t i n g s a t u r a b l e b i n d i n g a n d c o m p e t i t i o n f o r b i n d i n g . 1.2.2 Nematode transmission (non-circulative) L o n g i d o r i d a n d t r i c h o d o r i d n e m a t o d e s t r a n s m i t n e p o - a n d t o b r a v i r u s e s , r e s p e c t i v e l y i n a n o n - c i r c u l a t i v e m a n n e r , a c q u i r i n g v i r u s f r o m f e e d i n g o n i n f e c t e d p l a n t 21 r o o t s ( B r o w n et al, 1 9 9 5 ) . S e v e n n e m a t o d e s p e c i e s w i t h i n t h e g e n u s Paratrichodorus a n d f o u r w i t h i n Trichodorus a r e k n o w n to b e v e c t o r s o f t o b r a v i r u s e s ( B r o w n et al., 1 9 9 5 ) . S p e c i f i c i t y e x i s t s b e t w e e n n e m a t o d e s p e c i e s a n d t h e i r a s s o c i a t e d v i r u s e s w h e r e p a r t i c u l a r t o b r a v i r u s i s o l a t e s a r e o n l y t r a n s m i t t e d b y c e r t a i n n e m a t o d e s p e c i e s a n d o n l y p a r t i c u l a r n e m a t o d e s p e c i e s m a y t r a n s m i t c e r t a i n v i r u s e s . T h e P p K 2 0 i s o l a t e o f Tobacco rattle tobravirus ( T R V ) i s t r a n s m i t t e d b y P. pachydermus b u t n o t b y T. primitivus, a n d P. pachydermus t r a n s m i t s s o m e T R V i s o l a t e s ( P p K 2 0 , P p B l , P p W l ) b u t n o t o t h e r s ( T v C 4 7 , T p E l ) ( B r o w n et al, 1989; P l o e g et al, 1991, 1 9 9 2 ) . T h i s s p e c i f i c i t y i s d e t e r m i n e d b y t h e a b i l i t y o f n e m a t o d e s t o r e t a i n v i r u s p a r t i c l e s at s p e c i f i c s i t e s w i t h i n t h e i r f e e d i n g a p p a r a t u s . T r a n s m i s s i b l e v i r u s w a s f o u n d i n s t a r v e d Longidorus f o r u p t o 12 w e e k s , i n Xiphinema f o r a y e a r , a n d f o r m o r e t h a n a y e a r f o r Trichodorus, i n d i c a t i n g t h a t t h e v i r u s m a y p e r s i s t f r o m o n e g r o w i n g s e a s o n t o a n o t h e r w i t h i n t h e i r n e m a t o d e v e c t o r s ( M a t t h e w s , 1 9 9 1 ; v a n H o o f , 1 9 7 0 ) . D i s e a s e c o n t r o l i s c u r r e n t l y a c h i e v e d b y a p p l y i n g s o i l s t e r i l a n t c h e m i c a l s t o e l i m i n a t e n e m a t o d e p o p u l a t i o n s a n d b y t h e a p p l i c a t i o n o f o x i m a c a r b a m a t e s w h i c h t e m p o r a r i l y i m m o b i l i s e t h e n e m a t o d e s , t h u s p r e v e n t i n g t h e m f r o m t r a n s m i t t i n g t h e v i r u s ( V i s s e r et al, 1 9 9 9 ) . T h e m e c h a n i s m o f v i r u s r e t e n t i o n a l o n g t h e n e m a t o d e f o o d c a n a l i s u n k n o w n . T h e m o l e c u l a r b i o l o g y o f v i r u s - n e m a t o d e i n t e r a c t i o n s i s l i t t l e u n d e r s t o o d d u e t o a l a c k o f a n in vitro s y s t e m f o r n e m a t o d e f e e d i n g s u c h as e x i s t s f o r a p h i d s t u d i e s . I n f e e d i n g , n e m a t o d e s i n j e c t t h e i r h o l l o w n e e d l e - l i k e f e e d i n g s t y l e t i n t o r o o t c e l l s , i n j e c t s a l i v a c a u s i n g l i q u i f i c a t i o n o f t h e c y t o p l a s m , a n d f i n a l l y w i t h d r a w p l a n t c e l l c o n t e n t s b y a s u c k i n g m e c h a n i s m ( M a t t h e w s , 19 9 1 ) . It i s k n o w n tha t a c q u i r e d v i r u s p a r t i c l e s b i n d t o 2 2 s p e c i f i c r e g i o n s o f t h e s t y l e t s h e a t h , p h a r y n x , o r e s o p h a g u s d u r i n g t h e f e e d i n g p r o c e s s ( G r a y , 1 9 9 6 ) . T h e t o b r a v i r u s g e n o m e c o n s i s t s o f t w o p o s i t i v e - s e n s e R N A s t h a t a r e s e p a r a t e l y e n c a p s i d a t e d i n t o r o d - s h a p e d p a r t i c l e s . R N A - 1 i s l o n g e r t h a n R N A - 2 a n d e n c o d e s t h e g e n e s f o r r e p l i c a t i o n a n d m o v e m e n t o f t h e v i r u s a n d a s m a l l p r o t e i n o f u n k n o w n f u n c t i o n w h i c h i s h i g h l y c o n s e r v e d a m o n g t o b r a v i r u s e s ( H a r r i s o n a n d R o b i n s o n , 1 9 8 8 ) . T h e s m a l l e r R N A - 2 i s h i g h l y v a r i a b l e a m o n g d i f f e r e n t i s o l a t e s o f T R V i n b o t h n u c l e o t i d e s e q u e n c e a n d g e n o m e l e n g t h . R N A - 2 e n c o d e s t h e v i r a l C P as w e l l as o n e o r m o r e n o n s t r u c t u r a l p r o t e i n s . It h a s b e e n s h o w n t h a t s o m e o f t h e s e p r o t e i n s a r e i n v o l v e d i n t r a n s m i s s i o n ( M a c F a r l a n e et al., 1996; H e r n a n d e z et al., 1 9 9 7 ) . T R V p a r t i c l e s h a v e b e e n a s s o c i a t e d w i t h t h e c u t i c u l a r l i n i n g o f t h e e s o p h a g u s o f P. pachydermus and T. similis n e m a t o d e s , t e n d i n g t o l i e p a r a l l e l t o t h e l o n g a x i s o f t h e f o o d c a n a l ( T a y l o r a n d R o b e r t s o n , 1970; B r o w n et al, 1 9 9 6 ) . T h e r e t e n t i o n o f v i r u s i n s i d e t h e n e m a t o d e f o o d c a n a l l i k e l y r e q u i r e s s p e c i f i c s t r u c t u r e s o f t h e v i r u s p a r t i c l e a n d t h e n e m a t o d e e s o p h a g e a l c u t i c l e . T h e s i t e s o f v i r u s r e t e n t i o n o n t h e w a l l o f t h e f o o d c a n a l i n X. diversicaudatum a n d P. pachydermus c o n t a i n c a r b o h y d r a t e s ( B r o w n et al., 1 9 9 5 ) . A d d i t i o n a l l y , c a r b o h y d r a t e - s t a i n i n g m a t e r i a l h a s b e e n o b s e r v e d s u r r o u n d i n g p a r t i c l e s o f Arabis mosaic nepovirus ( A r M V ) r e t a i n e d w i t h i n t h e f e e d i n g a p p a r a t u s o f X. diversicaudatum ( R o b e r t s o n a n d H e n d r y , 1 9 8 6 ) . B a s e d o n e v i d e n c e o f c a r b o h y d r a t e s i n t h e v i c i n i t y o f v i r u s i n t h e n e m a t o d e f o o d c a n a l , B r o w n et a/.(1995) s u g g e s t e d t h a t t h e v i r u s c o a t p r o t e i n m a y h a v e l e c t i n - l i k e p r o p e r t i e s , w i t h c a r b o h y d r a t e s b e i n g i n v o l v e d i n b o t h r e t e n t i o n a n d d i s s o c i a t i o n o f v i r u s p a r t i c l e s . 2 3 T o b r a v i r u s p a r t i c l e s a n d n e p o v i r u s e s a r e u n r e l a t e d e x c e p t f o r t h e f a c t t h a t t h e y a r e n e m a t o d e - t r a n s m i t t e d . V i r a l c o a t p r o t e i n i s l i k e l y i n v o l v e d i n t h e r e c o g n i t i o n p r o c e s s b e t w e e n n e m a t o d e v e c t o r a n d t h e s e v i r u s e s . T h u s f a r i t h a s b e e n s h o w n t h a t t h e d e t e r m i n a n t s f o r t r a n s m i s s i o n o f Raspberry ringspot nepovirus ( R R S V ) , Tomato black ring nepovirus ( T B R V ) a n d Tobacco ringspot nepovirus ( T R V ) a r e o n R N A 2 , w h i c h i s t h e s e g m e n t o f t h e v i r u s g e n o m e c o d i n g f o r t h e c o a t p r o t e i n ( B r o w n et al., 1 9 9 5 ) . T h e c o a t p r o t e i n i s a l m o s t c e r t a i n l y i n v o l v e d i n t r a n s m i s s i o n b u t w h e t h e r o r n o t o t h e r p r o t e i n s e n c o d e d o n R N A 2 are a l s o i n v o l v e d i s n o t k n o w n . T h e s t r u c t u r e o f t o b r a v i r u s p a r t i c l e s i n d i c a t e s t h a t t o b r a v i r u s C P s u b u n i t s s t a c k i n a t i g h t s p i r a l t o f o r m a h o l l o w r o d - s h a p e d s t r u c t u r e . S e q u e n c e a n d s t r u c t u r a l c o m p a r i s o n s b e t w e e n t h e C P s o f T R V a n d t h e r o d - s h a p e d Tobacco mosaic tobamovirus ( T M V ) i n d i c a t e t h a t t h e N - a n d C - t e r m i n a l r e g i o n s o f T R V a r e l o c a t e d o n t h e o u t s i d e o f t h e v i r u s p a r t i c l e ( G o u l d e n et a l . , 1 9 9 2 ) . N M R m e a s u r e m e n t s s u g g e s t t h a t t h e r e l a t i v e l y l o n g p r o t r u d i n g C - t e r m i n a l a m i n o a c i d s e q u e n c e s o f t o b r a v i r u s C P s f o r m m o b i l e a r m s w h i c h are g o o d c a n d i d a t e s f o r i n v o l v e m e n t i n t h e r e t e n t i o n o f t o b r a v i r u s e s b y t h e i r a s s o c i a t e d v e c t o r n e m a t o d e s ( M a y o et ah, 1 9 9 5 ) . T h e f l e x i b l e d o m a i n o f t h e C P ( O R F 1 o f R N A - 2 ) i s d i f f e r e n t i n s i z e i n a l l t h r e e n e m a t o d e - t r a n s m i s s i b l e t o b r a v i r u s e s s e q u e n c e d t o d a t e [ T R V i s o l a t e T p O l , 17 aa; P E B V (Pea early browning virus) i s o l a t e T p A 5 6 , 2 9 aa, T R V i s o l a t e P p K 2 0 , 2 2 aa] ( M a c F a r l a n e et al, 1 9 9 9 ) . It w a s p r e v i o u s l y s h o w n t h a t r e m o v i n g t h e C - t e r m i n a l 15 a a o f t h e C P o f P E B V a b o l i s h e d n e m a t o d e t r a n s m i s s i o n ( M a c F a r l a n e et al., 1 9 9 6 ) . R e s i d u e s at t h e e x t r e m e C - t e r m i n u s o f t h e f l e x i b l e c o a t p r o t e i n d o m a i n w o u l d b e m o s t i m p o r t a n t i n 2 4 s p e c i f i c r e c o g n i t i o n o f v e c t o r s u r f a c e s o r t r a n s m i s s i o n h e l p e r p r o t e i n , a n d i n t h a t r e g i o n a l l t h r e e v i r u s s e q u e n c e s a r e d i f f e r e n t ( M a c F a r l a n e et al, 1 9 9 9 ) . B o t h t h e 9- a n d 2 9 - k D a n o n - s t r u c t u r a l p r o t e i n s o f t h e t w o v i r u s e s t r a n s m i t t e d b y T. primitivus ( T R V T p O l a n d P E B V T p A 5 6 ) a r e m o r e s i m i l a r t o e a c h o t h e r t h a n t h e y a r e t o t h e 2 9 . 4 - k D a p r o t e i n o f T R V P p K 2 0 w h i c h i s t r a n s m i t t e d b y P. pachydermus ( M a c F a r l a n e et al, 1 9 9 9 ) . T h e s e d a t a s u g g e s t t h a t n o n s t r u c t u r a l p r o t e i n s h a v e a r o l e i n n e m a t o d e t r a n s m i s s i o n . It h a s b e e n s u g g e s t e d t h a t t h e n o n s t r u c t u r a l p r o t e i n s m a y s p e c i f i c a l l y l i n k v i r u s p a r t i c l e s t o r e c e p t o r s i t e s i n t h e n e m a t o d e e s o p h a g u s ( H e r n a n d e z et al, 1 9 9 7 ) . T h e s e n o n s t r u c t u r a l p r o t e i n s m a y f u n c t i o n as h e l p e r c o m p o n e n t s a n a l o g o u s t o t h e h e l p e r c o m p o n e n t s o f p o t y v i r u s e s o r t h e a p h i d t r a n s m i s s i o n f a c t o r o f c a u l i m o v i r u s e s ( s e e a b o v e ; P i r o n e a n d B l a n c , 1 9 9 6 ) . D e t a i l e d m u t a g e n e s i s s t u d i e s o f t h e n o n s t r u c t u r a l a n d s t r u c t u r a l p r o t e i n s a r e n e c e s s a r y t o b e t t e r u n d e r s t a n d t h e p r o c e s s o f n e m a t o d e t r a n s m i s s i o n o f t o b r a v i r u s e s , w i t h p a r t i c u l a r e m p h a s i s o n r e s i d u e s p r e d i c t e d t o b e s u r f a c e l o c a t e d ( M a c F a r l a n e et al, 1 9 9 9 ) . 1.2.3 F u n g u s t r a n s m i s s i o n F u n g i w h i c h t r a n s m i t v i r u s e s a r e z o o s p o r i c , o b l i g a t e p a r a s i t e s o f p l a n t r o o t s ( A d a m s , 1 9 9 1 ) . T w o d i s t i n c t t y p e s o f f u n g i b e l o n g i n g t o d i f f e r e n t c l a s s e s o f t h e s u b d i v i s i o n M a s t i g o m y c o t i n a a r e k n o w n t o t r a n s m i t p l a n t v i r u s e s ( T a b l e 1.2; G r a y a n d R o c h o n , 1 9 9 9 ) . P l a s m o d i o p h o r o m y c e t e v e c t o r s (Polymyxa a n d Spongospora spp.) h a v e b i f l a g e l l a t e z o o s p o r e s w h i l e t h e C h y t r i d i o m y c e t e v e c t o r s (Olpidium spp.) h a v e a s i n g l e f l a g e l l u m ( A d a m s , 1 9 9 1 ) . 2 5 T a b l e 1.2 K n o w n a n d p u t a t i v e f u n g a l v e c t o r s f o r v i r u s e s a n d v i r u s - l i k e a g e n t s 1 . Virus (Family) Acronym Fungal Vector Acquisition Mode Tombusviruses (Tombusviridae) Cucumber necrosis virus C N V Olpidium in vitro bornovanus Aureusvirus (Tombusviridae) Cucumber leaf spot virus C L S V O. bornovanus in vitro Carmoviruses (Tombusviridae) Cucumber soil-borne virus C S B V 0. bornovanus in vitro Melon necrotic spot virus M N S V 0. bornovanus in vitro Squash necrosis virus3 SqNV 0. bornovanus in vitro Dianthoviruses (Tombusviridae) Red clover necrotic mosaic R C N M V 0. bornovanus in vitro Necroviruses (Tombusviridae) Chenopodium necrosis virus ChNV 0. brassicae in vitro Lisianthus necrosis L N V o. brassicae in vitro Tobacco necrosis virus T N V o. brassicae in vitro Varicosviruses Freesia leaf necrosis agent F L N A o. brassicae in vivo Lettuce big vein L B V V o. brassicae in vivo Tobacco stunt virus TStV 0. brassicae in vivo Bymoviruses (Potyviridae) Barley mild mosaic virus B a M M V Polymyxa graminis in vivo Barley yellow mosaic virus B a Y M V P. graminis in vivo Oat mosaic virus O M V P. graminis in vivo Rice necrosis mosaic virus R N M V P. graminis in vivo Wheat spindle streak mosaic virus4 W S S M V P. graminis in vivo Wheat yellow mosaic virus W Y M V P. graminis in vivo Furoviruses Beet necrotic yellow vein5 B N Y Y V P. betae in vivo Beet soil-borne virus B S B V P. betae in vivo Indian peanut clump virus IPCV P. graminis in vivo Peanut clump virus PCV P. graminis in vivo Potato mop top virus P M T V Spongospora in vivo Oat golden stripe virus Rice stripe necrosis virus Soil-borne wheat mosaic Uncharacterized viruses Lettuce ring necrosis agent Pepper yellow vein agent Watercress yellow spot virus Watercress chlorotic leaf spot OGSV RSNV S B W M V L R N A P Y V A W Y S V W C L A f.sp. subterranea P. graminis P. graminis P. graminis O. brassicae O. brassicae S. subterranea f.sp. nasturtii S. subterranea f.sp. nasturtii in vivo in vivo in vivo in vivo in vivo not known not known Table is from D. Rochon (unpublished). 2 A family name is provided if assigned. 3 SqNV is a tentative carmovirus. 4 W S S M V and W Y M V are possibly strains of each other. 5 Beet necrotic yellow vein is a tentative species of the furovirus genus. 2 6 # Q zoospore discharge in root cell F i g u r e 1.1 L i f e c y c l e o f Olpidium brassicae ( a d a p t e d f r o m T e m m i n k , 1 9 7 1 ) . T h e q u e s t i o n m a r k i n d i c a t e s t h a t i t i s n o t c e r t a i n h o w r e s t i n g s p o r a n g i a a r e f o r m e d i n r o o t c e l l s o f O. brassicae. B o t h t y p e s o f f u n g i s h a r e c o m m o n f e a t u r e s i n t h e i r l i f e c y c l e s ( A d a m s , 1 9 9 1 ; F i g u r e 1.1). T h i c k - w a l l e d r e s t i n g s p o r e s s u r v i v e i n t h e s o i l f o r m a n y y e a r s a f t e r d e c a y o f t h e i n f e c t e d p l a n t . W i t h p r o p e r e n v i r o n m e n t a l c o n d i t i o n s , r e s t i n g s p o r e s ( c e l l w a l l , n o f l a g e l l a ) w i l l g e r m i n a t e , b e c o m i n g p r i m a r y z o o s p o r e s ( f l a g e l l a t e d , n o c e l l w a l l ) w h i c h s w i m t o h o s t r o o t s a n d e n c y s t o n r o o t e p i d e r m a l c e l l s . E n c y s t m e n t i n v o l v e s w i t h d r a w a l 2 7 o f t h e f l a g e l l a , a d h e s i o n t o t h e h o s t w a l l a n d s e c r e t i o n o f a c y s t w a l l s e p a r a t i n g t h e f u n g a l c y t o p l a s m f r o m t h e p l a n t c e l l c y t o p l a s m . T h e z o o s p o r e p r o t o p l a s t i s t h e n i n j e c t e d i n t o t h e h o s t c e l l w h e r e t h e t h a l l u s d i v i d e s i n t o a m u l t i n u c l e a t e P l a s m o d i u m a n d t h e n d e v e l o p s i n t o a z o o s p o r a n g i u m . S e c o n d a r y z o o s p o r e s a r e r e l e a s e d f r o m t h e z o o s p o r a n g i u m i n t o s o i l w h e n t h e p r e s e n c e o f w a t e r c a u s e s t h e d i s s o l u t i o n o f a g e l a t i n o u s p l u g i n t h i s s a c - l i k e s t r u c t u r e ( A d a m s , 19 9 1 ) . T h e r e a r e t w o m a i n s t r a t e g i e s f o r t r a n s m i s s i o n o f f u n g a l l y t r a n s m i t t e d v i r u s e s . I n o n e s t r a t e g y , v i r u s i s a d s o r b e d t o t h e z o o s p o r e s u r f a c e b u t i s n o t f o u n d i n r e s t i n g s p o r e s (in vitro t r a n s m i s s i o n ) . I n t h e o t h e r , v i r u s e n t e r s t h e t h a l l u s i n t h e h o s t a n d i s l o c a t e d w i t h i n r e s t i n g s p o r e s (in vivo t r a n s m i s s i o n ) ( C a m p b e l l , 1 9 9 6 ) . V i r u s e s t r a n s m i t t e d i n t h i s m a n n e r h a v e b e e n t e r m e d n o n p e r s i s t e n t a n d p e r s i s t e n t , r e s p e c t i v e l y ( A d a m s , 1 9 9 1 ) . T h e s e t r a n s m i s s i o n s t r a t e g i e s a r e a n a l o g o u s t o n o n c i r c u l a t i v e a n d c i r c u l a t i v e v i r u s t r a n s m i s s i o n b y i n v e r t e b r a t e v e c t o r s ( G r a y , 1996; s e e a b o v e ) . A n a l o g i e s b e t w e e n m e c h a n i s m s o f t r a n s m i s s i o n b y i n v e r t e b r a t e v e c t o r s a n d t h o s e u s e d b y f u n g i w e r e c h a l l e n g e d b a s e d o n t h e f a c t t h a t f u n g i h a v e n o c i r c u l a t o r y s y s t e m ( C a m p b e l l , 1 9 9 3 ) . T h e u s e o f t h e t e r m s ' p e r s i s t e n t ' a n d ' n o n - p e r s i s t e n t ' a r e n o t a p p r o p r i a t e f o r f u n g a l v e c t o r s b e c a u s e t h e y a r e b a s e d o n v i r u s s u r v i v a l i n dormant ( f u n g a l ) r e s t i n g s p o r e s i n c o n t r a s t t o r e t e n t i o n o f v i r u s b y feeding ( i n v e r t e b r a t e ) v e c t o r s ( C a m p b e l l , 1 9 9 6 ) . D e s p i t e t h e o b v i o u s b i o l o g i c a l d i f f e r e n c e s b e t w e e n f u n g i a n d i n v e r t e b r a t e s , t h e o v e r a l l s i m i l a r i t i e s b e t w e e n t r a n s m i s s i o n o f f u n g i a n d i n v e r t e b r a t e s i n d i c a t e s t h a t s u c h c o m p a r i s o n s m i g h t g i v e f u r t h e r i n s i g h t i n t o g e n e r a l t r a n s m i s s i o n m e c h a n i s m s ( A d a m s , 19 9 1 ) . 2 8 T h e t e r m s in vitro a n d in vivo d i s t i n g u i s h b e t w e e n f u n g a l v e c t o r s b a s e d o n w h e t h e r v i r u s e s a r e e x t e r n a l l y o r i n t e r n a l l y b o r n e , r e s p e c t i v e l y ( C a m p b e l l a n d F r y , 1 9 6 6 ) . T h e s e t e r m s g i v e i m p o r t a n t b i o l o g i c a l i n f o r m a t i o n a b o u t t h e m o d e o f f u n g a l t r a n s m i s s i o n a n d a l l u d e t o t h e d i f f e r e n c e s i n b i o l o g y b e t w e e n t h e s e t w o m o d e s . T h e r e f o r e , I w i l l u s e t h e t e r m s in vitro a n d in vivo t o d e s c r i b e f u n g u s - t r a n s m i s s i o n m e c h a n i s m s i n t h i s r e v i e w b u t w i l l a l s o p e r i o d i c a l l y u s e t h e t e r m s n o n - c i r c u l a t i v e a n d c i r c u l a t i v e , r e s p e c t i v e l y , t o m a i n t a i n c o n t i n u i t y w i t h t h e s e c t i o n s o n i n v e r t e b r a t e v e c t o r s . Olpidium l i f e - c y c l e O. brassicae w a s d e m o n s t r a t e d t o b e t h e n a t u r a l v e c t o r o f Tobacco necrosis virus ( T N V ) ( T e a k l e , 1 9 6 0 ) a n d m u c h o f o u r k n o w l e d g e o f t h e b i o l o g y o f Olpidium spp. c o m e s f r o m s t u d i e s o f O. brassicae ( T e m m i n k a n d C a m p b e l l , 1968, 1 9 6 9 a , 1 9 6 9 b ; T e m m i n k , 197 1 ; F i g u r e 1.1). T h e c e l l s o f l e t t u c e O. brassicae z o o s p o r e s a r e 2 x 3 u r n , o v o i d , a n d s u r r o u n d e d b y a c o n t i n u o u s p l a s m a l e m m a ( T e m m i n k a n d C a m p b e l l , 1 9 6 9 a ) . T h e a x o n e m e i s 0.2 t o 0.25 J i m w i d e a n d s u r r o u n d e d b y a m e m b r a n o u s s h e a t h c o n t i n u o u s w i t h t h e p l a s m a l e m m a o f t h e z o o s p o r e b o d y ( T e m m i n k a n d C a m p b e l l , 1 9 6 9 a ) . T h e c e l l s o f O. bornovanus i n f e c t i n g c u c u m b e r a r e l a r g e r t h a n t h a t o f O. brassicae, b e i n g 6-7 |im. T h e l e t t u c e i s o l a t e o f O. brassicae e n c y s t s o n a n d p e n e t r a t e s r o o t h a i r s a n d e p i d e r m a l c e l l s i n t h e z o n e o f e l o n g a t i o n o f t h e r o o t s ( T e m m i n k a n d C a m p b e l l , 1 9 6 9 b ) . I n f e c t i o n o f t h e r o o t h a s n o o b s e r v a b l e p a t h o g e n i c e f f e c t o n h o s t p l a n t s b u t s u c h p l a n t s m a y b e m o r e s u s c e p t i b l e t o o t h e r p a t h o g e n i c o r g a n i s m s a n d m a y i n c u r a s m a l l d e c r e a s e i n o v e r a l l g r o w t h ( G r o g a n a n d C a m p b e l l , 1 9 6 6 ) . A t t h e t i m e o f i n f e c t i o n o f n e w r o o t e p i t h e l i a l c e l l s , Olpidium z o o s p o r e s h a v e r e t r a c t e d t h e i r a x o n e m e s . T w o d i f f e r e n t m o d e s 2 9 o f a x o n e m a l r e t r a c t i o n , " w r a p - a r o u n d ' a n d ' r e e l i n g - i n ' , h a v e b e e n s u g g e s t e d f o r Olpidium ( T e m m i n k , 19 7 1 ) . I n t h e ' w r a p - a r o u n d ' m o d e , t h e a x o n e m e i s c o i l e d a r o u n d t h e b o d y o f t h e z o o s p o r e s o t h a t t h e a x o n e m a l s h e a t h a n d p l a s m a l e m m a o f t h e z o o s p o r e b o d y a r e f u s e d d u r i n g a x o n e m a l u p t a k e . I n t h e ' r e e l i n g - i n ' m o d e , t h e a x o n e m e i s p u l l e d i n s i d e ( ' r e e l e d i n ' ) t h e z o o s p o r e b o d y . T e m m i n k a n d C a m p b e l l ( 1 9 6 9 b ) s u g g e s t t h a t t h e ' r e e l i n g - i n ' m o d e o f a x o n e m a l r e t r a c t i o n o c c u r s i n Olpidium z o o s p o r e s . T h e m o d e o f r e t r a c t i o n i s i m p o r t a n t i n t r a n s m i s s i o n b e c a u s e i t i s h y p o t h e s i z e d t h a t v i r u s p a r t i c l e s b o u n d t o t h e a x o n e m e e n t e r t h e z o o s p o r e c y t o p l a s m f o l l o w i n g ' r e e l i n g - i n ' o f t h e f l a g e l l u m . T h i s t h e n a l l o w s v i r u s t o e n t e r p l a n t s w h e n t h e z o o s p o r e c y t o p l a s m i s i n j e c t e d i n t o t h e r e c i p i e n t c e l l . A f t e r a x o n e m a l w i t h d r a w a l a c y s t w a l l i s s e c r e t e d a r o u n d t h e z o o s p o r e b o d y . I n p h o t o s o f c r o s s - s e c t i o n s a n d l o n g i t u d i n a l s e c t i o n s o f e n c y s t e d O. brassicae z o o s p o r e s , a x o n e m a l f i b r i l s w e r e o b s e r v e d c o i l e d w i t h i n t h e c y s t , p r o v i d i n g e v i d e n c e f o r t h e ' r e e l i n g -i n ' h y p o t h e s i s ( T e m m i n k , 19 7 1 ) . I n s o m e c y s t s b u n d l e s o f m e m b r a n e s c o u l d b e o b s e r v e d i n c l o s e p r o x i m i t y t o t h e p l a s m a l e m m a . T h e p r e s e n c e o f t h i s w h o r l o f m e m b r a n e s s u g g e s t s t h a t t h e s h e a t h i s p u l l e d i n a n d b r e a k s d u r i n g a x o n e m a l w i t h d r a w a l ( T e m m i n k a n d C a m p b e l l , 1 9 6 9 b ; T e m m i n k , 19 7 1 ) . T h e ' r e e l i n g - i n ' m o d e o f a x o n e m a l r e t r a c t i o n w o u l d i n d i c a t e t h a t v i r u s a d s o r b e d t o t h e a x o n e m a l s h e a t h i s p u l l e d i n t o t h e c y s t c y t o p l a s m , w h e r e i t i s a v a i l a b l e t o e n t e r t h e r o o t c e l l c y t o p l a s m d u r i n g i n f e c t i o n ( T e m m i n k a n d C a m p b e l l , 1 9 6 9 b ) . T h i s h y p o t h e s i s w a s s u p p o r t e d w i t h p h o t o g r a p h s o f v i r u s - l i k e p a r t i c l e s c l o s e t o w h o r l s o f m e m b r a n e s i n t h e c y s t s ( T e m m i n k , 1 9 7 1 ) . U p o n e n c y s t m e n t , t h e f u n g a l p r o t o p l a s m e n t e r s t h e r o o t c e l l ( S a h t i y a n c i , 1 9 6 2 ) . A h o l e a p p e a r s i n t h e c y s t w a l l a n d t h e n t h e c y s t c y t o p l a s m , s u r r o u n d e d b y a n e w l y f o r m e d 3 0 p l a s m a l e m m a , m o v e s i n t o t h e r o o t c e l l t h r o u g h a h o l e i n i t s c e l l w a l l ( T e r r v r n i n k , 1 9 71, T e m m i n k a n d C a m p b e l l , 1 9 6 9 b ) . T h e c y s t p l a s m a l e m m a r e m a i n s i n t h e e m p t y c y s t . T h e c y s t p r o t o p l a s t t h e n m o v e s t h r o u g h a h o l e i n t h e r o o t c e l l p l a s m a l e m m a i n t o t h e r o o t c e l l c y t o p l a s m , b e c o m i n g a t h a l l u s c o n t a i n e d w i t h i n t h e t h a l l u s p l a s m a l e m m a ( T e m m i n k , 1 9 7 1 ) . T h e t h a l l u s g r o w s w i t h i n t h e r o o t c e l l f o r 2 4 h o u r s a n d t h e n b e c o m e s m u l t i n u c l e a t e a n d b e g i n s t o f o r m a c e l l w a l l ( T e m m i n k , 1 9 7 1 ) . A f t e r 7 2 h o u r s t h e t h a l l u s f o r m s c l e a v a g e v e s i c l e s w h i c h t h e n f u s e t o b e c o m e z o o s p o r e s . A v a r y i n g n u m b e r o f z o o s p o r e s a r e c o n t a i n e d w i t h i n a m a t u r e z o o s p o r a n g i u m , w h i c h r e l e a s e s t h e z o o s p o r e s t h r o u g h i t s e x i t t u b e a f t e r c o n t a c t w i t h f r e s h w a t e r ( T e m m i n k , 1 9 7 1 ) . T w o i m p o r t a n t p o i n t s r e l e v a n t t o in vitro t r a n s m i s s i o n a r i s e f r o m k n o w l e d g e o f t h e Olpidium l i f e c y c l e . F i r s t , v i r u s b o u n d t o t h e z o o s p o r e a x o n e m e m a y e n t e r t h e z o o s p o r e t h r o u g h t h e ' r e e l i n g - i n ' m o d e o f r e t r a c t i o n w h i l e v i r u s b o u n d t o t h e p l a s m a l e m m a w i l l b e l e f t b e h i n d i n t h e c y s t a f t e r t r a n s f e r o f c y s t c y t o p l a s m t o t h e r o o t c e l l ( T e m m i n k , 1 9 7 1 ) . S e c o n d , t h e f u n g a l t h a l l u s i s s e p a r a t e d f r o m t h e r o o t c e l l c y t o p l a s m b y a s i n g l e m e m b r a n e d u r i n g t h e f i r s t 2 4 h o u r s a f t e r i n f e c t i o n . V i r u s m u s t e n t e r t h e r o o t c e l l c y t o p l a s m b e f o r e t h e f o r m a t i o n o f a c e l l w a l l b y t h e t h a l l u s a p p r o x i m a t e l y 2 4 h o u r s p o s t - i n f e c t i o n ( T e m m i n k , 1 9 7 1 ) . O n e h y p o t h e s i s f o r t h e m e c h a n i s m o f t r a n s f e r o f v i r u s f r o m t h e c y s t c y t o p l a s m ( w h i c h b e c o m e s t h e t h a l l u s ) t o t h e r o o t c y t o p l a s m i s b y v a c u o l e s ( T e m m i n k , 1 9 7 1 ) . V a c u o l e - l i k e s t r u c t u r e s w e r e n o t e d n e a r t h e t h a l l i 4-24 h o u r s a f t e r i n o c u l a t i o n , b e f o r e t h e f o r m a t i o n o f t h e t h a l l u s w a l l . T h e s e v a c u o l e - l i k e s t r u c t u r e s s o m e t i m e s c o n t a i n e d v i r u s -l i k e p a r t i c l e s a n d s o m e t i m e s t h e s e v a c u o l e s h a d r u p t u r e d a n d r e l e a s e d v i r u s - l i k e p a r t i c l e s . T h i s r e l e a s e m e c h a n i s m w a s t h o u g h t t o r e s e m b l e e x c r e t i o n o r r e g u r g i t a t i o n b y e x o c y t o s i s 3 1 as d e s c r i b e d b y d e D u v e a n d W a t t i a u x ( 1 9 6 6 ) . L a b e l l i n g w i t h a n t i b o d i e s a n d / o r g o l d p a r t i c l e s m a y h e l p t o d e t e r m i n e t h e i d e n t i t y o f v i r u s - l i k e p a r t i c l e s i n t h e v a c u o l e s . E i g h t e e n h o u r s a f t e r i n f e c t i o n o f r o o t s w i t h O. brassicae a n d T N V , i r r e g u l a r c l u s t e r s o r c r y s t a l - l i k e a r r a y s o f v i r u s p a r t i c l e s w e r e p r e s e n t i n n e c r o t i c c e l l s ( T e m m i n k , 19 7 1 ) . N e c r o s i s s e e m e d t o o c c u r o n l y i n t h e f u n g u s - i n f e c t e d c e l l s . N o g r o w i n g t h a l l i w e r e p r e s e n t i n t h e n e c r o t i c c e l l s , s o t h a t i f v i r u s h a d e n t e r e d t h e c e l l a n d b e g u n t o r e p l i c a t e , g r o w t h o f t h a l l i a n d s u b s e q u e n t p r o d u c t i o n o f z o o s p o r e s w a s p r e c l u d e d . I n a c e l l c o n t a i n i n g g r o w i n g t h a l l i , n o v i r u s p a r t i c l e s w e r e o b s e r v e d ( T e m m i n k , 1 9 7 1 ) . L i t t l e c e l l - t o - c e l l s p r e a d o f T N V o c c u r r e d i n i n f e c t e d l e t t u c e r o o t s , w i t h o b s e r v a b l e n e c r o t i c l e s i o n s o n t h e r o o t s b u t n o s y s t e m i c n e c r o s i s o f t h e e n t i r e p l a n t . In vitro ( n o n - c i r c u l a t i v e ) t r a n s m i s s i o n T w o s p e c i e s o f Olpidium (O. brassicae a n d O. bornovanus) h a v e b e e n s h o w n t o t r a n s m i t s e v e r a l s o i l - b o r n e p l a n t v i r u s e s i n t h e in vitro ( n o n - c i r c u l a t i v e ) m a n n e r ( T a b l e 1.2; G r a y a n d R o c h o n , 1 9 9 9 ) . I n t h i s m o d e o f t r a n s m i s s i o n , v i r u s e s a r e n o t f o u n d w i t h i n r e s t i n g s p o r e s a n d a c q u i s i t i o n o f v i r u s o c c u r s o u t s i d e o f l i v i n g c e l l s ( C a m p b e l l , 1 9 9 6 ) . V i r u s s u r v i v a l f r o m s e a s o n t o s e a s o n d e p e n d s o n t h e s t a b i l i t y o f v i r i o n s i n t h e s o i l a n d d e c a y i n g p l a n t d e b r i s , i n d e p e n d e n t o f f u n g a l a n d p l a n t s u r v i v a l ( C a m p b e l l , 1 9 9 6 ) . S e v e r a l d i s t i n c t p r o c e s s e s a r e r e q u i r e d f o r in vitro a c q u i s i t i o n o f v i r u s b y z o o s p o r e s : v i r u s a t t a c h m e n t t o z o o s p o r e s , f u n g u s i n f e c t i o n o f t h e h o s t , v i r u s r e l e a s e i n t o t h e h o s t , a n d m u l t i p l i c a t i o n o f t h e v i r u s i n t h e h o s t ( T e m m i n k et al, 1 9 7 0 ) . Z o o s p o r e s a n d v i r u s p a r t i c l e s a r e r e l e a s e d i n t o t h e s o i l i n d e p e n d e n t l y f r o m i n f e c t e d r o o t s . V i r u s p a r t i c l e s t h e n a d h e r e t o t h e p l a s m a l e m m a a n d a x o n e m a l s h e a t h o f t h e z o o s p o r e s ( T e m m i n k , 19 7 1 ; S t o b b s et al, 1 9 8 2 ) . T h e a x o n e m e a l o n g w i t h b o u n d v i r u s i s t h e n 3 2 w i t h d r a w n i n t o t h e z o o s p o r e c y t o p l a s m a n d v i r u s i s t h e n t h o u g h t t o b e c a r r i e d i n t o r o o t c e l l s o f t h e h o s t p l a n t d u r i n g d i s c h a r g e o f t h e z o o s p o r e p r o t o p l a s m ( T e m m i n k , 1 9 7 1 ; S t o b b s et al., 1 9 8 2 ) . V i r u s i s n o t f o u n d i n r e s t i n g s p o r e s as w i t h in vivo t r a n s m i s s i o n ( C a m p b e l l , 1 9 9 6 ) . S p e c i f i c i t y o f in vitro f u n g a l t r a n s m i s s i o n I n v e s t i g a t i o n s i n t o t h e m o d e o f T N V t r a n s m i s s i o n b y O. brassicae w e r e u n d e r t a k e n w i t h p a r t i c u l a r e m p h a s i s o n e x p l a i n i n g t h e o b s e r v e d v e c t o r s p e c i f i c i t y ( T e m m i n k et al, 1 9 7 0 ) . T h e l e t t u c e a n d t o m a t o i s o l a t e s o f O. brassicae t r a n s m i t T N V e f f i c i e n t l y w h i l e t h e m u s t a r d i s o l a t e d o e s not, e v e n t h o u g h t h e m u s t a r d i s o l a t e i s a b l e t o i n f e c t p l a n t s ( T e m m i n k et ah, 1 9 7 0 ) . O. bornovanus ( f o r m e r l y O. cucurbitacearum) t r a n s m i t s C N V b u t n o t T N V t o s e v e r a l h o s t p l a n t s ( D i a s , 1 9 7 0 a ) . D i f f e r e n c e s i n a d s o r p t i o n o f v i r u s t o f u n g a l z o o s p o r e s w e r e t h o u g h t t o c a u s e t h e d i f f e r e n t i a l t r a n s m i s s i o n , o r s p e c i f i c i t y , o b s e r v e d i n in vitro t r a n s m i s s i o n ( T e m m i n k et al., 1 9 7 0 ) . T o d e t e r m i n e i f t h i s w a s t h e c a s e , d i f f e r e n t i s o l a t e s o f O. brassicae a n d O. bornovanus w e r e m i x e d w i t h T N V o r C N V a n d t h e n n e g a t i v e l y s t a i n e d , s e c t i o n e d , a n d o b s e r v e d b y e l e c t r o n m i c r o s c o p y f o r v i r u s p a r t i c l e a d s o r p t i o n ( T e m m i n k et a l . , 1 9 7 0 ) . T N V b o u n d t o l e t t u c e b u t n o t t o m u s t a r d O. brassicae. C N V d i d n o t b i n d t o e i t h e r i s o l a t e o f O. brassicae. I n c o n t r a s t , C N V b o u n d t o O. bornovanus w h i l e T N V d i d n o t ( T e m m i n k et al., 1 9 7 0 ) . T a k e n t o g e t h e r , t h e s e r e s u l t s i n d i c a t e d t h a t t h e s p e c i f i c i t y o f in vitro v i r u s t r a n s m i s s i o n b y Olpidium i s at t h e l e v e l o f z o o s p o r e b i n d i n g . A c o m p r e h e n s i v e a n a l y s i s o f t h e i n t e r a c t i o n s b e t w e e n s i x v i r u s e s k n o w n t o b e a c q u i r e d in vitro a n d t r a n s m i t t e d b y at l e a s t o n e i s o l a t e o f Olpidium spp. f u r t h e r e x a m i n e d t h e s p e c i f i c i t y o f i n t e r a c t i o n b e t w e e n t h e s e v i r u s e s a n d t h e i r f u n g a l v e c t o r s ( C a m p b e l l et 3 3 al., 1 9 9 5 ) . Cucumber soil borne carmovirus ( C S B V ) , Melon necrotic spot carmovirus ( M N S V ) , Squash necrosis carmovirus ( S q N V ) , Cucumber leaf spot aureusvirus ( C L S V ) , C N V a n d T N V w e r e e x a m i n e d f o r t r a n s m i s s i b i l i t y b y s e v e r a l s i n g l e s p o r a n g i a l i s o l a t e s o f 0. bornovanus a n d 0. brassicae o b t a i n e d f r o m s e v e r a l d i f f e r e n t g e o g r a p h i c r e g i o n s . F i v e c u c u m b e r , five m e l o n , a n d t w o s q u a s h i s o l a t e s o f O. bornovanus a n d t h r e e i s o l a t e s o f O. brassicae w e r e e x a m i n e d f o r t h e i r a b i l i t y t o t r a n s m i t t h e s e s i x v i r u s e s in vitro ( C a m p b e l l et al., 1 9 9 5 ) . A l l i s o l a t e s o f O. bornovanus t r a n s m i t t e d C N V b u t t h e r e w a s a h i g h v a r i a b i l i t y i n t h e l e v e l s o f t r a n s m i s s i o n as s h o w n b y a b s o r b a n c e v a l u e s f r o m a d o u b l e a n t i b o d y s a n d w i c h E L I S A o f e x t r a c t s o f i n f e c t e d r o o t s i n o c u l a t e d w i t h in vitro m i x t u r e s o f v i r u s a n d z o o s p o r e s ( C a m p b e l l et al., 1 9 9 5 ) . A l l i s o l a t e s o f O. bornovanus t r a n s m i t t e d M N S V . A l l f i v e c u c u m b e r , o n l y t w o o f t h e m e l o n a n d n o n e o f t h e s q u a s h i s o l a t e s o f O. bornovanus t r a n s m i t t e d C L S V . A l l c u c u m b e r a n d s q u a s h b u t o n l y t w o o f the m e l o n i s o l a t e s o f O. bornovanus t r a n s m i t t e d S q N V . T w o s q u a s h i s o l a t e s o f O. bornovanus w e r e t h e o n l y v e c t o r s o f C S B V . N o n e o f t h e 12 i s o l a t e s o f O. bornovanus t r a n s m i t t e d T N V . T h r e e c u c u r b i t i s o l a t e s o f O.brassicae w e r e t e s t e d f o r t r a n s m i s s i o n o f a l l s i x v i r u s e s a n d o n l y T N V w a s t r a n s m i t t e d , w i t h v a r i a b l e e f f i c i e n c y ( C a m p b e l l et ai, 1 9 9 5 ) . T h e h i g h s p e c i f i c i t y o f t h e b i o l o g i c a l i n t e r a c t i o n b e t w e e n Olpidium a n d t h e v i r u s e s i t t r a n s m i t s i s s t r o n g l y s u g g e s t i v e o f a s p e c i f i c m o l e c u l a r i n t e r a c t i o n b e t w e e n v i r u s p a r t i c l e s a n d Olpidium z o o s p o r e s . In vivo ( c i r c u l a t i v e ) f u n g a l t r a n s m i s s i o n F u n g a l t r a n s m i s s i o n i s c h a r a c t e r i z e d as in vivo ( c i r c u l a t i v e ) i f i n f e c t i v e v i r u s c a n b e i d e n t i f i e d f r o m r e s t i n g s p o r e s o f f u n g u s a f t e r a i r - d r y i n g o f r o o t s o r l o n g - t e r m s t o r a g e o f i n f e s t e d s o i l o r a f t e r a c i d ( 5 N H C 1 ) o r t r i s o d i u m p h o s p h a t e ( 2 0 % ) t r e a t m e n t s , w h i c h 3 4 k i l l e x t e r n a l l y - b o r n e (in vitro t r a n s m i t t e d ) v i r u s ( C a m p b e l l , 1985; H i r u k i , 1 9 8 7 ) . T h e p r o c e s s o f in vivo v i r u s a c q u i s i t i o n a n d t r a n s m i s s i o n i s u n k n o w n b u t i t m a y b e t h a t i n o c u l a t i o n o c c u r s s o o n a f t e r t h e f u n g u s p e n e t r a t e s t h e v i r u s - i n f e c t e d h o s t c e l l , b e f o r e t h e f o r m a t i o n o f a t h a l l u s w a l l ( C a m p b e l l , 1 9 9 6 ) . V i r u s e s a r e w i t h i n z o o s p o r e s u p o n r e l e a s e f r o m r o o t c e l l s a n d c a n n o t b e a c q u i r e d b y z o o s p o r e s o u t s i d e o f t h e p l a n t i n c o n t r a s t t o v i r u s e s t r a n s m i t t e d i n t h e in vitro m a n n e r ( s e e b e l o w ) . V i r u s e s w i t h i n r e s t i n g s p o r e s c a n s u r v i v e f o r l o n g p e r i o d s a n d s o i n f e s t a t i o n s b y in v / v o - t r a n s m i t t e d v i r u s e s a r e v i r t u a l l y p e r m a n e n t , w i t h v i r u s r e s i s t a n c e i n p l a n t s b e i n g t h e p r i m a r y c o n t r o l m e a s u r e ( C a m p b e l l , 1 9 9 6 ) . In vivo t r a n s m i s s i o n b y Olpidium brassicae A n a s s o c i a t i o n b e t w e e n O. brassicae a n d b i g v e i n d i s e a s e o f l e t t u c e w a s t h e f i r s t d e s c r i p t i o n o f Olpidium s p p . i n v o l v e d i n d i s e a s e p r o d u c t i o n o n p l a n t s ( G r o g a n et al., 1958; F r y , 1 9 5 8 ) . T h e c a u s a t i v e a g e n t o f t h e d i s e a s e w a s d e t e r m i n e d t o b e Lettuce big-vein virus ( L B V V ) ( C a m p b e l l et al., 1 9 6 1 ; C a m p b e l l a n d G r o g a n , 1 9 6 3 ) . Tobacco stunt virus ( T S t V ) w a s a l s o s h o w n t o b e t r a n s m i t t e d b y O. brassicae ( H i r u k i , 1 9 7 0 ) . V i r i o n s o f L B V V a n d T S t V a r e r o d - s h a p e d a n d c l o s e l y r e l a t e d s e r o l o g i c a l l y ( C a m p b e l l , 1 9 9 6 ) . T S t V c o n t a i n s t w o d s R N A s a n d i t i s l i k e l y t h a t L B V V a l s o c o n t a i n s d s R N A s . T h e r e l a t i o n s h i p s o f T S t V a n d L B V V w i t h O. brassicae a r e v e r y s i m i l a r ( G r o g a n a n d C a m p b e l l , 1 9 6 6 ) . O. brassicae-trmsmitted L B V V i s a c q u i r e d as t h e f u n g u s d e v e l o p s i n v i r u s -i n f e c t e d h o s t c e l l s ( C a m p b e l l a n d G r o g a n , 19 6 3 ) . A p p r o x i m a t e l y 5 0 % o f s i n g l e s p o r a n g i a l c u l t u r e s c o n t a i n L B V V ( L i n et al, 1970; C a m p b e l l , 1 9 8 8 ) . T h e r e i s l i m i t e d e v i d e n c e t h a t L B V V d o e s n o t r e p l i c a t e i n O. brassicae ( C a m p b e l l , 1 9 9 6 ) . T h e l a c k o f 3 5 r e p l i c a t i o n o f L B V V i n i t s v e c t o r w o u l d e x p l a i n w h y c u l t u r e s o f O. brassicae, w h i c h r e a d i l y i n f e c t a n d r e p r o d u c e o n s u g a r b e e t r o o t s , l o s e t h e i r a b i l i t y t o t r a n s m i t L B V V a f t e r s e r i a l p a s s a g e t o v i r u s - r e s i s t a n t s u g a r - b e e t r o o t s ( C a m p b e l l , 1 9 6 2 ) . L B V V - i n f e c t e d O. brassicae c o n t i n u e d t o b e v i r u l i f e r o u s a f t e r s e r i a l p a s s a g e t o l e t t u c e r o o t s , i n w h i c h t h e v i r u s r e p l i c a t e s r e a d i l y ( C a m p b e l l , 1 9 6 2 ) . I n t h e a b s e n c e o f r e p l i c a t i o n i n t h e v e c t o r , v i r u s t i t e r f a l l s w i t h e a c h g e n e r a t i o n u n l e s s t h e f u n g u s i n f e c t s h o s t c e l l s i n w h i c h t h e v i r u s c a n m u l t i p l y ( C a m p b e l l , 1 9 9 6 ) . L B V V a n d T S t V s u r v i v e i n r e s t i n g s p o r e s a n d c a n r e m a i n i n i n f e s t e d s o i l i n d e f i n i t e l y . In vivo t r a n s m i s s i o n b y Polymyxa a n d Spongospora s p p . S e v e r a l m e m b e r s o f t h e f u r o - a n d b y m o v i r u s g r o u p s a r e f u n g a l l y t r a n s m i t t e d i n t h e in vivo m a n n e r b y Polymyxa spp. ( T a b l e 1.2; G r a y a n d R o c h o n , 1 9 9 9 ) . O n e f u r o v i r u s , Potato mop top virus ( P M T V ) a n d t w o u n c h a r a c t e r i z e d v i r u s e s , Watercress yellow spot virus ( W Y S V ) a n d Watercress chlorotic leaf spot agent ( W C L A ) , a r e t r a n s m i t t e d b y Spongospora s p p ( T a b l e 1.2, G r a y a n d R o c h o n , 1 9 9 9 ) . F u n g a l l y t r a n s m i s s i b l e f u r o v i r u s e s c o n t a i n s e q u e n c e h o m o l o g i e s i n a c o n s e r v e d d o m a i n o f a C P r e a d t h r o u g h p r o t e i n . I n t h i s r e g a r d , t h e f u r o v i r u s r e a d t h r o u g h d o m a i n m a y h a v e a f u n c t i o n s i m i l a r t o th a t o f t h e R T D o f t h e a p h i d - t r a n s m i t t e d l u t e o v i r u s e s ( s e e s e c t i o n 1.2.1; C a m p b e l l , 1 9 9 6 ) . B y m o v i r u s e s d o n o t e n c o d e a C P R T b u t d o e n c o d e a p r o t e i n f r o m t h e s e c o n d O R F o f R N A - 2 w h i c h i s i n v o l v e d i n t r a n s m i s s i o n ( C a m p b e l l , 1 9 9 6 ) . F u r o - a n d b y m o v i r u s e s a r e r o d - s h a p e d b u t t h e y a r e m o r p h o l o g i c a l l y d i s t i n g u i s h a b l e . F u r o v i r u s e s h a v e t w o t o f i v e s e p a r a t e l y e n c a p s i d a t e d s s R N A s a n d b y m o v i r u s e s h a v e t w o s s R N A s ( C a m p b e l l , 1 9 9 6 ) . T h e g e n o m e s o f t h e s e v i r u s e s c a n b e a l t e r e d t h r o u g h s e r i a l p a s s a g i n g o r m a i n t e n a n c e o n o l d e r p l a n t s . S p o n t a n e o u s d e l e t i o n 3 6 m u t a t i o n s i n t h e r e g i o n e n c o d i n g t h e r e a d t h r o u g h p r o t e i n o f t h e C P o f Soil borne wheat mosaic virus ( S B W M V ) , B N Y V V , Peanut clump virus ( P C V ) , a n d B a M M V h a v e b e e n i d e n t i f i e d f r o m s e r i a l m e c h a n i c a l p a s s a g e i n t h e a b s e n c e o f t h e i r f u n g a l v e c t o r s ( C h e n et al., 1995; S h i r a k o a n d B r a k k e , 1984; T a m a d a a n d K u s u m e , 19 9 1 ; M a n o h a r et al., 1 9 9 3 ; D e s s e n s et al., 1995; J a c o b i et al, 1 9 9 5 ) . It h a s b e e n s u g g e s t e d t h a t t h e d e l e t e d r e g i o n s c o r r e s p o n d t o p o r t i o n s o f t h e C P i n v o l v e d i n f u n g u s t r a n s m i s s i o n . B N Y V V w a s m e c h a n i c a l l y p a s s a g e d 17 t i m e s o v e r a p e r i o d o f t h r e e y e a r s i n o r d e r t o p r o d u c e d e l e t i o n m u t a n t s i n R N A - 2 ( T a m a d a a n d K u s u m e , 199 1 ) . T h e s e B N Y V V m u t a n t s h a d d e l e t i o n s i n t h e C - t e r m i n u s o f t h e R T p r o t e i n a n d w e r e n o t t r a n s m i s s i b l e b y t h e v e c t o r o f B N Y V V , Polymyxa betae, s u g g e s t i n g t h a t t h e f u l l - l e n g t h 7 5 k D a R T p r o t e i n w a s r e q u i r e d f o r t r a n s m i s s i o n ( T a m a d a a n d K u s u m e , 199 1 ) . T h i s w a s t h e f i r s t d i r e c t p r o o f t h a t a C P R T p r o t e i n p l a y s a r o l e i n v e c t o r t r a n s m i s s i o n o f a p l a n t v i r u s . D e l e t i o n a n a l y s i s a n d s c a n n i n g a l a n i n e m u t a g e n e s i s h a v e i d e n t i f i e d a K T E R a m i n o a c i d m o t i f n e a r t h e C - t e r m i n u s o f t h e B N Y V V R T p r o t e i n ( T a m a d a et al, 1 9 9 6 ) . T h e Polymyxa g r a m z m s - t r a n s m i t t e d v i r u s , S B W M V , h a s a s i m i l a r s e q u e n c e m o t i f ( K T E I R ) l o c a t e d n e a r t h e C - t e r m i n u s o f i t s R T p r o t e i n ( S h i r a k o a n d W i l s o n , 1 9 9 3 ) . B a s e d o n t h e s e s i m i l a r i t i e s , i t h a s b e e n s u g g e s t e d t h a t t h e s e m o t i f s p l a y i m p o r t a n t r o l e s i n f u n g u s t r a n s m i s s i o n . A l i g n m e n t s o f t h e C P r e a d t h r o u g h d o m a i n o f s e v e r a l f u n g a l l y t r a n s m i t t e d f u r o - a n d b y m o v i r u s e s h a v e i d e n t i f i e d t h e c o m m o n a m i n o a c i d d y a d s E R a n d Q R ( P e e r e n b o o m et al, 1 9 9 6 ) . T h e s e m o t i f s a r e l o c a t e d o n t h e o u t s i d e o f t h e p r o t e i n , s u g g e s t i n g t h a t t h e y m a y f a c i l i t a t e i n t e r a c t i o n s w i t h t h e f u n g a l v e c t o r . 3 7 1.3 Cucumber necrosis virus C N V w a s i d e n t i f i e d i n t h e 1950's as t h e c a u s a t i v e a g e n t o f a s e v e r e d i s e a s e i n g r e e n h o u s e g r o w n c u c u m b e r s i n O n t a r i o , C a n a d a ( M c K e e n , 1 9 5 9 ) . C N V c a u s e d n e c r o t i c s p o t t i n g a n d m a l f o r m a t i o n o f t h e f o l i a g e , s t u n t i n g o f g r o w t h a n d r e d u c e d f r u i t s i z e , w i t h d e a t h o f t h e p l a n t s i x t o e i g h t w e e k s p o s t - i n f e c t i o n i n s y s t e m i c c a s e s . C N V i s r e g u l a r l y f o u n d i n f e c t i n g g l a s s h o u s e g r o w n c u c u m b e r s i n O n t a r i o a n d h a s b e e n i d e n t i f i e d as a c a u s a l a g e n t o f d i s e a s e o f t o m a t o s i n T e x a s a n d A r i z o n a . It i s a l s o f o u n d i n f e c t i n g l e t t u c e a s y m p t o m a t i c a l l y i n t h e S a l i n a s V a l l e y o f C a l i f o r n i a ( D . M . R o c h o n , p e r s o n a l c o m m u n i c a t i o n ) . A l t h o u g h C N V h a s a l i m i t e d n a t u r a l h o s t r a n g e , i t s e x p e r i m e n t a l h o s t r a n g e i s w i d e . C N V c a n i n f e c t p l a n t s f r o m s e v e r a l d i c o t y l e d o n o u s p l a n t f a m i l i e s . 1.3.1 Taxonomic status of CNV C N V r e p r e s e n t s o n e o f s e v e r a l s p e c i e s i n t h e T o m b u s v i r u s g e n u s ( f a m i l y Tombusviridae). T o m b u s v i r u s e s h a v e 3 0 n m s p h e r i c a l p a r t i c l e s c o n t a i n i n g a s i n g l e m o l e c u l e o f p o s i t i v e s e n s e R N A , c o m p r i s e d o f a p p r o x i m a t e l y 4,700 nt. C N V i s s e r o l o g i c a l l y d i s t i n c t f r o m o t h e r t o m b u s v i r u s e s , l i k e l y d u e t o t h e v a r i a b l e n a t u r e o f t h e t o m b u s v i r u s C P p r o t r u d i n g d o m a i n . M o s t t o m b u s v i r u s e s a r e s o i l - t r a n s m i t t e d b u t C N V i s t h e o n l y t o m b u s v i r u s w h i c h h a s b e e n s h o w n t o h a v e a s p e c i f i c s o i l v e c t o r . T o m b u s v i r u s e s r e p r e s e n t p a r t o f t h e f a m i l y Tombusviridae. A l t h o u g h C N V i s t h e o n l y t o m b u s v i r u s f o r w h i c h a s o i l v e c t o r h a s b e e n u n e q u i v o c a l l y d e m o n s t r a t e d , s e v e r a l m e m b e r s o f t h e Tombusviridae a r e k n o w n t o b e f u n g a l l y t r a n s m i t t e d ( T a b l e 1.2). It i s p o s s i b l e t h a t a d d i t i o n a l t o m b u s v i r u s e s as w e l l as Tombusviridae m e m b e r s w i l l b e f o u n d t o h a v e Olpidium v e c t o r s . 3 8 ORF 5 5' TJAG —I 33 kDa | ORF1 ORF 2 92 kDa TH 41 kDa ( C P i n - l 2 1 k D a l — ORF 3 ORF 4 I 20 kDa 1 3' sgRNA 1 sgRNA 2 Figure 1.2 G e n o m i c o r g a n i z a t i o n o f C N V . T h e f i v e o p e n r e a d i n g f r a m e s ( O R F s ) e n c o d e d b y t h e C N V g e n o m e a r e s h o w n . P r o t e i n s p r o d u c e d b y e a c h O R F a r e i n d i c a t e d . T h e 3 3 a n d 9 2 k D a p r o t e i n s a r e t r a n s l a t e d f r o m g e n o m i c l e n g t h R N A a n d t h e 4 1 k D a a n d 2 1 / 2 0 k D a p r o t e i n s a r e t r a n s l a t e d f r o m s u b g e n o m i c ( s g ) R N A s 1 a n d 2, r e s p e c t i v e l y . S g R N A 2 i s b i c i s t r o n i c w i t h t h e 2 0 k D a p r o t e i n b e i n g p r o d u c e d b y l e a k y s c a n n i n g ( J o h n s t o n a n d R o c h o n , 1 9 9 6 ) . 1.3.2 Genomic organization T h e g e n o m e o f C N V i s 4 7 0 1 nt, h a s b e e n f u l l y s e q u e n c e d a n d a f u l l - l e n g t h i n f e c t i o u s c D N A c l o n e h a s b e e n p r o d u c e d ( R o c h o n a n d T r e m a i n e , 1989; R o c h o n a n d J o h n s t o n , 1 9 9 1 ) . A t l e a s t f i v e p r o t e i n s o f m o l e c u l a r w e i g h t 33, 92, 4 1 , 2 1 , a n d 2 0 k D a ar e p r e d i c t e d b y t h e s e q u e n c e o f C N V ( F i g u r e 1.2). B a s e d o n s e q u e n c e c o m p a r i s o n s i t h a s b e e n s u g g e s t e d t h a t p 9 2 i s t h e r e p l i c a s e ( R o c h o n a n d T r e m a i n e , 1 9 8 9 ) . A d d i t i o n a l w o r k h a s s h o w n t h a t p 4 1 i s t h e c o a t p r o t e i n ( C P ) , p 2 1 i s a c e l l - t o - c e l l m o v e m e n t p r o t e i n , a n d p 2 0 i s i n v o l v e d i n s y m p t o m i n d u c t i o n as w e l l as s u p p r e s s i n g t h e f o r m a t i o n o f d e f e c t i v e i n t e r f e r i n g R N A s ( J o h n s t o n a n d R o c h o n , 1990; R o c h o n a n d J o h n s t o n , 1 9 9 1 ; R o c h o n , 1 9 9 1 ) . T h e f u n c t i o n o f p 3 3 i s n o t k n o w n b u t i t i s b e l i e v e d t o b e a n e c e s s a r y c o m p o n e n t o f t h e v i r a l r e p l i c a s e . T w o 3' c o - t e r m i n a l s u b g e n o m i c R N A s ( s g R N A 1 a n d s g R N A 2 ) a r e g e n e r a t e d f r o m C N V g e n o m i c R N A d u r i n g i n f e c t i o n ( R o c h o n a n d J o h n s t o n , 1 9 9 1 ) . S g R N A l 3 9 s e r v e s as t e m p l a t e f o r t h e c o a t p r o t e i n a n d s g R N A 2 i s a b i f u n c t i o n a l m R N A e n c o d i n g p 2 1 a n d p 2 0 . T r a n s l a t i o n o f p 2 0 f r o m s g R N A 2 o c c u r s v i a a l e a k y s c a n n i n g m e c h a n i s m ( J o h n s t o n a n d R o c h o n , 1990, 1 9 9 6 ) . 1.3.3 CNV defective interfering RNAs D e f e c t i v e i n t e r f e r i n g ( D I ) R N A s a r e n a t u r a l v i r a l d e l e t i o n m u t a n t s p r o d u c e d w h e n e r r o r s a r e m a d e d u r i n g r e p l i c a t i o n o f t h e p a r e n t a l v i r u s . D I R N A s a r e u n a b l e t o r e p l i c a t e w i t h o u t t h e p r o d u c t i o n o f t r a n s - a c t i n g f a c t o r s , s u c h as t h e v i r a l r e p l i c a s e , b y t h e p a r e n t a l v i r u s . D I g e n o m e s r e t a i n a m i n i m u m o f c i s - a c t i n g s e q u e n c e s r e q u i r e d f o r r e p l i c a t i o n . C o m p e t i t i o n b e t w e e n t h e m o r e e f f i c i e n t l y r e p l i c a t i n g D I R N A s a n d t h a t o f t h e p a r e n t a l v i r u s f o r t h e s e f a c t o r s r e s u l t s i n i n t e r f e r e n c e w i t h t h e n o r m a l r e p l i c a t i o n o f t h e p a r e n t a l , o r h e l p e r , v i r u s ( J o n e s et al., 1 9 9 0 ) . D I R N A s a r e t h o u g h t t o o c c u r u n i v e r s a l l y i n a n i m a l v i r u s i n f e c t i o n s ( P e r r a u l t , 1 9 8 1 ) a n d h a v e b e e n r e p o r t e d f o r s e v e r a l p o s i t i v e - s t r a n d s s R N A p l a n t v i r u s e s ( r e v i e w e d b y R o u x et al., 1 9 9 1 ) i n c l u d i n g C N V ( R o c h o n , 1 9 9 1 ; J o h n s t o n a n d R o c h o n , 1990; F i n n e n a n d R o c h o n , 1 9 9 3 ) , T B S V - C h ( H i l l m a n et al, 1 9 8 7 ) , Cymbidium ringspot tombusvirus ( B u r g y a n et al., 1 9 8 9 ) , Turnip crinkle carmovirus ( L i et al., 1 9 8 9 ) , Clover yellow mosaic potexvirus ( W h i t e et al., 1 9 9 1 ) , Tomato spotted wilt tospovirus ( R e s e n d e et al., 1 9 9 2 ) a n d s e v e r a l o t h e r p l a n t v i r u s e s . R N A e x t r a c t s o f p l a n t s i n f e c t e d w i t h a l a b o r a t o r y c u l t u r e o f C N V ( C N V - L c ) c o n t a i n e d h i g h l e v e l s o f a v i r u s - r e l a t e d R N A s p e c i e s o f a p p r o x i m a t e l y 4 0 0 n t ( J o h n s t o n a n d R o c h o n , 1 9 9 0 ) . S y m p t o m s o n p l a n t s i n o c u l a t e d w i t h C N V - L c w e r e p e r s i s t e n t a n d a t t e n u a t e d w h i l e a s e v e r e s y s t e m i c n e c r o s i s o f p l a n t s i n o c u l a t e d w i t h w i l d - t y p e C N V t r a n s c r i p t s o c c u r r e d , i n d i c a t i n g t h a t t h i s 4 0 0 n t v i r u s - l i k e R N A c o u l d b e a D I . 4 0 S e q u e n c i n g o f s e v e r a l c l o n e s f r o m t h e t h e C N V - L c s m a l l R N A s i n d i c a t e d t h a t t h e s e s m a l l R N A s w e r e i n f a c t D I R N A s d e r i v e d f r o m t h e C N V g e n o m e ( F i n n e n a n d R o c h o n , 1 9 9 3 ) . I n a d d i t i o n t o t h e a t t e n u a t e d a n d p e r s i s t e n t s y m p t o m s o c c u r i n g i n t h e p r e s e n c e o f D I R N A s , a r e d u c e d y i e l d o f v i r u s p a r t i c l e s ( w i l d - t y p e C N V ) i s o b s e r v e d . T h e c o a t p r o t e i n o f C N V i s n o t r e q u i r e d f o r e f f i c i e n t g e n e r a t i o n o r a c c u m u l a t i o n o f D I R N A s ( R o c h o n et al, 1 9 9 4 ) . 1.3.4 Coat protein mutants A c o a t p r o t e i n d e l e t i o n m u t a n t w h i c h d o e s n o t c o n t a i n t h e s e q u e n c e c o d i n g f o r t h e p r o t r u d i n g d o m a i n ( P - d o m a i n ; s e e p a r t i c l e s t r u c t u r e b e l o w ) o f i t s C P ( M c L e a n et al, 1 9 9 3 ) w a s e x a m i n e d t o d e t e r m i n e t h e r o l e o f t h e P - d o m a i n i n C N V i n f e c t i o n . T h i s m u t a n t , n a m e d P D ( - ) , r e p l i c a t e d w e l l a n d m o v e d s y s t e m i c a l l y i n t h e C N V s y s t e m i c h o s t , N. clevelandii. N e i t h e r C N V v i r i o n s n o r C P s u b u n i t s c o u l d b e d e t e c t e d f r o m s a p o f P D ( -) - i n f e c t e d p l a n t s . I n t e r e s t i n g l y , t h e m o s t p r o m i n e n t R N A s p e c i e s i n s y s t e m i c a l l y i n f e c t e d l e a v e s o f P D ( - ) - i n o c u l a t e d p l a n t s w a s a p p r o x i m a t e l y 3 8 0 0 nt, c o r r e s p o n d i n g t o t h e d e l e t i o n o f a l l b u t 7 4 n t o f t h e 1 1 4 0 n t C P c o d i n g s e q u e n c e ( C P ( - ) ) ( M c L e a n et al, 1 9 9 3 ) . T h e s e r e s u l t s s h o w e d t h a t C N V R N A c a n r e p l i c a t e a n d m o v e s y s t e m i c a l l y i n p l a n t s i n t h e a b s e n c e o f a f u n c t i o n a l C P . A n o t h e r t o m b u s v i r u s , Tomato bushy stunt virus, c h e r r y s t r a i n ( T B S V - C h ) , i s a l s o a b l e t o m o v e c e l l - t o - c e l l a n d s y s t e m i c a l l y i n N. clevelandii a n d N. benthamiana i n t h e a b s e n c e o f i t s C P ( S c h o l t o f et al, 1 9 9 3 ) . I n f u r t h e r a t t e m p t s t o p r o d u c e a P - d o m a i n l e s s C N V p a r t i c l e , s e v e r a l P - d o m a i n f r a m e s h i f t a n d d e l e t i o n m u t a n t s w e r e p r o d u c e d a n d e x a m i n e d f o r t h e p r e s e n c e o f v i r u s o r v i r u s - l i k e p a r t i c l e s u s i n g e l e c t r o n m i c r o s c o p y ( S i t et al, 1 9 9 5 ) . P a r t i c l e s w e r e n o t 4 1 o b s e r v e d f o r a n y o f t h e m u t a n t s , i n c l u d i n g t h o s e l a c k i n g o n l y t w e l v e a m i n o a c i d s at t h e c a r b o x y - t e r m i n u s o f t h e P - d o m a i n . C P s u b u n i t s w e r e i d e n t i f i e d f o r s e v e r a l o f t h e s e P-d o m a i n m u t a n t s i n s a p b u t at l o w e r l e v e l s t h a n w i l d - t y p e C N V , i n d i c a t i n g t h a t t h e d e l e t e d C P s u b u n i t s m a y b e l e s s s t a b l e t h a n w i l d - t y p e ( S i t et al., 1 9 9 5 ) . T h e a b s e n c e o f v i r u s p a r t i c l e s i n p l a n t s i n f e c t e d w i t h P - d o m a i n m u t a n t s d e m o n s t r a t e s t h a t t h e P - d o m a i n i s r e q u i r e d f o r C N V p a r t i c l e f o r m a t i o n a n d / o r s t a b i l i t y . (c) F i g u r e 1.3 S t r u c t u r e o f (a) t h e T B S V p a r t i c l e , (b) c o a t p r o t e i n s u b u n i t , a n d ( c ) l i n e a r o r d e r o f d o m a i n s o f t h e c o a t p r o t e i n . T h e n u m b e r s i n ( c ) c o r r e s p o n d t o t h e n u m b e r o f a m i n o a c i d s i n e a c h d o m a i n ( a d a p t e d f r o m H o p p e r et al., 1 9 8 4 ) . S e e t e x t f o r a d d i t i o n a l d e t a i l s . 1.3.5 P a r t i c l e s t r u c t u r e D e t a i l s o f t h e C N V p a r t i c l e s t r u c t u r e h a v e n o t b e e n d e t e r m i n e d . H o w e v e r , t h e t h r e e - d i m e n s i o n a l s t r u c t u r e o f t h e p a r t i c l e a n d c o n s t i t u e n t c o a t p r o t e i n s u b u n i t s o f t h e c l o s e l y r e l a t e d t y p e m e m b e r o f t h e t o m b u s v i r u s g r o u p , T B S V , h a s b e e n d e t e r m i n e d b y X -4 2 r a y c r y s t a l l o g r a p h y t o h i g h r e s o l u t i o n ( H a r r i s o n et al, 1 9 7 8 ) . T h e 1 8 0 i d e n t i c a l C P s u b u n i t s a r e a r r a n g e d i n T = 3 i c o s a h e d r a l s y m m e t r y i n t h e v i r a l c a p s i d . E a c h C P s u b u n i t f o l d s i n t o t h r e e d o m a i n s : t h e R N A - b i n d i n g ( R ) , s h e l l ( S ) , a n d p r o t r u d i n g ( P ) d o m a i n s ( F i g u r e 1.3; H a r r i s o n et al, 1978; H o p p e r et al, 1 9 8 4 ) . T h e R a n d S d o m a i n s a r e c o n n e c t e d b y a n a r m (a) a n d t h e S a n d P d o m a i n s a r e j o i n e d b y a s h o r t h i n g e ( h ) . T B S V C P s u b u n i t s o c c u r i n t h r e e d i f f e r e n t e n v i r o n m e n t s i n t h e c a p s i d a r c h i t e c t u r e , d e s i g n a t e d A , B , a n d C . T h e a r m s o f t h e C s u b u n i t s i n t e r c a l a t e i n t h e i n t e r i o r o f t h e p a r t i c l e t o f o r m a c a g e - l i k e s t r u c t u r e w h i l e C a + + s t a b i l i z e s t h e i n t e r a c t i o n b e t w e e n s h e l l d o m a i n s o f s u b u n i t s A - B , B - C , a n d C - A at t h e p a r t i c l e s u r f a c e ( H a r r i s o n et al, 1 9 7 8 ) . A d d i t i o n o f c h e l a t o r s s u c h as E D T A r e m o v e C a + + f r o m t h e s e s u b u n i t c o n t a c t s , c a u s i n g a s p a r t i c a c i d r e s i d u e s t o r e p e l e a c h o t h e r a n d t h e p a r t i c l e t o s w e l l i n a p H d e p e n d e n t f a s h i o n ( H a r r i s o n etal, 1 9 7 8 ) . A l t h o u g h t h e c r y s t a l s t r u c t u r e o f C N V h a s n o t b e e n d e t e r m i n e d , h o m o l o g y b a s e d s t r u c t u r a l m o d e l i n g h a s b e e n u s e d t o m o d e l t h e s t r u c t u r e s o f t h e C N V C P s u b u n i t f o l l o w i n g a l i g n m e n t s w i t h t h e T B S V s u b u n i t . T h e s e s t u d i e s h a v e i n d i c a t e d t h a t t h e o v e r a l l s e c o n d a r y s t r u c t u r e o f C N V d o e s n o t d i f f e r r a d i c a l l y f r o m t h a t o f T B S V ( K . K a k a n i a n d D. R o c h o n , p e r s o n a l c o m m u n i c a t i o n ) . 1.3.6 The role of the CNV coat protein in fungus transmission T h e C P O R F o f C N V a n d t h a t o f T B S V - C h , a t o m b u s v i r u s w i t h n o k n o w n f u n g a l v e c t o r , w e r e e x c h a n g e d i n f u l l - l e n g t h i n f e c t i o u s c D N A c l o n e s o f e a c h v i r u s t o d e t e r m i n e i f t h e C P i s i n v o l v e d i n t h e s p e c i f i c i t y o f t r a n s m i s s i o n ( M c L e a n et al, 1 9 9 4 ) . P a r t i c l e s o f c h i m e r i c T B S V - C h c o n t a i n i n g t h e C N V C P g e n e w e r e t r a n s m i s s i b l e v i a z o o s p o r e s o f O. 4 3 bornovanus, w h i l e p a r t i c l e s o f c h i m e r i c C N V c o n t a i n i n g t h e T B S V - C h C P g e n e w e r e n o t t r a n s m i s s i b l e b y O. bornovanus ( M c L e a n et al., 1 9 9 4 ) . T h e s e r e s u l t s w e r e t h e f i r s t d i r e c t e v i d e n c e t h a t t h e C P o f a p l a n t v i r u s i s r e s p o n s i b l e f o r t h e s p e c i f i c i t y o f i t s t r a n s m i s s i o n b y a f u n g u s . W e h y p o t h e s i z e t h a t s e q u e n c e s a n d / o r s t r u c t u r e s o f t h e C N V C P i n t e r a c t w i t h s p e c i f i c f a c t o r s ( s ) i n t h e z o o s p o r e p l a s m a l e m m a t o f a c i l i t a t e a t t a c h m e n t a n d t h u s t r a n s m i s s i o n . T h e s h e l l a n d p r o t r u d i n g d o m a i n s o f t h e t o m b u s v i r u s p a r t i c l e f o r m d i s t i n c t j e l l y - r o l l b a r r e l s ( H a r r i s o n et al., 1 9 7 8 ) , c o m m o n s t r u c t u r a l m o t i f s o f m a n y i c o s a h e d r a l v i r u s e s a n d c e r t a i n p r o t e i n s k n o w n to h a v e r e c e p t o r b i n d i n g f u n c t i o n s ( C h e l v a n a y a g a m et ah, 1992; G i b s o n a n d A r g o s , 1 9 9 0 ) . T h e j e l l y - r o l l b a r r e l s o f C N V m a y b e i n v o l v e d i n t h e i n t e r a c t i o n o f t h i s v i r u s w i t h p u t a t i v e r e c e p t o r m o l e c u l e s o n t h e s u r f a c e o f O. bornovanus z o o s p o r e s . 1.4 Brief overview of virus-receptor interactions V i r u s i n f e c t i o n o f h o s t c e l l s b e g i n s b y a t t a c h m e n t o f t h e v i r u s t o t h e h o s t c e l l s u r f a c e ( f o r r e v i e w s s e e D a l e s , 1973; L o n b e r g - H o l m a n d P h i l i p s o n , 1974; D i m m o c k , 1982; T a r d i e u et a l . , 1982; P a u l s o n , 1985; M a r s h a n d H e l e n i u s , 1 9 8 9 ) . T h e n a t u r e , n u m b e r a n d d i s t r i b u t i o n o f t h e s p e c i f i c c e l l u l a r r e c e p t o r s t o w h i c h m o s t v i r u s e s a t t a c h p l a y s a r o l e i n d e t e r m i n i n g t h e i r h o s t r a n g e a n d t i s s u e t r o p i s m ( H o l l a n d , 1 9 6 1 ; L o n b e r g -H o l m a n d P h i l i p s o n , 1974; C r o w e l l a n d L a n d a u , 1 9 7 9 ; P a u l s o n , 1985; M i m s , 1 9 8 6 ) . A n i m a l v i r u s e s u t i l i z e a w i d e v a r i e t y o f c e l l u l a r s u r f a c e m o l e c u l e s as r e c e p t o r s i n c l u d i n g p r o t e i n s , c a r b o h y d r a t e s a n d g l y c o l i p i d s ( R o s s m a n n , 1994; T a b l e 1.3). A t t a c h m e n t i s 4 4 m e d i a t e d b y t h e b i n d i n g o f a s i t e o n t h e v i r u s p a r t i c l e , a v i r a l a t t a c h m e n t p r o t e i n ( V A P ) , t o a m o l e c u l e o n t h e c e l l s u r f a c e a c t i n g as a v i r u s r e c e p t o r ( L e n t z , 1 9 9 0 ) . Table 1.3 S o m e k n o w n r e c e p t o r s f o r a n i m a l v i r u s e s 1 . Cellular Receptor Virus Reference Sialic acid Reoviruses Paul etal., 1989; Choi etal., 1990 Influenza virus Weis etal, 1988 Polyomavirus Fried etal., 1981 Immunoglobulin family: (i) CD4 HIV Dalgleish etal., 1984 (ii) Poliovirus receptor Polioviruses Mendelsohn et al., 1989 (iii) ICAM-1 Major serotype group of Greve etal., 1989; Staunton etal, 1989; HRV Tomassini etal, 1989 Integrins FMDV Acharya etal, 1989; Mason etal., 1993 Complement receptor type 2 Epstein-Barr viruses Moore etal., 1987; Tanner etal, 1987 (B lymphocyte surface glycoprotein) Amino acid permeases Ecotropic murine Kim etal, 1991; Wang etal, 1991 leukemia virus Carcinoembryonic antigen Mouse hepatitis virus (a Williams etal, 1991 coronavirus) Erythrocyte P antigen Human B19 Parvovirus Browner al, 1993 LDL receptor Minor serotype group of Hoferefa/., 1994 HRV Aminopeptidase N Transmissible Yeageref al, 1992 gastroenteritis virus Human coronavirus, Vlasakef al, 1988 strain 229E 'Table is from Rossmann, 1994. V i r u s r e c e p t o r s h a v e b e e n d e f i n e d as s t r u c t u r e s o n t h e c e l l s u r f a c e t o w h i c h v i r u s a t t a c h m e n t i s f o l l o w e d b y a b i o l o g i c a l l y r e l e v a n t r e s p o n s e ( T a r d i e u et al, 1 9 8 2 ) . T h i s r e s p o n s e i s u s u a l l y i n f e c t i o n o f t h e c e l l b y e n t r y o f t h e v i r u s v i a e i t h e r m e m b r a n e f u s i o n o r r e c e p t o r - m e d i a t e d e n d o c y t o s i s ( P a u l s o n , 1 9 8 5; M a r s h a n d H e l e n i u s , 1 9 8 9 ) . F r o m s t u d i e s o f v i r u s - r e c e p t o r i n t e r a c t i o n s u s i n g t i s s u e c u l t u r e s y s t e m s , s e v e r a l f a c t o r s , i n c l u d i n g t e m p e r a t u r e , i o n i c s t r e n g t h , p H , c o m p o s i t i o n o f t h e m e d i u m , a n d t h e p r e s e n c e o f s e r u m , h a v e m a j o r e f f e c t s o n v i r u s b i n d i n g ( L o n b e r g - H o l m , 1 9 8 1 ) . 4 5 I n i t i a l c h a r a c t e r i z a t i o n o f t h e i n t e r a c t i o n b e t w e e n a v i r u s a n d a p u t a t i v e r e c e p t o r i n v o l v e s t h e e s t a b l i s h m e n t o f s p e c i f i c i t y i n t h e i n t e r a c t i o n ( T a r d i e u et al., 1 9 8 2 ) . T h r e e c r i t e r i a w e r e d e s c r i b e d b y T a r d i e u et al. ( 1 9 8 2 ) as n e c e s s a r y f o r e s t a b l i s h i n g t h a t a s p e c i f i c r e c e p t o r e x i s t s o n h o s t c e l l s . F i r s t , s p e c i f i c i t y o f b i n d i n g m u s t c o r r e l a t e w i t h t h e b i o l o g y o f t h e v i r u s - h o s t i n t e r a c t i o n . S e c o n d , b i n d i n g o f v i r u s t o h o s t c e l l m u s t b e s a t u r a b l e , f u r t h e r d e f i n i n g t h e i n t e r a c t i o n as s p e c i f i c . T h i r d , u n l a b e l e d v i r u s m u s t b e a b l e t o c o m p e t e o f f l a b e l e d h o m o l o g o u s v i r u s , o r h e t e r o l o g o u s v i r u s k n o w n t o h a v e t h e s a m e b i o l o g i c a l i n t e r a c t i o n w i t h t h e h o s t c e l l ( T a r d i e u et ah, 1 9 8 2 ) . T w o f u r t h e r c r i t e r i a u s e d t o c o n f i r m t h e i d e n t i t y o f a v i r a l r e c e p t o r a r e t h e d e m o n s t r a t i o n o f s p e c i f i c b i n d i n g o f a p u r i f i e d r e c e p t o r t o t h e v i r u s a n d a n a b i l i t y t o c o n f e r , b y g e n e t r a n s f e r , v i r u s b i n d i n g a c t i v i t y u p o n a c e l l t h a t p r e v i o u s l y d i d n o t b i n d v i r u s ( W h i t e a n d L i t t m a n , 1 9 8 9 ) . S u c c e s s f u l a p p r o a c h e s f o r t h e i d e n t i f i c a t i o n o f r e c e p t o r s h a v e i n c l u d e d t h e u s e o f a n t i b o d i e s t o c e l l - s u r f a c e a n t i g e n s t o b l o c k v i r a l a t t a c h m e n t o r i n f e c t i v i t y a n d t r a n s f e r o f D N A f r o m p e r m i s s i v e t o n o n - p e r m i s s i v e c e l l l i n e s ( V i l e a n d W e i s s , 1 9 9 1 ) . 1.5 Summary and Thesis Objectives T h e o v e r a l l g o a l o f t h i s t h e s i s i s t o e x a m i n e , at t h e m o l e c u l a r l e v e l , t h e i n t e r a c t i o n s b e t w e e n a p l a n t v i r u s , C N V , a n d i t s v e c t o r , O. bornovanus, t o d e t e r m i n e i f t h e r e a r e s p e c i f i c s i t e s o n t h e v i r u s p a r t i c l e w h i c h i n t e r a c t w i t h s p e c i f i c m o l e c u l e s o n t h e f u n g a l z o o s p o r e a c c o r d i n g t o t h e p r e v a i l i n g r e c e p t o r h y p o t h e s i s . T h e t h e s i s o b j e c t i v e s a r e d i v i d e d i n t o t w o p a r t s , t h e f i r s t o b j e c t i v e p e r t a i n i n g t o t h e v i r u s p a r t i c l e a n d p o t e n t i a l r e c e p t o r b i n d i n g s i t e s o n i t s s u r f a c e , a n d t h e s e c o n d o b j e c t i v e p e r t a i n i n g t o t h e f u n g a l 4 6 z o o s p o r e s a n d t h e s e a r c h f o r p u t a t i v e r e c e p t o r m o l e c u l e s o n i t s s u r f a c e . T h e s e o b j e c t i v e s a r e d e s c r i b e d i n m o r e d e t a i l b e l o w . 1. To determine if specific sequences or structures on the cucumber necrosis virus coat protein are involved in fungus transmission. A . Analysis of naturally occurring CNV mutants deficient in transmission. O n e c o m m o n l y u s e d a p p r o a c h f o r i d e n t i f y i n g r e g i o n s o f p r o t e i n s w h i c h h a v e s p e c i f i c f u n c t i o n s i s t o s e a r c h f o r n a t u r a l l y o c c u r r i n g m u t a n t s w h i c h h a v e l o s t t h a t f u n c t i o n . T h e m u t a n t s c a n t h e n b e c l o n e d a n d s e q u e n c e d a n d t h e l o c a t i o n o f t h e m u t a t i o n i d e n t i f i e d . T h e s p e c i f i c a m i n o a c i d o r t h e r e g i o n i t i s l o c a t e d i n i s t h e n i d e n t i f i e d as b e i n g i m p o r t a n t i n t h a t p a r t i c u l a r f u n c t i o n . T h i s a p p r o a c h w a s u s e d t o l o c a t e a r e g i o n i n t h e C N V C P r e q u i r e d f o r f u n g u s t r a n s m i s s i o n . T h e r e s u l t s o f t h i s s t u d y a r e d e s c r i b e d i n C h a p t e r 3. B . Primary amino acid sequence alignment. T h e a m i n o a c i d s e q u e n c e o f t h e C P o f s e v e r a l 0//?/ti/wra-transmissible v i r u s e s as w e l l as v i r u s e s w i t h n o k n o w n f u n g a l v e c t o r s w e r e a l i g n e d i n o r d e r t o d e t e r m i n e i f s p e c i f i c r e g i o n s o f t h e C P a r e c o n s e r v e d ( a n d p o s s i b l y t h e r e f o r e r e q u i r e d ) i n 0//?/d/wm-transmitted v i r u s e s . R e s u l t s o f t h i s a n a l y s i s a r e d e s c r i b e d i n C h a p t e r 4. C . Mutational analysis. S i t e - s p e c i f i c in vitro m u t a g e n e s i s c a n b e u s e d t o i d e n t i f y r e g i o n s o f p r o t e i n s i m p o r t a n t t o s p e c i f i c i n t e r a c t i o n s . H o w e v e r , I o p t e d t o i n s t e a d a n a l y z e n a t u r a l l y o c c u r r i n g m u t a n t s . T h i s i s b e c a u s e i t w a s a n t i c i p a t e d t h a t m a n y a r t i f i c i a l f u n g u s t r a n s m i s s i o n m u t a n t s m a y a c t u a l l y r e p r e s e n t v i r u s m u t a n t s d e f i c i e n t i n o t h e r a s p e c t s o f t h e v i r u s s u c h as p a r t i c l e f o r m a t i o n , e n c a p s i d a t i o n o f R N A , s t a b i l i t y , r e p l i c a t i o n , etc. 4 7 To assess the possible involvement of a receptor in the interaction between cucumber necrosis virus and zoospores of its fungal vector, Olpidium bornovanus. A . In vitro zoospore/virus binding studies. I f a s p e c i f i c m o l e c u l e m e d i a t i n g v i r u s b i n d i n g o c c u r s o n t h e s u r f a c e o f Olpidium z o o s p o r e s , t h e b i n d i n g w i l l s a t i s f y t h r e e c r i t e r i a : ( i ) b i o l o g i c a l s p e c i f i c i t y o f t r a n s m i s s i o n w i l l c o r r e l a t e w i t h t h e b i n d i n g a s s a y , ( i i ) v i r u s b i n d i n g t o z o o s p o r e s w i l l b e s a t u r a b l e , a n d ( i i i ) l a b e l e d v i r u s w i l l b e c o m p e t i t i v e l y i n h i b i t e d b y e x c e s s u n l a b e l e d h o m o l o g o u s v i r u s . T h e e x p e r i m e n t s d e s c r i b e d i n C h a p t e r 5 a d d r e s s t h e p o s s i b l e i n v o l v e m e n t o f r e c e p t o r s i n C N V t r a n s m i s s i o n b y O. bornovanus. B . I d e n t i f i c a t i o n o f t y p e s o f s u g a r s o n t h e s u r f a c e s o f Olpidium z o o s p o r e s . W o r k d o n e i n m y l a b o r a t o r y c o n c u r r e n t l y w i t h m y t h e s i s r e s e a r c h h a s s u g g e s t e d t h e i n v o l v e m e n t o f a z o o s p o r e g l y c o p r o t e i n i n C N V / z o o s p o r e i n t e r a c t i o n s . T h e s u g a r c o m p o s i t i o n o f t h e z o o s p o r e s u r f a c e o f Olpidium z o o s p o r e s w a s e x a m i n e d u s i n g f i v e F T T C - l a b e l e d l e c t i n s . A n i d e n t i f i c a t i o n o f p o t e n t i a l s u g a r s f o r v i r u s b i n d i n g o n t h e s u r f a c e o f Olpidium w o u l d a i d i n f u r t h e r i n v e s t i g a t i o n s i n t o t h e n a t u r e o f p u t a t i v e r e c e p t o r s f o r f u n g u s - t r a n s m i t t e d v i r u s e s . 4 8 2 C H A P T E R T W O : M A T E R I A L S A N D M E T H O D S 2.1 Maintenance of virus cultures T h e c h e r r y s t r a i n o f Tomato bushy stunt tombusvirus ( T B S V - C h ) w a s a g i f t f r o m T . J . M o r r i s ( U n i v . o f N e b r a s k a , L i n c o l n ) ; Tobacco necrosis necrovirus ( T N V - N Z ) a n d Cucumber leaf spot aureusvirus ( C L S V ) w e r e g i f t s f r o m R.N. C a m p b e l l ( U . C . D a v i s , C A ) . Melon necrotic spot carmovirus ( M N S V ) ( D u t c h i s o l a t e ) w a s o r i g i n a l l y o b t a i n e d f r o m D.Z. M a a t . Cucumber necrosis virus ( C N V ) a n d C L S V i n f e c t i o n s w e r e i n i t i a t e d u s i n g t r a n s c r i p t s o f f u l l - l e n g t h c D N A c l o n e s ( R o c h o n a n d J o h n s t o n , 1 9 9 1 ; D. R o c h o n , u n p u b l i s h e d ) . C N V , C L S V , a n d M N S V w e r e c o n f i r m e d t o b e t r a n s m i s s i b l e b y O. bornovanus a n d T N V - N Z b y O. brassicae. T B S V - C h w a s c o n f i r m e d t o b e n o n -t r a n s m i s s i b l e b y O. bornovanus a n d O. brassicae. 2.2 Purification of virus 2.2.1 CsCl purification C N V a n d T B S V - C h w e r e p u r i f i e d u s i n g i s o p y c n i c c e n t r i f u g a t i o n t h r o u g h C s C l g r a d i e n t s ( R o c h o n et al., 1 9 9 4 ) . F r o z e n v i r u s - i n f e c t e d p l a n t m a t e r i a l w a s h o m o g e n i z e d i n a W a r i n g b l e n d e r u s i n g t w o v o l u m e s o f 1 0 0 m M N a O A c , p H 5.0/5 m M 2-m e r c a p t o e t h a n o l , f i l t e r e d t h r o u g h M i r a c l o t h ( C a l b i o c h e m ) , a n d a l l o w e d t o s t a n d at 4 ° C f o r 1 hr. T h e s u s p e n s i o n w a s c e n t r i f u g e d at 9 0 0 0 x g f o r 15 m i n , a f t e r w h i c h t h e 4 9 s u p e r n a t a n t w a s a d j u s t e d t o 8 % p o l y e t h y l e n e g l y c o l ( P E G ) ( M W = 8 0 0 0 ; S i g m a ) . T h e s u s p e n s i o n w a s s t i r r e d at 4 ° C f o r 1 h r a n d t h e n c e n t r i f u g e d f o r 2 0 m i n at 9 0 0 0 x g. T h e v i r u s p e l l e t w a s r e s u s p e n d e d i n 10 m M N a P 0 4 , p H 7.2, 1 5 0 m M N a C l a n d C s C l ( G i b c o ) w a s a d d e d t o a f i n a l d e n s i t y o f 1.33 g / c m 3 (0.45 g o f C s C l / m l o f f i n a l s o l u t i o n ) . C s C l g r a d i e n t s w e r e c e n t r i f u g e d i n a B e c k m a n T i 8 0 r o t o r at 4 2 0 0 0 r p m f o r 16-24 h r at 2 0 ° C . T h e v i r u s b a n d w a s w i t h d r a w n u s i n g a 18 g a u g e n e e d l e a n d d i a l y z e d a g a i n s t t h r e e c h a n g e s o f 10 m M N a O A c , p H 5.0 at 4 ° C . T h e v i r u s s u s p e n s i o n w a s t h e n c e n t r i f u g e d at 1 4 0 0 0 r p m f o r 15 m i n i n a n E p p e n d o r f b e n c h t o p c e n t r i f u g e f o l l o w e d b y f i l t r a t i o n t h r o u g h a 0.2 p m M i l l i p o r e f i l t e r . V i r u s w a s q u a n t i f i e d s p e c t r o p h o t o m e t r i c a l l y a n d i t s i d e n t i t y a n d c o n c e n t r a t i o n c o n f i r m e d b y a g a r o s e g e l e l e c t r o p h o r e s i s u s i n g 1 % a g a r o s e a n d T B b u f f e r ( 8 8 m M T r i s , 8 8 m M b o r i c a c i d , p H 8.3) f o l l o w e d b y s t a i n i n g w i t h e t h i d i u m b r o m i d e (0.5 p g / m l ) i n T B b u f f e r c o n t a i n i n g 1 m M E D T A ( i n c l u s i o n o f E D T A i n t h e s t a i n w a s f o u n d t o e n h a n c e s t a i n i n g o f R N A w i t h i n p a r t i c l e s ) . A 1 m g / m l s o l u t i o n o f C N V o r T B S V - C h h a s a n A 2 6 0 o f 4.5. 2.2.2 Differential centrifugation M N S V , T N V , a n d C L S V w e r e p u r i f i e d as d e s c r i b e d f o r C N V a n d T B S V a b o v e e x c e p t t h a t t h e P E G p e l l e t w a s s u b j e c t e d t o a l t e r n a t i n g l o w s p e e d / h i g h s p e e d c e n t r i f u g a t i o n f o r v i r u s p u r i f i c a t i o n . F o l l o w i n g P E G p r e c i p i t a t i o n o f v i r u s t h e p e l l e t w a s r e s u s p e n d e d i n 10 m M N a O A c , p H 5.0. T h e v i r u s s u s p e n s i o n w a s t h e n c e n t r i f u g e d at 9 0 0 0 x g f o r 2 0 m i n f o l l o w e d b y c e n t r i f u g a t i o n o f t h e s u p e r n a t a n t i n a B e c k m a n T i 50.2 r o t o r at 4 0 0 0 0 r p m f o r 2.5 hr. T h e v i r u s p e l l e t w a s r e s u s p e n d e d i n 10 m M N a O A c , p H 5.0 a n d t h e n c e n t r i f u g e d at 1 4 0 0 0 r p m f o r 15 m i n i n a n E p p e n d o r f b e n c h t o p c e n t r i f u g e 5 0 f o l l o w e d b y f i l t r a t i o n o f t h e s u p e r n a t a n t t h r o u g h a 0.2 u r n M i l l i p o r e f i l t e r . V i r u s w a s q u a n t i f i e d s p e c t r o p h o t o m e t r i c a l l y a n d i t s i d e n t i t y a n d p u r i t y c o n f i r m e d b y a g a r o s e g e l e l e c t r o p h o r e s i s as d e s c r i b e d f o r C s C l p u r i f i e d C N V a n d T B S V - C h . A 1 m g / m l s o l u t i o n o f M N S V h a s a n A 2 6 o o f 5.0; T N V o f 5.2 a n d C L S V o f 5.63. 2.2.3 Miniprep purification A m i n i p r e p p r o c e d u r e w a s e m p l o y e d t o p a r t i a l l y p u r i f y v i r i o n s f r o m i n f e c t e d l e a v e s . O n e l e a f ( a p p r o x i m a t e l y 2 0 0 m g ) w a s g r o u n d i n l i q u i d n i t r o g e n a n d a d d e d t o 1 m l o f 0.1 M N a O A c , p H 5.0/5 m M 2 - m e r c a p t o e t h a n o l i n a 1.5-ml m i c r o f u g e t u b e . T h e m i x t u r e w a s a l l o w e d t o s i t o n i c e f o r 10 m i n at 4 ° C . P E G ( M W = 8 0 0 0 ; S i g m a ) w a s t h e n a d d e d t o t h e s u p e r n a t a n t t o a f i n a l c o n c e n t r a t i o n o f 8 % a n d t h e s a m p l e s w e r e i n c u b a t e d w i t h g e n t l e s h a k i n g f o r 3 0 m i n at 4 ° C . V i r u s w a s p e l l e t e d b y c e n t r i f u g a t i o n i n a E p p e n d o r f b e n c h t o p c e n t r i f u g e at 1 4 0 0 0 r p m f o r 15 m i n at 4 ° C . P e l l e t s w e r e r e s u s p e n d e d i n 5 0 p i c o l d , s t e r i l e d e i o n i z e d w a t e r o r i n 10 m M N a O A c , p H 5.0. T h e c o n c e n t r a t i o n o f v i r u s w a s e s t i m a t e d b y e l e c t r o p h o r e s i s o f s e v e r a l d i l u t i o n s t h r o u g h a 1 % a g a r o s e g e l b u f f e r e d i n T B ( H e a t o n , 1 9 9 2 ) f o l l o w e d b y s t a i n i n g w i t h e t h i d i u m b r o m i d e ( s e e s e c t i o n 2.2.1). C s C l - p u r i f i e d C N V o r T B S V w a s u s e d as a c o n c e n t r a t i o n s t a n d a r d . 2.3 Maintenance of fungal cultures O. bornovanus ( i s o l a t e S S 1 9 6 ) w a s m a i n t a i n e d o n t h e r o o t s o f c u c u m b e r c v . P o i n s e t t 7 6 a n d O. brassicae ( l e t t u c e i s o l a t e , S S 5 8 ) o n t h e r o o t s o f l e t t u c e c v . W h i t e B o s t o n as d e s c r i b e d b y C a m p b e l l et al. ( 1 9 9 5 ) . W h i t e s a n d ( f l i n t s h o t ) w a s u s e d as t h e m e d i u m f o r a l l s t o c k c u l t u r e s a n d e x p e r i m e n t a l p l a n t s . 51 S e e d s w h i c h d i d n o t h a v e a f u n g i c i d e c o a t i n g w e r e s u r f a c e s t e r i l i z e d . C u c u m b e r s e e d s w e r e i m m e r s e d i n 7 0 % e t h a n o l f o r o n e m i n f o l l o w e d b y 1 5 % c o m m e r c i a l b l e a c h f o r 15 m i n . T h e s e e d s w e r e t h e n w a s h e d i n t h r e e c h a n g e s o f d i s t i l l e d w a t e r a n d t h e n p l a c e d o n s t e r i l e p a p e r t o w e l i n a u t o c l a v e d c l e a r p l a s t i c v e s s e l s t o g e r m i n a t e . A f t e r 7-10 d a y s , c u c u m b e r s e e d l i n g s w e r e t r a n s f e r r e d t o o p a q u e p l a s t i c c u p s ( t w o s e e d l i n g s / c u p ) c o n t a i n i n g s t e r i l e s a n d . S e e d s w i t h a f u n g i c i d e c o a t i n g w e r e r i n s e d s e v e r a l t i m e s i n d i s t i l l e d w a t e r t o r e m o v e t h e f u n g i c i d e f o l l o w e d b y g e r m i n a t i o n as d e s c r i b e d a b o v e . L e t t u c e s e e d s w e r e i m m e r s e d i n 15 % c o m m e r c i a l b l e a c h f o r f i v e m i n a n d t h e n p l a c e d j u s t u n d e r t h e s u r f a c e o f wet, s t e r i l e s a n d t o g e r m i n a t e . Olpidium s t o c k c u l t u r e s w e r e o b t a i n e d i n d r i e d r o o t s f r o m R. N . C a m p b e l l (U.C., D a v i s , C A ) . T o r e c o v e r f u n g a l i n f e c t i v i t y , d r i e d r o o t s w e r e c u t i n t o t w o m m p i e c e s , i m m e r s e d i n s t e r i l e w a t e r a n d a l l o w e d t o h y d r a t e f o r f i v e m i n . O. bornovanus s u s p e n s i o n s w e r e p o u r e d o n t o t h e r o o t s o f c u c u m b e r s e e d l i n g s o r o n t o u n g e r m i n a t e d c u c u m b e r s e e d s . O. bornovanus z o o s p o r e s c o u l d b e o b s e r v e d a f t e r a p p r o x i m a t e l y t h r e e w e e k s . T o m a i n t a i n Olpidium z o o s p o r e c u l t u r e s , z o o s p o r e s u s p e n s i o n s w e r e p o u r e d o n t o 6-10 d a y o l d c u c u m b e r s e e d l i n g s ( p a s s a g i n g o f t h e f u n g u s ) . A f t e r t h r e e t o f i v e w e e k s s u f f i c i e n t z o o s p o r e s w e r e p r e s e n t i n c u c u m b e r r o o t w a s h e s f o r u s e i n t r a n s m i s s i o n / b i n d i n g e x p e r i m e n t s . O. brassicae z o o s p o r e s u s p e n s i o n s w e r e p o u r e d o n t o l e t t u c e s e e d l i n g s o n t h e s u r f a c e o f s t e r i l e s a n d . A p p r o x i m a t e l y s i x w e e k s o f g r o w t h w e r e n e c e s s a r y b e f o r e s u f f i c i e n t n u m b e r s o f O. brassicae z o o s p o r e s c o u l d b e o b s e r v e d i n r o o t w a s h e s f r o m l e t t u c e . O. brassicae z o o s p o r e s w e r e n o r m a l l y p a s s e d o n t o 14 d a y o l d l e t t u c e s e e d l i n g s 5 2 a n d a l l o w e d a f u r t h e r 4-6 w e e k s f o r t h e a c c u m u l a t i o n o f s u f f i c i e n t n u m b e r s o f z o o s p o r e s f o r t r a n s m i s s i o n a n d b i n d i n g e x p e r i m e n t s . Z o o s p o r e s u s p e n s i o n s w e r e p r e p a r e d b y i m m e r s i n g w a s h e d f u n g u s - i n f e c t e d r o o t s i n s t e r i l e d e i o n i z e d w a t e r f o r 15 m i n f o l l o w e d b y f i l t r a t i o n t h r o u g h M i r a c l o t h ( C a l b i o c h e m ) t o r e m o v e r o o t d e b r i s . Z o o s p o r e s w e r e c o u n t e d u s i n g a B r i g h t l i n e h a e m o c y t o m e t e r a n d p h a s e - c o n t r a s t m i c r o s c o p y . 2.4 Production of antibodies 2.4.1 Polyclonal antibody production T o p r o d u c e a n t i b o d i e s w h i c h w e r e r e a c t i v e i n b o t h W e s t e r n B l o t s a n d E L I S A , 1 0 0 | i g o f S D S - P A G E d e n a t u r e d a n d 1 0 0 \ig o f n a t i v e v i r i o n s i n P B S ( f o r 1 l i t e r : 8 g N a C l , 1.44 g N a 2 H P O 4 - 2 H 2 0 , 0.2 g K H 2 P 0 4 , 0.2 g K C 1 , p H 7.4) w e r e m i x e d i n a 1:1 r a t i o w i t h F r e u n d ' s i n c o m p l e t e a d j u v a n t a n d i n j e c t e d s u b c u t a n e o u s l y i n t o f e m a l e N e w Z e a l a n d G i a n t W h i t e r a b b i t s ( U B C A n i m a l C a r e C e n t r e ) . F o l l o w i n g a s t a n d a r d b o o s t i n g s c h e d u l e , n o r m a l l y t w o b o o s t s at 2 1 d a y i n t e r v a l s , t h e r a b b i t w a s e x s a n g u i n a t e d a n d t h e b l o o d a l l o w e d t o c l o t at 3 7 ° C f o r 1 h r f o l l o w e d b y 4 ° C o v e r n i g h t . T h e s e r u m w a s t h e n s e p a r a t e d b y c e n t r i f u g a t i o n at 3 6 0 0 r p m i n a H e r m l e b e n c h t o p c e n t r i f u g e . S o d i u m a z i d e at a c o n c e n t r a t i o n o f 0 . 0 2 % w a s a d d e d b e f o r e s t o r a g e at 4 C . 2.4.2 Monoclonal antibody production M o n o c l o n a l a n t i b o d i e s ( M A b s ) w e r e p r o d u c e d a c c o r d i n g t o H a r l o w a n d L a n e ( 1 9 8 9 ) . C s C l - p u r i f i e d v i r i o n s ( 1 0 0 |0,g i n P B S ) w e r e m i x e d 1:1 w i t h F r e u n d ' s i n c o m p l e t e 5 3 a d j u v a n t a n d i n j e c t e d s u b c u t a n e o u s l y u s i n g a t o t a l v o l u m e o f 2 0 0 | i l / m o u s e . A f t e r f o u r w e e k s , m i c e w e r e b o o s t e d i n t r a p e r i t o n e a l l y w i t h 1 0 0 u g o f v i r i o n s m i x e d 1:1 w i t h F r e u n d ' s i n c o m p l e t e a d j u v a n t u s i n g a t o t a l v o l u m e o f o n e m l p e r m o u s e . E L I S A o n a t a i l b l e e d t h r e e d a y s l a t e r i n d i c a t e d w h e t h e r a s u f f i c i e n t a n t i b o d y r e s p o n s e h a d b e e n m o u n t e d a n d w a s f o l l o w e d i m m e d i a t e l y b y h a r v e s t i n g o f t h e s p l e e n a n d f u s i o n w i t h m y e l o m a c e l l s ( H a r l o w a n d L a n e , 19 8 9 ) . C l o n e s p o s i t i v e f o r a n t i b o d y p r o d u c t i o n w e r e e x p a n d e d a n d p u r i f i e d u s i n g b a t c h c u l t u r e a n d a m m o n i u m s u l f a t e p r e c i p i t a t i o n f o l l o w e d b y d i a l y s i s a g a i n s t P B S . P u r i f i e d M A b s w e r e s t o r e d at 4 ° C i n t h e p r e s e n c e o f 0 . 0 2 % s o d i u m a z i d e . 2.4.3 Purification of IgG and production of alkaline phosphatase conjugate I g G w a s p u r i f i e d u s i n g P r o t e i n G S e p h a r o s e 4 F F ( P h a r m a c i a ) a c c o r d i n g t o t h e m a n u f a c t u r e r ' s i n s t r u c t i o n s . B r i e f l y , 2 0 m M s o d i u m p h o s p h a t e , p H 7.0, a n d 0.1 M g l y c i n e , p H 2.7 w e r e u s e d f o r b i n d i n g a n d e l u t i o n o f I g G , r e s p e c t i v e l y . E a c h o n e m l f r a c t i o n w a s n e u t r a l i z e d w i t h t h e a d d i t i o n o f 5 0 p i o f 1 M T r i s - H C l , p H 9.0. F r a c t i o n s c o n t a i n i n g I g G (as d e t e r m i n e d b y a b s o r b a n c e at 2 8 0 n m ) w e r e c o m b i n e d a n d d i a l y z e d a g a i n s t t h r e e c h a n g e s o f P B S at 4 ° C f o r a t o t a l o f 6 h o u r s f o l l o w e d b y f i l t e r - s t e r i l i z a t i o n a n d s t o r a g e at - 2 0 ° C . I g G c o n c e n t r a t i o n s w e r e q u a n t i f i e d s p e c t r o p h o t o m e t r i c a l l y ( a 1 m g / m l s o l u t i o n o f I g G w i l l g i v e a n a b s o r b a n c e v a l u e o f 1.35 at 2 8 0 n m ) . C o n j u g a t i o n o f I g G t o a l k a l i n e p h o s p h a t a s e ( A L P ) w a s p e r f o r m e d u s i n g B o e h r i n g e r M a n n h e i m A L P ( c a t a l o g # 5 6 7 7 4 4 ) . O n e m l o f 1 m g / m l I g G a n d 1 0 0 JLLI o f 10 m g / m l A L P w e r e p l a c e d t o g e t h e r i n d i a l y s i s t u b i n g a n d l e f t t o d i a l y z e f o r 5 h r at 4 ° C a g a i n s t P B S c o n t a i n i n g 0 . 0 6 % f r e s h l y d i l u t e d E M g r a d e g l u t a r a l d e h y d e . F o l l o w i n g c o n j u g a t i o n , t h e I g G w a s d i a l y z e d a g a i n s t t h r e e c h a n g e s o f P B S ( 5 0 0 m l ) at 4 ° C o v e r a 5 4 p e r i o d o f 9 t o 18 h o u r s . S o d i u m a z i d e at 0 . 0 2 % w a s a d d e d t o t h e I g G - A L P c o n j u g a t e s w h i c h w e r e t h e n d i l u t e d 1:1 w i t h s t e r i l e 1 0 0 % g l y c e r o l a n d s t o r e d at 4 ° C a n d - 2 0 ° C . T h e p r e s e n c e o f g l y c e r o l w a s n e c e s s a r y t o k e e p t h e c o n j u g a t e s f r o m f r e e z i n g at - 2 0 ° C w h i c h w o u l d h a v e i n a c t i v a t e d t h e A L P . 2.5 Enzyme-linked Immunoassay (ELISA) D o u b l e a n t i b o d y s a n d w i c h E L I S A ( D A S - E L I S A ) u s i n g p o l y c l o n a l a n t i s e r a r a i s e d t o C N V , T B S V , C L S V , o r M N S V a n d t h e a p p r o p r i a t e A L P - I g G c o n j u g a t e s p r o d u c e d as d e s c r i b e d a b o v e w a s p e r f o r m e d as d e s c r i b e d b y C l a r k et al. ( 1 9 8 6 ) . B r i e f l y , I g G w a s d i l u t e d i n c o a t i n g b u f f e r ( 5 0 m M s o d i u m c a r b o n a t e b u f f e r , p H 9.6) t o a f i n a l c o n c e n t r a t i o n o f 1 p.g/ml a n d 1 0 0 jxl a l i q u o t s w e r e a d d e d t o t h e w e l l s o f 9 6 w e l l m i c r o t i t e r p l a t e s a n d i n c u b a t e d at 3 7 ° C f o r o n e h o u r . P l a t e s w e r e w a s h e d f o u r t i m e s u s i n g d e i o n i z e d w a t e r . W e l l s w e r e b l o c k e d u s i n g 2 0 0 \\\ o f 2 % s k i m m i l k i n P B S at 3 7 ° C f o r 3 0 m i n . A f t e r r e m o v a l o f t h e b l o c k i n g b u f f e r , 1 0 0 p J o f test s a m p l e s i n 5 0 m M p o t a s s i u m p h o s p h a t e b u f f e r , p H 7.0 w e r e a d d e d t o t h e w e l l s a n d t h e p l a t e s i n c u b a t e d at 3 7 ° C f o r o n e h o u r . A f t e r w a s h i n g t h e p l a t e s as a b o v e , 1 0 0 p i o f t h e a p p r o p r i a t e c o n j u g a t e d i l u t e d 1:250 t o 1:2000 i n 0 . 2 % s k i m m i l k i n P B S w a s a d d e d t o e a c h w e l l a n d i n c u b a t e d at 3 7 ° C f o r o n e h o u r f o l l o w e d b y w a s h i n g . T h e s u b s t r a t e , p - n i t r o p h e n y l p h o s p h a t e ( S i g m a ) , w a s a d d e d at a f i n a l c o n c e n t r a t i o n o f 1 m g / m l i n A P b u f f e r ( 1 0 0 m M N a C l , 5 0 m M M g C l 2 , 1 0 0 m M T r i s - H C l , p H 9.5) at a v o l u m e o f 1 0 0 i x l / w e l l a n d i n c u b a t e d at 3 7 ° C f o r o n e h o u r . A b s o r b a n c e w a s m e a s u r e d at 4 0 5 n m u s i n g a D y n a t e c h M R X p l a t e r e a d e r . 5 5 2.6 Immunoblotting P r o t e i n s w e r e d e n a t u r e d i n 2 X L a e m m l i b u f f e r ( 2 0 % g l y c e r o l , 1 0 % 2-m e r c a p t o e t h a n o l , 0 . 0 5 % b r o m o p h e n o l b l u e , 4 % s o d i u m d o d e c y l s u l p h a t e ( S D S ) , 125 m M T r i s - H C l , p H 6.8) a n d e l e c t r o p h o r e s e d t h r o u g h 1 2 % p o l y a c r y l a m i d e g e l s c o n t a i n i n g S D S at 2 0 0 V f o r 4 5 m i n ( B i o - R a d M i n i P r o t e a n II) e s s e n t i a l l y a c c o r d i n g t o L a e m m l i ( 1 9 7 0 ) . P r o t e i n s t a n d a r d s , n o r m a l l y C s C l p u r i f i e d v i r i o n s i n c o n c e n t r a t i o n s f r o m 1 n g t o 1 0 0 n g , w e r e i n c l u d e d o n b l o t s t o e n a b l e q u a n t i t a t i o n o f v i r u s i n t h e s a m p l e s . P r o t e i n s w e r e t h e n e l e c t r o p h o r e t i c a l l y t r a n s f e r r e d t o I m m o b i l o n P V D F m e m b r a n e s ( M i l l i p o r e ) at 1 0 0 V f o r 9 0 m i n u t e s at 4 ° C i n a s u b m a r i n e a p p a r a t u s ( B i o - R a d ) c o n t a i n i n g W e s t e r n t r a n s f e r b u f f e r ( 2 5 m M T r i s , 1 9 2 m M g l y c i n e , 0 . 0 5 % S D S a n d 2 0 % m e t h a n o l ) . B l o t s w e r e f i r s t b l o c k e d f o r o n e h o u r i n a s o l u t i o n o f 5 % s k i m m i l k p o w d e r i n T B S ( 1 0 m M T r i s - H C l , 1 5 0 m M N a C l , p H 7.4). B l o t s w e r e t h e n w a s h e d t h r e e t i m e s f o r 10 m i n e a c h i n T B S T ( 1 0 m M T r i s - H C l , 1 5 0 m M N a C l , 0 . 0 5 % T w e e n - 2 0 , p H 7.4) a n d i n c u b a t e d w i t h a 1:250 t o 1:2000 d i l u t i o n o f t h e a p p r o p r i a t e a n t i b o d y i n T B S T o v e r n i g h t at 4 ° C . A l l w a s h i n g a n d h y b r i d i z a t i o n s t e p s , u n l e s s n o t e d , w e r e c a r r i e d o u t at r o o m t e m p e r a t u r e w i t h c o n s t a n t a g i t a t i o n . T h e w e s t e r n b l o t w a s t h e n w a s h e d i n T B S T as d e s c r i b e d a b o v e . T h e s e c o n d a r y a n t i b o d y w a s h o r s e r a d i s h p e r o x i d a s e - c o n j u g a t e d A f f i n i P u r e g o a t a n t i - r a b b i t o r a n t i - m o u s e I g G ( J a c k s o n I m m u n o R e s e a r c h ) , w h i c h w a s u s e d at 1:10 0 0 0 d i l u t i o n i n T B S T f o r o n e h o u r . T h e w e s t e r n w a s s u b s e q u e n t l y w a s h e d i n T B S T as a b o v e a n d b o u n d a n t i b o d y v i s u a l i z e d u s i n g t h e E C L W e s t e r n b l o t t i n g s y s t e m ( A m e r s h a m P h a r m a c i a B i o t e c h , Inc.) a n d H y p e r f i l m ™ - E C L ™ ( A m e r s h a m L i f e S c i e n c e s ) . 5 6 2.7 Isolation of transmission-deficient CNV variants C N V w a s m e c h a n i c a l l y p a s s a g e d 13 t i m e s t h r o u g h t h e s y s t e m i c host, Nicotiana clevelandii, b e g i n n i n g w i t h i n f e c t i o u s t r a n s c r i p t s o f t h e w i l d - t y p e C N V c D N A c l o n e p K 2 / M 5 ( h e r e a f t e r r e f e r r e d t o as W T C N V R N A ; R o c h o n a n d J o h n s t o n , 1 9 9 1 ) . I n a d d i t i o n , o u r l a b o r a t o r y c u l t u r e o f C N V ( L c ) , w h i c h h a s b e e n m a i n t a i n e d f o r s e v e r a l y e a r s b y m e c h a n i c a l p a s s a g e , w a s u s e d . I n f e c t e d N. clevelandii l e a v e s f r o m t h e t h i r t e e n t h m e c h a n i c a l p a s s a g e w e r e t h e n u s e d t o i n o c u l a t e t h e l o c a l l e s i o n h o s t , Chenopodium quinoa. I n d i v i d u a l l o c a l l e s i o n s f r o m t h i s h o s t w e r e i s o l a t e d a n d t h e n f u r t h e r " p u r i f i e d " b y a s e c o n d p a s s a g e o n C. quinoa. L o c a l l e s i o n s f r o m t h i s p l a n t w e r e u s e d t o i n o c u l a t e N. clevelandii t o i n c r e a s e t h e a m o u n t o f v i r u s . C r u d e l e a f e x t r a c t s o r p u r i f i e d v i r u s f r o m N. clevelandii w e r e u s e d i n f u n g u s t r a n s m i s s i o n a s s a y s . 2.8 Fungus transmission assay E i t h e r l e a f e x t r a c t s o r p u r i f i e d v i r i o n s w e r e t e s t e d f o r in vitro a c q u i s i t i o n a n d t r a n s m i s s i o n t o c u c u m b e r s e e d l i n g s e s s e n t i a l l y as d e s c r i b e d p r e v i o u s l y ( C a m p b e l l et al., 1991, 1 9 9 5 ; M c L e a n et al., 1 9 9 4 ) . S p e c i f i e d a m o u n t s o f p u r i f i e d v i r u s o r l e a f e x t r a c t s ( s e e v i r u s m i n i p r e p p u r i f i c a t i o n a b o v e ) w e r e a d d e d t o z o o s p o r e s o f t h e S S 1 9 6 s t r a i n o f O. bornovanus ( 1 0 4 z o o s p o r e s / m l i n 5 0 m M g l y c i n e - N a O H , p H 7.6) o r b u f f e r a l o n e t o a f i n a l v o l u m e o f 10 m l . A f t e r a 15 m i n a c q u i s i t i o n p e r i o d , t h i s s u s p e n s i o n w a s p o u r e d i n t o p o t s c o n t a i n i n g 13-16 d a y o l d c u c u m b e r s e e d l i n g s . S i x d a y s l a t e r , i n o c u l a t e d c u c u m b e r r o o t s w e r e a s s a y e d f o r t h e p r e s e n c e o f v i r u s b y D A S - E L I S A u s i n g p o l y c l o n a l a n t i s e r a r a i s e d t o C N V , T B S V , C L S V , M N S V , o r T N V p a r t i c l e s . 5 7 2.9 RT-PCR and cloning of the LL5 coat protein V i r i o n R N A o f L L 5 w a s e x t r a c t e d f r o m p a r t i c l e s u s i n g p h e n o l / c h l o r o f o r m as d e s c r i b e d ( R o c h o n a n d J o h n s t o n , 1 9 9 1 ) . D o u b l e - s t r a n d e d c D N A c o p i e s o f t h e c o a t p r o t e i n c o d i n g r e g i o n o f C N V v a r i a n t s w e r e o b t a i n e d b y u s i n g t h e r e v e r s e t r a n s c r i p t a s e / p o l y m e r a s e c h a i n r e a c t i o n ( R T - P C R ; S a m b r o o k et al., 1 9 8 9 ) . T h e p l u s s e n s e p r i m e r ( C N V o l i g o n. 30; 5' A C G T G A A T T C G T G A C C C C T G A G G C A A 3 ' ) c o r r e s p o n d s t o C N V n u c l e o t i d e s 2 4 4 7 t o 2 4 6 2 a n d l i e s 181 n u c l e o t i d e s u p s t r e a m o f t h e c o a t p r o t e i n O R F ( i t a l s o i n c l u d e s a n o n c o d e d £ c o R l s i t e at i t s 5' t e r m i n u s ) . T h e m i n u s s e n s e p r i m e r ( C N V o l i g o n. 24; 5 ' G G G A G T A A T G G T A C C T C C 3 ' ) c o r r e s p o n d s t o t h e c o m p l e m e n t o f C N V n u c l e o t i d e s 3 9 0 1 t o 3 9 1 8 a n d l i e s 148 n u c l e o t i d e s d o w n s t r e a m o f t h e C P O R F . T h e L L 5 C P R T - P C R p r o d u c t w a s l i g a t e d i n t o p T 7 B l u e ( N o v a g e n ) . D N A f r o m t h i s c l o n e w a s d i g e s t e d w i t h Bsu36l a n d Ncol, w h i c h c u t at u n i q u e s i t e s f l a n k i n g t h e C P O R F . T h e 1.4-kb f r a g m e n t w a s l i g a t e d i n t o s i m i l a r l y d i g e s t e d p K 2 / M 5 ( a f u l l -l e n g t h C N V c D N A c l o n e ; s e e R o c h o n a n d J o h n s t o n , 1 9 9 1 ) t o p r o d u c e p M 5 / L L 5 . T h e s e q u e n c e o f t h e e n t i r e t r a n s f e r r e d r e g i o n o f t h e L L 5 C P g e n e w a s d e t e r m i n e d b y t h e d i d e o x y c h a i n t e r m i n a t i o n p r o c e d u r e ( S a n g e r et al., 1 9 7 7 ) . 2.10 In vitro transcription and inoculation of plants T 7 R N A p o l y m e r a s e r u n - o f f t r a n s c r i p t s a n d i n o c u l a t i o n o f p l a n t s w e r e as d e s c r i b e d p r e v i o u s l y ( R o c h o n a n d J o h n s t o n , 1 9 9 1 ) . 5 8 2.11 In vitro mutagenesis I n v i t r o m u t a g e n e s i s w a s u s e d t o p r o d u c e t h e C N V C P m u t a n t s L L 5 s a n d L L 5 a , w h i c h , r e s p e c t i v e l y , c o n t a i n t h e s i n g l e n u c l e o t i d e s u b s t i t u t i o n s f o u n d i n t h e s h e l l a n d a r m d o m a i n s o f p M 5 / L L 5 . A 1.55-kb s u b c l o n e o f p K 2 / M 5 , w h i c h e n c o m p a s s e s t h e C N V C P a n d f l a n k i n g r e g i o n s , w a s u s e d as a t e m p l a t e f o r o l i g o n u c l e o t i d e - d i r e c t e d in vitro m u t a g e n e s i s as d e s c r i b e d b y K u n k e l et al. ( 1 9 8 7 ) . T h e m u t a g e n i c o l i g o n u c l e o t i d e ( m u t a t i o n s h o w n u n d e r l i n e d ) u s e d t o p r o d u c e L L 5 S was: 5 ' G A T G A T A A G G T C T G G 3 ' ( C N V n u c l e o t i d e s 3 1 4 4 t o 3 1 6 6 ) a n d t h e o n e t o p r o d u c e L L 5 a was: 5 ' C A C C C A C A G G C T T G T C C T G G G G C T A T C 3 ' ( C N V n u c l e o t i d e s 2 8 1 1 t o 2 8 3 7 ) . M u t a n t s w e r e s c r e e n e d b y s e q u e n c i n g a n d t h e p l a s m i d D N A w a s d i g e s t e d w i t h BgWBglQ t o o b t a i n a 6 9 8 - b p f r a g m e n t c o n t a i n i n g t h e m u t a t i o n . T h i s g e l - p u r i f i e d 6 9 8 - b p f r a g m e n t w a s l i g a t e d i n t o t h e s i m i l a r l y d i g e s t e d i n t e r m e d i a t e v e c t o r p C N V C P [a C N V EcoRUKpnl s u b c l o n e i n t h e p h a g e m i d B l u e s c r i p t ( S t r a t a g e n e ) e n c o m p a s s i n g t h e C P O R F ; M c L e a n et al., 1 9 9 4 ] t o f o r m L L 5 s / p C N V C P a n d L L 5 a / p C N V C P . B o t h L L 5 s / p C N V C P a n d L L 5 a / p C N V C P w e r e d i g e s t e d w i t h Bsu36VNcoI as d e s c r i b e d a b o v e a n d l i g a t e d i n t o s i m i l a r l y d i g e s t e d p K 2 / M 5 t o f o r m L L 5 s / M 5 a n d L L 5 a / M 5 . T h e s e q u e n c e b e t w e e n t h e BglVBgUl s i t e s w a s c o n f i r m e d t o e n s u r e t h a t n o o t h e r m u t a t i o n s o c c u r r e d as a r e s u l t o f t h e o l i g o n u c l e o t i d e - d i r e c t e d m u t a g e n e s i s . 2.12 Binding Assays A s t a n d a r d b i n d i n g a s s a y w a s as f o l l o w s . O. bornovanus o r O. brassicae z o o s p o r e s (4 X 1 0 5 t o 1 X 10 6 ) w e r e i n c u b a t e d w i t h C N V , T B S V - C h , M N S V , T N V , o r C L S V ( s e e f i g u r e l e g e n d s f o r a m o u n t s o f v i r u s u s e d ) i n o n e m l 5 0 m M NaPC>4 b u f f e r , p H 5 9 7.6 f o r o n e h o u r . T h e s u s p e n s i o n w a s c e n t r i f u g e d i n a n E p p e n d o r f b e n c h t o p c e n t r i f u g e at 5 0 0 0 r p m f o r s e v e n m i n t o p e l l e t z o o s p o r e s a n d a n y b o u n d v i r u s . I m m e d i a t e l y f o l l o w i n g c e n t r i f u g a t i o n , t h e s u p e r n a t a n t w a s r e m o v e d b y g e n t l e a s p i r a t i o n , t h e p e l l e t w a s h e d i n 1.5 m l o f b u f f e r a n d z o o s p o r e s p e l l e t e d as b e f o r e . T h e z o o s p o r e p e l l e t w a s r e s u s p e n d e d i n 10 (J.1 o f s t e r i l e w a t e r a n d 2.5 p i w a s a s s a y e d f o r t h e p r e s e n c e o f v i r u s u s i n g W e s t e r n b l o t a n a l y s i s a n d v i r u s - s p e c i f i c a n t i s e r a . T h e E C L W e s t e r n b l o t t i n g s y s t e m ( A m e r s h a m P h a r m a c i a B i o t e c h , Inc.) w a s u s e d f o r d e t e c t i o n as d e s c r i b e d a b o v e . T h e q u a n t i t y o f v i r u s r e p r e s e n t e d b y a b a n d w a s d e t e r m i n e d b y d e n s i t o m e t r y u s i n g t h e I m a g e Q u a n t p r o g r a m ( M o l e c u l a r D y n a m i c s ) . F o r C N V d e t e c t i o n a m o n o c l o n a l a n t i b o d y ( 5 7 - 2 ) w a s p r e p a r e d ( s e e a b o v e ) w h i l e r a b b i t p o l y c l o n a l a n t i b o d i e s w e r e u s e d f o r C L S V a n d T N V d e t e c t i o n ( s e e a b o v e ) . T h e p r e p a r a t i o n o f M N S V p o l y c l o n a l a n t i b o d i e s w a s p r e v i o u s l y d e s c r i b e d ( R i v i e r e , 1 9 8 9 ) a n d T B S V - C h a n t i b o d i e s w e r e o b t a i n e d f r o m t h e A g r i c u l t u r e a n d A g r i -F o o d C a n a d a v i r u s a n t i s e r a c o l l e c t i o n . D A S - E L I S A w a s u s e d t o d e t e r m i n e t h e a m o u n t o f T B S V - C h b i n d i n g . 2.13 Introduction of a frameshift mutation into the CLSV CP ORF J R 3 , a f u l l - l e n g t h i n f e c t i o u s C L S V c D N A c l o n e ( D . R o c h o n a n d J. M i l l e r , u n p u b l i s h e d ) w a s d i g e s t e d w i t h Xhol, w h i c h c l e a v e s at C L S V n t p o s i t i o n 2 5 0 8 , 1 3 2 n t 3' t o t h e C L S V C P s t a r t c o d o n . F o l l o w i n g d i g e s t i o n , t h e f o u r b a s e 5' o v e r h a n g w a s f i l l e d i n w i t h K l e n o w ( B R L ) a n d p l a s m i d r e c i r c u l a r i z e d u s i n g l i g a s e . T h e r e s u l t i n g C L S V m u t a n t , J R 3 A X h o , w a s c o n f i r m e d b y r e s t r i c t i o n e n z y m e a n a l y s i s a n d s e q u e n c i n g t o c o n t a i n a f r a m e s h i f t at t h e N - t e r m i n u s o f t h e C P c o d i n g r e g i o n . 6 0 2.14 Analysis of JR3AXho B o t h t h e w i l d - t y p e C L S V i n f e c t i o u s c l o n e J R 3 a n d t h e C P m u t a n t J R 3 A X h o w e r e d i g e s t e d w i t h Smal t o l i n e a r i z e t h e D N A a n d t h e n T 7 R N A p o l y m e r a s e r u n - o f f t r a n s c r i p t s w e r e p r o d u c e d as d e s c r i b e d p r e v i o u s l y b y R o c h o n a n d J o h n s t o n ( 1 9 9 1 ) . T r a n s c r i p t s ( c a . 1-2 p g p e r l e a f ) w e r e r u b - i n o c u l a t e d o n t o t h e l e a v e s o f y o u n g N. benthamiana ( t h r e e l e a f s t a g e ) . R N A e x t r a c t s w e r e o b t a i n e d u s i n g p h e n o l / c h l o r o f o r m as d e s c r i b e d ( R o c h o n a n d J o h n s t o n , 1 9 9 1 ) . 2.15 Lectin labelling of fungal zoospores F I T C - l a b e l l e d l e c t i n s w e r e p u r c h a s e d i n l y o p h i l i z e d f o r m a n d r e s u s p e n d e d at a f i n a l c o n c e n t r a t i o n o f 1 m g / m l i n P B S a c c o r d i n g t o t h e m a n u f a c t u r e r ' s i n s t r u c t i o n s a n d s t o r e d at - 2 0 ° C ( S i g m a ) . Z o o s p o r e s w e r e w a s h e d o n c e ( i n 10 m M s o d i u m p h o s p h a t e b u f f e r , p H 7.3) b y c e n t r i f u g a t i o n f o r 5 m i n at 5 0 0 0 r p m i n a n E p p e n d o r f b e n c h t o p c e n t r i f u g e a n d r e s u s p e n d e d i n 1 m l w a s h b u f f e r t o g i v e a f i n a l z o o s p o r e c o n c e n t r a t i o n o f 2 x 1 0 5 t o 2 x 1 0 6 z o o s p o r e s / m l . F I T C - l e c t i n s w e r e a d d e d t o z o o s p o r e s at t h e m a n u f a c t u r e r s r e c o m m e n d e d c o n c e n t r a t i o n f o r t h e a g g l u t i n a t i o n o f f r e s h h u m a n e r y t h r o c y t e s . T h e z o o s p o r e - l e c t i n s u s p e n s i o n w a s a l l o w e d t o i n c u b a t e i n t h e d a r k f o r 10 m i n f o l l o w e d b y c e n t r i f u g a t i o n a n d r e s u s p e n s i o n o f t h e z o o s p o r e p e l l e t i n 5 0 p i o f 10 m M s o d i u m p h o s p h a t e b u f f e r , p H 7.3. I n s u g a r c o m p e t i t i o n e x p e r i m e n t s , a p p r o p r i a t e s u g a r s at 1 0 0 p g / m l w e r e a d d e d t o F I T C - l e c t i n s f o r 3 0 m i n i n t h e d a r k b e f o r e i n c u b a t i o n w i t h z o o s p o r e s . I m a g e s w e r e o b s e r v e d u s i n g a Z e i s s A x i o P h o t w i t h D I C a n d e p i f l u o r e s c e n c e o p t i c s . Z e i s s f i l t e r set 4 8 7 9 1 0 ( e x c i t a t i o n 4 5 0 t o 4 9 0 n m ) w a s u s e d . 61 3 C H A P T E R T H R E E : I D E N T I F I C A T I O N A N D M O L E C U L A R C H A R A C T E R I Z A T I O N O F N A T U R A L C N V V A R I A N T S W I T H R E D U C E D T R A N S M I S S I B I L I T Y 3.1 Introduction E f f e c t i v e d i s s e m i n a t i o n o f p l a n t v i r u s e s i n n a t u r e o f t e n i n v o l v e s s p e c i f i c i n v e r t e b r a t e o r f u n g a l v e c t o r s . A l t h o u g h a c o n s i d e r a b l e a m o u n t o f i n f o r m a t i o n i s a v a i l a b l e r e g a r d i n g b i o l o g i c a l a s p e c t s o f v e c t o r m e d i a t e d t r a n s m i s s i o n , r e l a t i v e l y l i t t l e i n f o r m a t i o n i s a v a i l a b l e a b o u t v i r u s - v e c t o r i n t e r a c t i o n s at t h e m o l e c u l a r l e v e l . T h e i n v o l v e m e n t o f t h e c o a t p r o t e i n ( C P ) i n t r a n s m i s s i o n i s w e l l e s t a b l i s h e d ( f o r r e v i e w s , s e e C a m p b e l l , 1 9 9 6 ; G r a y , 1 9 9 6 a n d P i r o n e a n d B l a n c , 1 9 9 6 ) . I n p o t y v i r u s e s , a p h i d t r a n s m i s s i b i l i t y r e q u i r e s a s p e c i f i c s e q u e n c e ( D A G ) i n t h e e x p o s e d N - t e r m i n a l r e g i o n o f t h e c a p s i d ( A t r e y a et al, 1990; A t r e y a et al, 1 9 9 1 ; G a l - o n et al, 1 9 9 2 ; A t r e y a et al, 1 9 9 5 ) . A s i m i l a r s e q u e n c e i s a l s o r e q u i r e d f o r a p h i d t r a n s m i s s i o n o f Potato aucuba mosaic virus ( B a u l c o m b e et al, 1 9 9 3 ) . T h e r e a d t h r o u g h p o r t i o n o f t h e C P s o f b y m o v i r u s e s , s o m e f u r o v i r u s e s a n d s e v e r a l l u t e o v i r u s e s h a v e b e e n i m p l i c a t e d i n v e c t o r t r a n s m i s s i o n ( T a m a d a a n d K u s u m e , 19 9 1 ; S h i r a k o a n d B r a k k e , 1984; S h i r a k o a n d W i l s o n , 1993; J o l l y a n d M a y o , 1994; B r a u l t et al, 1995; D e s s e n s a n d M e y e r , 1995; J a c o b i et al, 1995; C h a y et al, 1 9 9 6 ) . I n Beet necrotic yellow vein virus ( B N Y V V ) , a K T E R m o t i f i n t h e C P r e a d t h r o u g h d o m a i n h a s b e e n s h o w n t o b e i m p o r t a n t f o r e f f i c i e n t t r a n s m i s s i o n b y Polymyxae betae ( T a m a d a et al, 1 9 9 6 ) . C e r t a i n v i r u s e s , s u c h as 6 2 p o t y v i r u s e s a n d Cauliflower mosaic virus ( C a M V ) e n c o d e a d d i t i o n a l n o n - v i r i o n a s s o c i a t e d " h e l p e r f a c t o r s " w h i c h a i d i n a p h i d t r a n s m i s s i o n p r o b a b l y b y b r i d g i n g a n i n t e r a c t i o n b e t w e e n t h e v i r i o n a n d s p e c i f i c s i t e s i n t h e f o o d c a n a l ( s e e P i r o n e a n d B l a n c , 1996; G r a y , 1 9 9 6 ) . R e c e n t l y , i t h a s b e e n s u g g e s t e d t h a t t o b r a v i r u s e s m a y a l s o e n c o d e h e l p e r f a c t o r s w h i c h i n f l u e n c e t h e e f f i c i e n c y o f n e m a t o d e t r a n s m i s s i o n ( M a c F a r l a n e a n d B r o w n , 1 9 9 5 ) . Cucumber necrosis virus ( C N V ) i s o n e o f s e v e r a l m e m b e r s o f t h e f a m i l y Tombusviridae k n o w n to b e f u n g a l l y t r a n s m i t t e d ( C a m p b e l l , 1 9 9 6 ) . C N V i s t r a n s m i t t e d t o c u c u m b e r t h r o u g h t h e s o i l v i a z o o s p o r e s o f t h e c h y t r i d f u n g u s Olpidium bornovanus ( D i a s , 1 9 7 0 a ; C a m p b e l l a n d S i m , 1994; C a m p b e l l etal, 1 9 9 5 ) . Z o o s p o r e s a n d v i r u s a r e r e l e a s e d i n d e p e n d e n t l y i n t o t h e s o i l f r o m i n f e c t e d r o o t s . C N V p a r t i c l e s a r e t h e n t h o u g h t t o a d h e r e t o t h e z o o s p o r e p l a s m a l e m m a ( T e m m i n k et al., 1 9 7 0 ) a n d e n t e r p l a n t r o o t s f o l l o w i n g z o o s p o r e e n c y s t m e n t i n r o o t c e l l s ( s e e s e c t i o n s a n d f o r m o r e d e t a i l ) . R e c i p r o c a l e x c h a n g e o f t h e C P g e n e o f C N V a n d t h a t o f a n o n - t r a n s m i s s i b l e t o m b u s v i r u s , t h e c h e r r y s t r a i n o f Tomato bushy stunt virus ( T B S V - C h ) , h a v e d e m o n s t r a t e d t h a t t h e C N V C P c o n t a i n s t h e d e t e r m i n a n t s f o r t h e s p e c i f i c i t y o f f u n g u s t r a n s m i s s i o n ( M c L e a n et al., 1 9 9 4 ) . L o n g t e r m m e c h a n i c a l p a s s a g e o f p l a n t v i r u s e s f r e q u e n t l y r e s u l t s i n t h e l o s s o f v e c t o r t r a n s m i s s i b i l i t y ( s e e C a m p b e l l , 1996; G r a y , 1 9 9 6 ) . W e a r e i n t e r e s t e d i n d e t e r m i n i n g t h e s p e c i f i c a m i n o a c i d s e q u e n c e s o r s t r u c t u r a l f e a t u r e s o f t h e C N V C P i n v o l v e d i n f u n g u s t r a n s m i s s i o n . T o w a r d t h i s e n d , t r a n s m i s s i o n d e f e c t i v e m u t a n t s p r e s e n t i n m e c h a n i c a l l y p a s s a g e d C N V h a v e b e e n c h a r a c t e r i z e d . S e v e r a l C N V v a r i a n t s d e f i c i e n t i n t r a n s m i s s i o n w e r e i d e n t i f i e d . O n e v a r i a n t , L L 5 , w a s a n a l y z e d i n d e t a i l a n d i t 6 3 w a s f o u n d t h a t a s i n g l e G l u t o L y s c h a n g e i n t h e c o a t p r o t e i n s h e l l d o m a i n i s r e s p o n s i b l e f o r t h e r e d u c e d t r a n s m i s s i b i l i t y . F u r t h e r m o r e , in vitro b i n d i n g a s s a y s w e r e d e v e l o p e d a n d i t w a s f o u n d t h a t t h e l o s s o f t r a n s m i s s i b i l i t y i s at l e a s t p a r t i a l l y d u e t o i n e f f i c i e n t z o o s p o r e b i n d i n g . 3.2 Results 3.2.1 Mechanically passaged CNV contains variants deficient in fungus transmission. I n d i v i d u a l l o c a l l e s i o n i s o l a t e s o f C N V ( s e e s e c t i o n 2.7) w e r e a m p l i f i e d i n N. clevelandii a n d i n f e c t e d l e a v e s w e r e u s e d i n a f u n g u s t r a n s m i s s i o n a s s a y . L e a v e s w e r e m a c e r a t e d i n b u f f e r , m i x e d w i t h 10 m l o f O. bornovanus z o o s p o r e s a n d t h e n p o u r e d i n t o s o i l c o n t a i n i n g c u c u m b e r s e e d l i n g s . S i x d a y s l a t e r , i n o c u l a t e d c u c u m b e r r o o t s w e r e a s s a y e d f o r t h e p r e s e n c e o f v i r u s b y b i o a s s a y u s i n g C. quinoa. U s i n g t h i s a s s a y , l e a f e x t r a c t s o f W T C N V i n v a r i a b l y p r o d u c e d o v e r 1 0 0 l o c a l l e s i o n s / l e a f o n C. quinoa f o l l o w i n g t r a n s m i s s i o n . H o w e v e r , s e v e r a l C N V l o c a l l e s i o n i s o l a t e s r e p r o d u c i b l y g a v e f e w e r l o c a l l e s i o n s ( l e s s t h a n 10 p e r l e a f ) a n d t h e r e f o r e t r a n s m i s s i o n o f t h e s e i s o l a t e s a p p e a r e d t o b e l e s s e f f i c i e n t . F o u r o f t h e s e v a r i a n t s w e r e f u r t h e r c h a r a c t e r i z e d b y s y m p t o m f o r m a t i o n , b y e x a m i n i n g l e a f e x t r a c t s f o r t h e p r e s e n c e o f v i r u s p a r t i c l e s a n d f o r t h e a b u n d a n c e a n d s i z e o f v i r a l R N A s p e c i e s . C h a r a c t e r i s t i c s o f t h e s e m u t a n t s a r e s u m m a r i z e d i n T a b l e 3.1. O n e m u t a n t , L L 2 , e x h i b i t e d d e l a y e d s y s t e m i c s y m p t o m s a n d d i d n o t p r o d u c e v i r u s p a r t i c l e s o r c o a t p r o t e i n as d e t e r m i n e d b y e l e c t r o n m i c r o s c o p y a n d w e s t e r n b l o t a n a l y s i s ( n o t s h o w n ) . A g a r o s e g e l e l e c t r o p h o r e s i s o f t o t a l l e a f R N A e x t r a c t s ( n o t s h o w n ) r e v e a l e d a n a p p a r e n t f u l l - l e n g t h g e n o m i c R N A 6 4 s p e c i e s s u g g e s t i n g t h a t t h e l a c k o f c o a t p r o t e i n w a s d u e t o a m i n o r c h a n g e i n t h e c o a t p r o t e i n g e n e . A n o t h e r m u t a n t , L L A 1 6 , a l s o s h o w e d d e l a y e d s y s t e m i c s y m p t o m s a n d c o n t a i n e d a g e n o m i c R N A d e l e t i o n o f a p p r o x i m a t e l y 1.1 k b . A l t h o u g h n o t d i r e c t l y d e t e r m i n e d , t h i s d e l e t i o n i s m o s t l i k e l y i n t h e C P g e n e s i n c e d e l e t i o n s o f t h i s s i z e i n o t h e r p a r t s o f t h e C N V g e n o m e w o u l d p r e c l u d e v i r a l R N A r e p l i c a t i o n o r m o v e m e n t ( R o c h o n a n d J o h n s t o n , 1 9 9 1 ; R u s s o et al., 1 9 9 4 ) . T h e i n a b i l i t y o f t h e s e t w o m u t a n t s t o b e t r a n s m i t t e d i s c o n s i s t e n t w i t h t h e r o l e o f t h e C N V C P i n t r a n s m i s s i o n ( M c L e a n et al., 1 9 9 4 ) . O n e o t h e r m u t a n t , L L A 1 , s h o w e d a t t e n u a t e d s y m p t o m s a n d w a s f o u n d a s s o c i a t e d w i t h d e f e c t i v e i n t e r f e r i n g ( D I ) R N A s a n d a c o r r e s p o n d i n g l o w l e v e l o f v i r a l g e n o m i c R N A ( n o t s h o w n ) . T h e i n e f f i c i e n t t r a n s m i s s i o n o f t h i s m u t a n t w a s t h e r e f o r e l i k e l y d u e t o t h e l o w l e v e l o f v i r u s i n i n f e c t e d l e a v e s . P r o p e r t i e s o f L L 5 w e r e s i m i l a r t o W T C N V e x c e p t f o r t h e r e d u c t i o n i n f u n g u s t r a n s m i s s i o n . A d e t a i l e d d e s c r i p t i o n o f L L 5 t r a n s m i s s i b i l i t y a n d o t h e r p r o p e r t i e s i s p r o v i d e d b e l o w . 6 5 Table 3.1 P h e n o t y p e s o f C N V t r a n s m i s s i o n m u t a n t s . Virus a + Fungus b Symptoms c Particles d Genotype W T C N V > 1 0 0 w i l d t y p e + W i l d t y p e L L 2 0 D e l a y e d - M u t a t e d C P g e n e L L 5 9 S y s t e m i c + M u t a t e d C P g e n e L L A 1 0 A t t e n u a t e d + D I R N A LLA16 0 D e l a y e d N D D e l e t e d C P g e n e Average number of local lesions per leaf in bioassay on Ch. quinoa following fungus transmission. b Symptoms were monitored 4 to 21 dpi. In LL2 and LLA16 symptoms were delayed 7 days beyond the normal 4 days that symptoms appear in WT CNV infection. c Presence of particles were determined by examination of leaf extracts by electron microscopy (see McLean et ai, 1994) and/or by agarose gel electrophoresis following "mini-prep" purification from a single infected leaf (see Materials and Methods). d Western blots of total protein and agarose gel electrophoresis of total RNA were performed using leaf extracts of inoculated plants. For LL2, the absence of coat protein in Western blots indicated no CP was being produced. A defective interfering RNA was found in LLA1 total RNA. LLA16 virion RNA from total RNA contained a deletion which is presumed to have occurred in the CP gene. 3.2.2 A Glu to Lys mutation in the L L 5 coat protein S domain is responsible for reduced fungal transmission. T h e C P g e n e o f L L 5 w a s a m p l i f i e d u s i n g R T - P C R ( s e e F i g u r e 3.1) a n d t h e n c l o n e d i n t o o u r W T C N V c D N A c l o n e i n o r d e r t o a s s e s s i t s r o l e i n t h e r e d u c e d t r a n s m i s s i b i l i t y o f L L 5 . T 7 R N A p o l y m e r a s e r u n - o f f t r a n s c r i p t s o f o n e s u c h c l o n e ( d e s i g n a t e d p M 5 / L L 5 ) w e r e u s e d t o i n o c u l a t e N. clevelandii a n d p u r i f i e d v i r u s o b t a i n e d f r o m i n f e c t e d l e a v e s w a s u s e d i n a f u n g u s t r a n s m i s s i o n a s s a y . C u c u m b e r r o o t s f r o m t h e t r a n s m i s s i o n a s s a y w e r e e x a m i n e d f o r t h e p r e s e n c e o f M 5 / L L 5 v i r u s u s i n g D A S - E L I S A . F i g u r e 3.2 s h o w s tha t l e v e l s o f M 5 / L L 5 v i r u s w e r e s i g n i f i c a n t l y l o w e r t h a n W T v i r u s i n i n o c u l a t e d c u c u m b e r r o o t s . T h i s s u g g e s t s t h a t t h e L L 5 c o a t p r o t e i n c o n t a i n s t h e a l t e r a t i o n s w h i c h r e d u c e f u n g u s t r a n s m i s s i b i l i t y . 6 6 A amber cod on p20 iriiTTiSfaitan l T T - rr I m p33 p92 p41 2P21 CNV genomic RNA B R | a | S P | t nt 2824 i nt 3156 I nt 3674 Phe to Cys Glu to Lys (silent) (LL5.) (LL5S) F i g u r e 3.1 L o c a t i o n o f m u t a t i o n s i n t h e L L 5 C P g e n e . A ) . S t r u c t u r e o f t h e C N V g e n o m e s h o w i n g t h e l o c a t i o n s o f t h e t w o p r i m e r s (1 a n d 2) u s e d t o a m p l i f y t h e L L 5 C P g e n e . B ) S t r u c t u r e o f t h e C N V C P g e n e s h o w i n g t h e R, S a n d P d o m a i n s a n d t h e c o n n e c t i n g a r m (a) a n d h i n g e (h). T h e g e n o m i c l o c a t i o n s o f t h e 3 n u c l e o t i d e s u b s t i t u t i o n s i n L L 5 a r e g i v e n a l o n g w i t h t h e a m i n o a c i d c h a n g e s t h e y c a u s e . T h e M 5 / L L 5 C P g e n e w a s s e q u e n c e d a n d f o u n d t o c o n t a i n t h r e e n u c l e o t i d e s u b s t i t u t i o n s ( s e e F i g u r e 3.1): a T t o G s u b s t i t u t i o n at C N V n u c l e o t i d e 2 8 2 4 c h a n g e d a P h e t o C y s i n t h e a r m (a) r e g i o n , a G t o A s u b s t i t u t i o n at n u c l e o t i d e 3 1 5 6 c h a n g e d a G l u t o L y s ( a m i n o a c i d 177) i n t h e s h e l l ( S ) d o m a i n a n d a G t o T s u b s t i t u t i o n at 3 6 7 4 i n t h e P d o m a i n c o d i n g r e g i o n w a s s i l e n t . T h e r e w e r e n o o t h e r c h a n g e s o u t s i d e o f t h e C P O R F . 6 7 F i g u r e 3.2 S u m m a r y o f f u n g u s t r a n s m i s s i o n a s s a y s . T r a n s m i s s i o n a s s a y s w e r e c o n d u c t e d u s i n g 1 o r 5 u g o f v i r u s p l u s ( + F ) o r m i n u s f u n g u s (-F) o r f u n g u s a l o n e . S i x d a y s a f t e r t r a n s m i s s i o n , r o o t s w e r e g r o u n d a n d a s s a y e d f o r v i r u s u s i n g D A S - E L I S A a n d C N V p o l y c l o n a l a n t i s e r u m . OD405 v a l u e s f o r f u n g u s o n l y c o n t r o l s w e r e s u b t r a c t e d f r o m a l l v a l u e s . A l l v a l u e s w e r e n o r m a l i z e d a g a i n s t W T C N V ( a r b i t r a r i l y a s s i g n e d OD405 o f 1.0) w i t h i n e a c h i n d i v i d u a l e x p e r i m e n t ( w h i c h c o n t a i n e d 1 o r 2 r e p l i c a t e s ) a n d t h e n o r m a l i z e d v a l u e s f r o m 5 s e p a r a t e e x p e r i m e n t s w e r e a v e r a g e d . B a r s r e p r e s e n t s t a n d a r d d e v i a t i o n s f o r e a c h t r e a t m e n t . T h e n u m b e r o f i n f e c t e d p o t s / t o t a l n u m b e r o f p o t s w e r e : W T C N V (10 / 1 0 ) , M 5 / L L 5 (2/10), M 5 / L L 5 s (5/10), a n d M 5 / L L 5 a ( 1 0 / 1 0 ) . S i t e - d i r e c t e d m u t a g e n e s i s w a s u s e d t o i n t r o d u c e t h e L L 5 a r m a n d S d o m a i n m u t a t i o n s i n d i v i d u a l l y i n t o W T C N V c D N A t o a s s e s s t h e p o s s i b l e i n d e p e n d e n t r o l e s o f th e t w o m u t a t i o n s i n t h e L L 5 l o w t r a n s m i s s i b i l i t y p h e n o t y p e . W h e n v i r u s f r o m p l a n t s i n f e c t e d w i t h T 7 R N A p o l y m e r a s e r u n - o f f t r a n s c r i p t s o f t h e s e t w o c l o n e s w e r e t e s t e d f o r t r a n s m i s s i b i l i t y ( F i g u r e 3.2), i t w a s f o u n d t h a t t h e a r m d o m a i n m u t a n t ( d e s i g n a t e d 6 8 M 5 / L L 5 a ) w a s h i g h l y t r a n s m i s s i b l e b u t t h a t t h e s h e l l d o m a i n m u t a n t ( M 5 / L L 5 s ) w a s t r a n s m i s s i b l e at o n l y a v e r y l o w l e v e l ( 0 - 2 0 % o f W T ) . W e c o n c l u d e f r o m t h e s e s t u d i e s t h a t t h e G l u t o L y s s u b s t i t u t i o n i n t h e C N V S d o m a i n i s l a r g e l y r e s p o n s i b l e f o r t h e l o w t r a n s m i s s i o n p h e n o t y p e . 3.2.3 The Glu to Lys substitution in the L L 5 shell domain is directly responsible for the loss of transmissibility. O u r d a t a h a v e s u g g e s t e d t h a t a s p e c i f i c a m i n o a c i d c h a n g e i n t h e L L 5 C P i s r e s p o n s i b l e f o r t h e r e d u c t i o n i n t r a n s m i s s i b i l i t y o f t h i s C N V v a r i a n t . T h i s m u t a t i o n m a y r e d u c e t r a n s m i s s i o n d i r e c t l y b y i n t e r f e r i n g w i t h z o o s p o r e r e c o g n i t i o n o r b i n d i n g . A l t e r n a t i v e l y , t h e m u t a t i o n m a y a f f e c t t r a n s m i s s i o n i n d i r e c t l y b y p r o d u c i n g a v i r u s w h i c h i s e i t h e r l e s s s t a b l e , l e s s c a p a b l e o f i n i t i a t i n g a n i n f e c t i o n o r l e s s c a p a b l e o f a c c u m u l a t i n g i n i n f e c t e d t i s s u e . T h e f o l l o w i n g d e s c r i b e s t h e r e s u l t s o f e x p e r i m e n t s d e s i g n e d t o d i s t i n g u i s h b e t w e e n t h e s e v a r i o u s p o s s i b i l i t i e s . 6 9 r^ <? Jf 4? # F i g u r e 3.3 A g a r o s e g e l e l e c t r o p h o r e s i s o f m u t a n t a n d W T v i r u s . T w o | i g o f C s C l p u r i f i e d v i r u s w a s e l e c t r o p h o r e s e d t h r o u g h a 1 % a g a r o s e g e l b u f f e r e d i n 10 m M T r i s / 7 5 m M g l y c i n e , p H 8.0 at 9 V / c m f o r 1.2 hr. G e l s w e r e s t a i n e d w i t h e t h i d i u m b r o m i d e . M 5 a n d M 5 / L L 5 S p a r t i c l e s c o n t a i n i n t a c t R N A b u t h a v e a l t e r e d e l e c t r o p h o r e t i c m o b i l i t i e s o n a g a r o s e g e l s . E l e c t r o n m i c r o s c o p y w a s u s e d t o v i s u a l i z e a n d c o m p a r e p a r t i c l e s p r o d u c e d i n W T C N V a n d m u t a n t v i r u s i n f e c t i o n s . D i f f e r e n c e s i n m o r p h o l o g y o r s t a i n i n g c h a r a c t e r i s t i c s w e r e n o t a p p a r e n t ( n o t s h o w n ) . P a r t i c l e s w e r e a l s o e x a m i n e d b y a g a r o s e g e l e l e c t r o p h o r e s i s t o a s s e s s p a r t i c l e i n t e g r i t y a n d r e l a t i v e m o b i l i t y . It c a n b e s e e n i n F i g u r e 3.3 t h a t p a r t i c l e p r e p a r a t i o n s o f W T C N V , M 5 / L L 5 , M 5 / L L 5 S a n d M 5 / L L 5 a a r e i n t a c t b u t that M 5 / L L 5 a n d M 5 / L L 5 S m i g r a t e s l i g h t l y s l o w e r t h a n e i t h e r W T o r M 5 / L L 5 a . T h e G l u to L y s s u b s t i t u t i o n i n t h e s h e l l d o m a i n s o f M 5 / L L 5 a n d M 5 / L L 5 s l i k e l y c o n t r i b u t e s t o t h e a l t e r e d m o b i l i t y b y i n c r e a s i n g t h e n e t p o s i t i v e c h a r g e o f t h e p a r t i c l e . I n a d d i t i o n , s i n c e t h i s m u t a t i o n i s i m m e d i a t e l y a d j a c e n t t o a n A s p r e s i d u e i n v o l v e d i n C a + 2 i o n m e d i a t e d 7 0 s u b u n i t c o n t a c t s ( R i v i e r e et al., 1989), t h e m u t a t i o n m a y a l s o l o w e r e l e c t r o p h o r e t i c m o b i l i t y b y p r o d u c i n g a p a r t i c l e w i t h a s w o l l e n c o n f o r m a t i o n ( s e e s e c t i o n 3.3). F i g u r e 3.4 A g a r o s e g e l e l e c t r o p h o r e s i s o f R N A e x t r a c t e d f r o m m u t a n t a n d W T v i r i o n s . V i r i o n s w e r e p u r i f i e d f r o m l e a v e s u s i n g a " m i n i - p r e p " p r o c e d u r e , a n d R N A e x t r a c t e d u s i n g p h e n o l / c h l o r o f o r m . E q u a l c o n c e n t r a t i o n s ( 2 0 0 n g ) o f R N A w e r e e l e c t r o p h o r e s e d t h r o u g h a n o n - d e n a t u r i n g a g a r o s e g e l a n d s t a i n e d w i t h e t h i d i u m b r o m i d e . T h e r e s u l t s o f t w o i n d e p e n d e n t e x p e r i m e n t s a r e s h o w n f o r M 5 / L L 5 s a n d M 5 / L L 5 a . T h e p o s i t i o n o f g e n o m i c R N A i s i n d i c a t e d . T h e a r r o w p o i n t s t o t h e f l u o r e s c e n t m a t e r i a l p r e s e n t i n t h e w e l l s l o a d e d w i t h M 5 / L L 5 a n d M 5 / L L 5 a R N A . V i r u s p a r t i c l e s w i t h a s w o l l e n c o n f o r m a t i o n a r e k n o w n t o b e m o r e s u s c e p t i b l e t o R N A a s e d e g r a d a t i o n ( R o e n h o r s t et al, 1989; H e a t o n , 1992). W e w i s h e d t o d e t e r m i n e i f p a r t i c l e s o f M 5 / L L 5 o r M 5 / L L 5 S c o n t a i n d e g r a d e d R N A s i n c e t h i s w o u l d e x p l a i n t h e l o s s o f f u n g u s t r a n s m i s s i b i l i t y . T h e i n t e g r i t y o f v i r a l R N A e x t r a c t e d f r o m W T a n d m u t a n t p a r t i c l e s w a s e x a m i n e d b y a g a r o s e g e l e l e c t r o p h o r e s i s . F i g u r e 3.4 s h o w s tha t a p p r o x i m a t e l y e q u i v a l e n t a m o u n t s o f l a r g e l y i n t a c t R N A w e r e e x t r a c t e d f r o m W T a n d M 5 / L L 5 S p a r t i c l e s . H o w e v e r , l e s s R N A w a s e x t r a c t e d f r o m M 5 / L L 5 a n d M 5 / L L 5 a 71 p a r t i c l e s . A s w i l l b e d e s c r i b e d b e l o w , M 5 / L L 5 a n d M 5 / L L 5 a a r e as i n f e c t i o u s as W T a n d M 5 / L L 5 s . T h e r e f o r e , t h e a c t u a l a m o u n t o f v i r a l R N A i n p a r t i c l e s s h o u l d b e e q u i v a l e n t . It i s p o s s i b l e t h a t t h e f l u o r e s c i n g m a t e r i a l p r e s e n t i n t h e w e l l s o f l a n e s c o n t a i n i n g M 5 / L L 5 a n d M 5 / L L 5 a R N A ( b u t a b s e n t i n W T a n d M 5 / L L 5 S w e l l s ; F i g u r e 3.4) c o r r e s p o n d s t o v i r i o n R N A w h i c h w a s n o t r e a d i l y r e l e a s e d f r o m v i r a l C P d u r i n g p h e n o l / c h l o r o f o r m e x t r a c t i o n ( s e e s e c t i o n 3.3). M 5 / L L 5 a n d M 5 / L L 5 s p a r t i c l e s a r e s t a b l e a n d as i n f e c t i o u s as W T . M u t a n t a n d W T p a r t i c l e s w e r e a l s o e x a m i n e d f o r t h e i r r e l a t i v e s t a b i l i t i e s a n d i n f e c t i v i t i e s u s i n g b i o a s s a y s a n d s e v e r a l l o c a l l e s i o n h o s t s (Cucumis sativis, Phaseolus vulgaris, Vigna unguiculata, C. amaranticolor a n d C. quinoa). E q u a l p a r t i c l e c o n c e n t r a t i o n s o f e a c h v i r u s p r o d u c e d a p p r o x i m a t e l y e q u a l n u m b e r s o f l o c a l l e s i o n s o v e r a r a n g e o f d i l u t i o n s ( d a t a n o t s h o w n ) i n d i c a t i n g t h a t a l l v i r u s e s w e r e e q u a l l y i n f e c t i o u s . F o r t h e s t a b i l i t y a s s a y , e q u i v a l e n t a m o u n t s o f W T C N V , M 5 / L L 5 , M 5 / L L 5 S a n d M 5 / L L 5 a p a r t i c l e s w e r e i n c u b a t e d f o r 0, 1, 3 o r 18 h r s i n t r a n s m i s s i o n b u f f e r ( 5 0 m M g l y c i n e , p H 7.6) a n d i n f e c t i v i t y a n a l y z e d u s i n g C. quinoa as a l o c a l l e s i o n h o s t . T h e r e w a s n o d e c r e a s e i n t h e n u m b e r o f l o c a l l e s i o n s f o r a n y o f t h e v i r u s p a r t i c l e p r e p a r a t i o n s o v e r t h i s t i m e p e r i o d ( d a t a n o t s h o w n ) , i n d i c a t i n g t h a t t h e r e d u c e d t r a n s m i s s i b i l i t y o f M 5 / L L 5 a n d M 5 / L L 5 s i s n o t d u e t o p a r t i c l e i n s t a b i l i t y . 7 2 / / / / / V ^-Genomic RNA F i g u r e 3.5 A c c u m u l a t i o n o f v i r a l R N A o r v i r u s p a r t i c l e s i n i n f e c t e d l e a v e s . ( A ) R N A a c c u m u l a t i o n . T o t a l R N A w a s e x t r a c t e d f r o m i n o c u l a t e d N. clevelandii l e a v e s i n f e c t e d w i t h W T , M 5 / L L 5 , M 5 / L L 5 s o r M 5 / L L 5 a a n d e q u a l v o l u m e s o f R N A w e r e e l e c t r o p h o r e s e d t h r o u g h a n o n - d e n a t u r i n g 1% a g a r o s e g e l . T h e p o s i t i o n o f g e n o m i c R N A i s i n d i c a t e d . ( B ) V i r u s w a s p u r i f i e d f r o m l e a v e s i n f e c t e d as a b o v e u s i n g a " m i n i - p r e p " p r o c e d u r e . A l i q u o t s o f e a c h v i r u s p r e p a r a t i o n (0.2 a n d 0.5 p i ) w e r e e l e c t r o p h o r e s e d t h r o u g h a 1% a g a r o s e g e l a n d s t a i n e d w i t h e t h i d i u m b r o m i d e . M 5 / L L 5 a n d M 5 / L L 5 S a c c u m u l a t e t o W T l e v e l s i n i n f e c t e d p l a n t s . T h e l e v e l o f a c c u m u l a t i o n o f g e n o m i c R N A i n i n f e c t e d N. clevelandii l e a v e s as c o m p a r e d t o W T R N A w a s d e t e r m i n e d f o r M 5 / L L 5 , M 5 / L L 5 a a n d M 5 / L L 5 S . T o t a l R N A w a s e x t r a c t e d f r o m s i n g l e i n o c u l a t e d l e a v e s a n d t h e l e v e l s o f g e n o m i c R N A a s s e s s e d b y e t h i d i u m b r o m i d e s t a i n i n g o f e q u i v a l e n t v o l u m e s o f t o t a l R N A ( F i g u r e 3.5 A ) . T h e r e w e r e n o m a j o r d i f f e r e n c e s i n t h e l e v e l o f g e n o m i c R N A as c o m p a r e d t o W T i n f e c t i o n s 73 s u g g e s t i n g t h a t e a c h v i r u s a c c u m u l a t e s t o a p p r o x i m a t e l y e q u i v a l e n t l e v e l s d u r i n g i n f e c t i o n . S i m i l a r e x p e r i m e n t s w e r e c o n d u c t e d c o m p a r i n g t h e l e v e l o f v i r i o n s w h i c h c o u l d b e e x t r a c t e d f r o m s i n g l e l e a v e s a n d n o d i f f e r e n c e s i n t h e a m o u n t s o f v i r u s w e r e f o u n d ( F i g u r e 3.5 B ) . T h u s a r e d u c e d a b i l i t y t o a c c u m u l a t e i n i n f e c t e d p l a n t s d o e s n o t a c c o u n t f o r t h e l o w E L I S A v a l u e s o b t a i n e d f o r L L 5 / M 5 a n d L L 5 / M 5 S f o l l o w i n g t r a n s m i s s i o n . 1.2 E a IT) © CU U e at u © c« < > "a* OH 0.8 0.6 0.4 0.2 -0.2 G virus - F 0 virus + F WT CNV TBSV M5/LL5 Virus M5/LL5C M5/LL5., F i g u r e 3.6 S u m m a r y o f in vitro b i n d i n g a s s a y s . B i n d i n g a s s a y s w e r e c o n d u c t e d u s i n g v i r u s p l u s ( + F ) o r m i n u s f u n g u s (-F). T h e z o o s p o r e p e l l e t w a s r e s u s p e n d e d i n b u f f e r a n d t h e a m o u n t o f v i r u s p r e s e n t d e t e r m i n e d b y D A S - E L I S A u s i n g e i t h e r a C N V o r T B S V - C h p o l y c l o n a l a n t i s e r a . A l l v a l u e s w e r e n o r m a l i z e d a g a i n s t W T C N V (OD405 o f 1.0) w i t h i n e a c h i n d i v i d u a l e x p e r i m e n t a n d t h e n o r m a l i z e d v a l u e s w e r e a v e r a g e d a c r o s s e x p e r i m e n t s . B u f f e r c o n t r o l s w e r e s u b t r a c t e d f r o m v i r u s o n l y s a m p l e s w h i l e f u n g u s o n l y c o n t r o l s w e r e s u b t r a c t e d f r o m t h e v i r u s p l u s f u n g u s s a m p l e s . W T C N V c o r r e s p o n d s t o s e v e n i n d e p e n d e n t e x p e r i m e n t s , T B S V t o f i v e e x p e r i m e n t s a n d M 5 / L L 5 , M 5 / L L 5 s a n d M 5 / L L 5 a t o t w o e x p e r i m e n t s . A l l e x p e r i m e n t s c o n t a i n e d at l e a s t t w o r e p l i c a t e s . 7 4 3.2.4 M5/LL5 and M5/LL5s particles bind zoospores less efficiently than WT virus. W e d e v e l o p e d a p r e l i m i n a r y b i n d i n g a s s a y t o a s s e s s i f t h e r e d u c e d a b i l i t y o f M 5 / L L 5 a n d M 5 / L L 5 s p a r t i c l e s t o b e t r a n s m i t t e d b y O. bornovanus z o o s p o r e s i s d u e t o t h e i n a b i l i t y o f v i r u s t o b i n d z o o s p o r e s o r i n s t e a d t o a d e f e c t i n a n o t h e r s t a g e o f t h e t r a n s m i s s i o n p r o c e s s . T o i n i t i a l l y v a l i d a t e t h e s e s t u d i e s , w e d e t e r m i n e d i f p a r t i c l e s o f C N V a n d t h e n o n - t r a n s m i s s i b l e T B S V - C h b i n d O. bornovanus z o o s p o r e s d i f f e r e n t i a l l y . O n e h u n d r e d p g o f W T C N V o r T B S V - C h p a r t i c l e s w e r e i n c u b a t e d f o r 15 m i n ( t h e a c q u i s i t i o n p e r i o d u s e d i n o u r t r a n s m i s s i o n a s s a y s ) w i t h o r w i t h o u t z o o s p o r e s (1 X 1 0 6 p e r m l ) i n 10 m l o f a c q u i s i t i o n b u f f e r . F o l l o w i n g i n c u b a t i o n , z o o s p o r e s w e r e c e n t r i f u g e d a n d w a s h e d t w o t i m e s a n d a n y p e l l e t e d m a t e r i a l w a s t h e n e x a m i n e d f o r t h e p r e s e n c e a n d l e v e l o f v i r u s u s i n g D A S - E L I S A a n d e i t h e r a C N V o r T B S V p o l y c l o n a l a n t i b o d y . U s i n g t h i s a s s a y , i t w a s d e t e r m i n e d t h a t a p p r o x i m a t e l y 15 n g o f C N V p a r t i c l e s i s a s s o c i a t e d w i t h t h e z o o s p o r e p e l l e t ( T a b l e 3.2) a n d t h a t l i t t l e o r n o C N V c o u l d b e d e t e c t e d w h e n z o o s p o r e s w e r e o m i t t e d f r o m t h e a s s a y . F u r t h e r m o r e , T B S V - C h p a r t i c l e s w e r e o n l y d e t e c t e d at o r n e a r b a c k g r o u n d l e v e l s . T h e s e e x p e r i m e n t s s u g g e s t t h a t C N V s p e c i f i c a l l y a s s o c i a t e s w i t h z o o s p o r e s a n d th a t t h e l a c k o f t r a n s m i s s i b i l i t y o f T B S V - C h m a y b e d u e t o th e i n a b i l i t y o f T B S V - C h p a r t i c l e s t o r e c o g n i z e o r b i n d z o o s p o r e s . S i m i l a r b i n d i n g e x p e r i m e n t s w e r e t h e n c o n d u c t e d u s i n g p u r i f i e d p r e p a r a t i o n s o f M 5 / L L 5 , M 5 / L L 5 s o r M 5 / L L 5 a p a r t i c l e s . T h e r e s u l t s o f s e v e r a l r e p e t i t i o n s o f t h e s e b i n d i n g a s s a y s a r e s u m m a r i z e d i n F i g u r e 3.6. It c a n b e s e e n t h a t M 5 / L L 5 a n d M 5 / L L 5 s p a r t i c l e s a r e p r e s e n t i n t h e z o o s p o r e p e l l e t at o n l y a p p r o x i m a t e l y 2 0 - 6 0 % t h e l e v e l o f W T v i r u s , w h e r e a s M 5 / L L 5 a b o u n d at 7 5 - 1 1 0 % t h e e f f i c i e n c y o f C N V . T h e s e r e s u l t s s u g g e s t t h a t t h e 7 5 i n e f f i c i e n t t r a n s m i s s i o n s o f M 5 / L L 5 a n d M 5 / L L 5 s a r e at l e a s t p a r t l y d u e t o t h e i r i n a b i l i t y t o r e c o g n i z e o r s t a b l y b i n d z o o s p o r e s . Table 3.2 B i n d i n g o f C N V t o O. bornovanus z o o s p o r e s in vitro. +Fungus -Fungus Virus DAS-ELISA 3 b ng v i r u s DAS-ELISA ng virus CNV a) 0.978 b) 0.451 15 15 a) 0.055 b) 0.011 <1 <1 TBSV-Ch a) 0.118 b) 0.025 3 2 a) 0.084 b) 0.000 2 <1 no virus a) 0.050 b ) 0.012 <1 <1 a) 0.055 b) 0.019 <1 <1 Values correspond to absorbance at 405 nm. The values in (a) and (b) correspond to the average values obtained from two separate experiments. Experiment (a) contained two replicates and experiment (b) three replicates. b Determined by comparing the DAS-ELISA value of the virus in the zoospore pellet to that of a dilution standard of C N V or TBSV-Ch. 3.3 Discussion R e p e a t e d m e c h a n i c a l p a s s a g e o f p l a n t v i r u s e s f r e q u e n t l y r e s u l t s i n t h e l o s s o f v e c t o r t r a n s m i s s i b i l i t y . I n s o m e c a s e s , t h e l o s s o f t r a n s m i s s i b i l i t y i s a s s o c i a t e d w i t h d e l e t i o n s i n g e n o m i c R N A , p r e s u m a b l y i n t h e g e n e s s p e c i f y i n g t r a n s m i s s i o n ( s e e C a m p b e l l , 1 9 9 6 ; G r a y , 1 9 9 6 ) . T h i s s t u d y d e m o n s t r a t e s t h a t m e c h a n i c a l l y p a s s a g e d C N V c o n t a i n s v a r i a n t s w h i c h h a v e l o s t t h e a b i l i t y t o b e t r a n s m i t t e d b y O. bornovanus. A c o m p r e h e n s i v e a n a l y s i s o f t h e l e v e l o f s u c h m u t a n t s w a s n o t u n d e r t a k e n , b u t f o u r o f 4 0 l o c a l l e s i o n s w e r e a n a l y z e d . T w o o f t h e f o u r v a r i a n t s ( L L A 1 6 a n d L L 2 ; T a b l e 3.1) d i d n o t p r o d u c e v i r a l C P e i t h e r b e c a u s e t h e C P g e n e w a s d e l e t e d o r b e c a u s e t h e C P w a s n o t e x p r e s s e d . A n o t h e r v a r i a n t ( L L A 1 ) c o n t a i n e d D I R N A s w i t h a c o r r e s p o n d i n g d e c r e a s e d 7 6 l e v e l o f g e n o m i c R N A a n d t h u s t h e l e a f e x t r a c t u s e d as i n o c u l u m w a s l i k e l y d e f i c i e n t i n v i r u s p a r t i c l e s . A l t e r n a t i v e l y , i t i s p o s s i b l e t h a t L L A 1 t r a n s m i t s w e l l b u t t h a t D I R N A i n t e r f e r e d w i t h v i r u s a c c u m u l a t i o n i n r o o t s . H o w e v e r , p r e v i o u s s t u d i e s h a v e s h o w n t h a t D I R N A s a r e p a c k a g e d i n e f f i c i e n t l y , i f at a l l , i n C N V c a p s i d s ( R o c h o n et ah, 1 9 9 4 ) . I s o l a t e s f r o m s e v e r a l o t h e r l o c a l l e s i o n s w e r e a l s o p o o r l y t r a n s m i t t e d . M o s t o f t h e s e m u t a n t s a p p e a r e d t o b e e i t h e r C P d e l e t i o n m u t a n t s o r c o n t a i n e d D I R N A s . I n d i v i d u a l C N V d e l e t i o n m u t a n t s l a c k i n g t h e C P g e n e d o n o t b e c o m e d o m i n a n t i n m e c h a n i c a l l y p a s s a g e d i n o c u l u m ( d a t a n o t s h o w n ) , d e s p i t e t h e f a c t t h a t t h e C N V C P i s n o t r e q u i r e d f o r v i r u s a c c u m u l a t i o n o r s p r e a d ( M c L e a n et al., 1993, S i t et al., 1 9 9 5 ) . T h e p r e s e n c e o f t h e C P g e n e m u s t t h e r e f o r e p r o v i d e s o m e s e l e c t i v e a d v a n t a g e o v e r i t s a b s e n c e . T h e c u r r e n t s t u d y e m p h a s i z e s th a t t r a n s m i s s i b i l i t y c a n b e a f f e c t e d b y s e v e r a l d i f f e r e n t g e n e t i c t r a i t s , i n c l u d i n g l o s s o f t h e c o a t p r o t e i n g e n e ( L L A 1 6 ) o r i t s p r o d u c t ( L L 2 ) , a n a l t e r a t i o n i n c a p s i d s e q u e n c e o r s t r u c t u r e ( L L 5 ) o r r e d u c e d a b i l i t y t o r e p l i c a t e o r a c c u m u l a t e ( L L A 1 ) . I n t h i s s t u d y , w e w i s h e d t o f o c u s o n m u t a t i o n s w h i c h d i r e c t l y a f f e c t t h e a b i l i t y o f C N V t o b e t r a n s m i t t e d , s u c h as t h o s e t h a t a f f e c t b i n d i n g t o t h e v e c t o r . W e h a v e d e m o n s t r a t e d t h a t t h e G l u t o L y s s u b s t i t u t i o n i n t h e L L 5 C P g e n e i s l a r g e l y r e s p o n s i b l e f o r t h e r e d u c t i o n i n f u n g u s t r a n s m i s s i b i l i t y o f t h i s C N V v a r i a n t . M 5 / L L 5 s p a r t i c l e s a r e s t a b l e , h i g h l y i n f e c t i o u s a n d a c c u m u l a t e t o W T l e v e l s i n m e c h a n i c a l l y i n o c u l a t e d p l a n t s . I n a d d i t i o n , M 5 / L L 5 s v i r i o n R N A i s i n t a c t a n d g e n o m i c R N A a c c u m u l a t e s t o W T l e v e l s ( F i g u r e s 3.3-3.5). T h u s t h e G l u t o L y s m u t a t i o n i n t h e C N V C P s h e l l d o m a i n a p p e a r s t o d i r e c t l y a f f e c t t r a n s m i s s i b i l i t y r a t h e r t h a n m e r e l y i n d i r e c t l y a f f e c t i n g t r a n s m i s s i o n t h r o u g h a n e f f e c t o n s o m e o t h e r a s p e c t o f v i r u s i n f e c t i o n . In vitro " b i n d i n g " a s s a y s f u r t h e r s u p p o r t t h e n o t i o n t h a t t h e G l u t o L y s m u t a t i o n d i r e c t l y 7 7 a f f e c t s t r a n s m i s s i o n . V i r a l p a r t i c l e s c o n t a i n i n g t h i s m u t a t i o n b i n d O. bornovanus z o o s p o r e s l e s s e f f i c i e n t l y ( F i g u r e 3.6) s u g g e s t i n g t h a t t h e d e c r e a s e d t r a n s m i s s i b i l i t y i s d u e t o a d e c r e a s e i n t h e a b i l i t y o f v i r a l c a p s i d s t o r e c o g n i z e o r s t a b l y b i n d z o o s p o r e s ( s e e b e l o w ) . T h e b i n d i n g a s s a y s ( F i g u r e 3.6) i n d i c a t e t h a t M 5 / L L 5 a n d M 5 / L L 5 s b i n d at a p p r o x i m a t e l y 2 0 - 6 0 % t h e e f f i c i e n c y o f W T p a r t i c l e s . T h e s e v a l u e s a r e s l i g h t l y h i g h e r t h a n t h o s e o b t a i n e d u s i n g t h e f u n g u s t r a n s m i s s i o n a s s a y ( 0 - 2 0 % ; s e e F i g u r e 3.2). T h i s r e s u l t m a y s u g g e s t t h a t f a c t o r s o t h e r t h a n b i n d i n g c o n t r i b u t e t o t h e l o w t r a n s m i s s i o n p h e n o t y p e . A l t h o u g h a s i n g l e a m i n o a c i d c h a n g e i n t h e C N V C P h a s b e e n i d e n t i f i e d w h i c h a f f e c t s t r a n s m i s s i o n , o t h e r c h a n g e s e l s e w h e r e i n t h e C P w o u l d a l s o b e e x p e c t e d t o h a v e a n a f f e c t . T h e G l u t o L y s c h a n g e i n L L 5 o c c u r s i n t h e " E F " l o o p o f t h e v i r a l c a p s i d s h e l l d o m a i n . T h i s l o o p i s i n v o l v e d i n s u b u n i t i n t e r a c t i o n s a n d i s a l s o p a r t i a l l y e x p o s e d o n t h e s u r f a c e o f t h e s h e l l ( H a r r i s o n , 1 9 8 3 ) . E x p o s e d r e g i o n s o f t h e p o t y v i r u s c a p s i d a n d l u t e o v i r u s c a p s i d h a v e p r e v i o u s l y b e e n s h o w n t o b e i n v o l v e d i n t r a n s m i s s i o n ( s e e P i r o n e a n d B l a n c , 1996; G r a y , 1 9 9 6 ) . L L 5 a n d M 5 / L L 5 p a r t i c l e s m i g r a t e s l i g h t l y s l o w e r t h a n W T p a r t i c l e s i n a g a r o s e g e l s ( F i g u r e 3.3). T h e G l u t o L y s s u b s t i t u t i o n w o u l d i n c r e a s e t h e n e t p o s i t i v e c h a r g e o f t h e p a r t i c l e a n d t h e r e f o r e s l o w i t s m i g r a t i o n . I n t e r s u b u n i t c o n t a c t s i n m a n y s m a l l s p h e r i c a l p l a n t v i r u s e s a r e s t a b i l i z e d b y C a + 2 i o n s ( H a r r i s o n , 1983; H e a t o n a n d M o r r i s , 1 9 9 2 ) . W h e n t h e s e i o n s a r e s e q u e s t e r e d w i t h E D T A t h e p a r t i c l e t a k e s o n a s w o l l e n c o n f o r m a t i o n a n d t h i s r e s u l t s i n l o w e r e d e l e c t r o p h o r e t i c m o b i l i t y i n a g a r o s e g e l s ( H e a t o n , 1 9 9 2 ) . T h e G l u t o L y s s u b s t i t u t i o n i n L L 5 o c c u r s i m m e d i a t e l y a d j a c e n t t o a n A s p r e s i d u e w h i c h i s i n v o l v e d i n C a + 2 i o n m e d i a t e d s u b u n i t c o n t a c t s . T h u s , i t i s p o s s i b l e t h a t t h e 7 8 l o w e r e d m o b i l i t i e s o f L L 5 a n d M 5 / L L 5 s m i g h t b e p a r t i a l l y a t t r i b u t e d t o t h e i r m o r e s w o l l e n states. W e s h o w t h a t M 5 / L L 5 s v i r i o n R N A i s l a r g e l y i n t a c t a n d p r e s e n t at n o r m a l W T l e v e l s a n d t h e r e f o r e t h e r e d u c e d t r a n s m i s s i b i l i t y o f t h e s e p a r t i c l e s i s n o t d u e t o d e g r a d a t i o n o r l o s s o f t h e i n f e c t i o u s c o m p o n e n t . I n t e r e s t i n g l y , t h e y i e l d o f M 5 / L L 5 a n d M 5 / L L 5 a v i r i o n R N A i s s i g n i f i c a n t l y l o w e r t h a n t h a t o f W T o r M 5 / L L 5 S ( F i g u r e 3.4). F i g u r e 3.4 s h o w s t h a t a l a r g e a m o u n t o f f l u o r e s c i n g m a t e r i a l i s p r e s e n t i n t h e w e l l s o f l a n e s c o n t a i n i n g M 5 / L L 5 a R N A ( a n d t o a l e s s e r e x t e n t M 5 / L L 5 ) . It i s p o s s i b l e t h a t t h e m a t e r i a l i n t h e w e l l s c o r r e s p o n d s t o v i r a l C P / R N A a g g r e g a t e s . I f so, t h e L L 5 a r m m u t a t i o n ( P h e t o C y s ) i s l i k e l y r e s p o n s i b l e f o r t h i s u n u s u a l p h e n o m e n o n . W e h a v e d e v e l o p e d a p r e l i m i n a r y in vitro b i n d i n g a s s a y t o a s s e s s t h e r o l e o f b i n d i n g i n t h e s p e c i f i c i t y o f C N V t r a n s m i s s i o n a n d t o f u r t h e r a s s e s s t h e d i r e c t r o l e o f v i r a l C P i n f u n g u s t r a n s m i s s i o n . O u r a s s a y s ( T a b l e 3.2 a n d F i g u r e 3.6) s h o w t h a t b i n d i n g i s s p e c i f i c (i.e., C N V b i n d s b u t t h e n o n - t r a n s m i s s i b l e T B S V - C h b i n d s at o n l y a v e r y l o w l e v e l ) a n d t h a t M 5 / L L 5 a n d M 5 / L L 5 S p a r t i c l e s b i n d l e s s e f f i c i e n t l y t h a n W T C N V . T h e s e d a t a s u g g e s t t h a t t h e s p e c i f i c i t y o f t r a n s m i s s i o n l i e s at t h e l e v e l o f O. bornovanus z o o s p o r e r e c o g n i t i o n o r b i n d i n g . S i m i l a r o b s e r v a t i o n s a n d c o n c l u s i o n s w e r e p r e v i o u s l y m a d e b y T e m m i n k et al. ( 1 9 7 0 ) f o r t o b a c c o n e c r o s i s v i r u s a n d i t s v e c t o r O. brassicae a n d a l s o f o r C N V a n d O. bornovanus u s i n g e l e c t r o n m i c r o s c o p y o f v i r u s / z o o s p o r e i n t e r a c t i o n s . T h e s e b i n d i n g d a t a r a i s e t h e i n t r i g u i n g p o s s i b i l i t y t h a t t h e i n t e r a c t i o n b e t w e e n p a r t i c l e s a n d z o o s p o r e s i s m e d i a t e d b y a s p e c i f i c r e c e p t o r o n t h e z o o s p o r e p l a s m a l e m m a , p e r h a p s s i m i l a r i n s o m e r e s p e c t s t o v i r u s / r e c e p t o r i n t e r a c t i o n s i n a n i m a l s y s t e m s 7 9 ( H a y w o o d , 1 9 9 4 ) . T h e p o s s i b l e i n v o l v e m e n t o f s p e c i f i c r e c e p t o r s i n p l a n t v i r u s t r a n s m i s s i o n h a s b e e n p r e v i o u s l y s u g g e s t e d f o r Barley yellow dwarf luteovirus ( G i l d o w , 1 9 9 3 ) a n d Tomato spotted wilt tosposvirus ( B a n d l a et al., 1 9 9 8 ) . I n a d d i t i o n , i t h a s b e e n s u g g e s t e d t h a t d i f f e r e n c e s i n s u r f a c e c h a r g e o f v e c t o r a n d n o n - v e c t o r i s o l a t e s o f O. brassicae m a y b e r e s p o n s i b l e f o r t h e d i f f e r e n t i a l t r a n s m i s s i o n o f T N V p e r h a p s b y i n f l u e n c i n g b i n d i n g b e t w e e n z o o s p o r e s a n d v i r u s ( M o w a t , 1 9 6 8 ) . It i s p o s s i b l e t h a t t h e G l u t o L y s a l t e r a t i o n i n t h e L L 5 C P s h e l l d o m a i n a f f e c t s t h e a b i l i t y o f v i r u s t o i n t e r a c t s t a b l y w i t h a p u t a t i v e r e c e p t o r p e r h a p s b y a l t e r i n g s p e c i f i c i o n i c i n t e r a c t i o n s w i t h a c o m p o n e n t o f t h e z o o s p o r e m e m b r a n e . A l t e r n a t i v e l y , o r a d d i t i o n a l l y , a c o n f o r m a t i o n a l c h a n g e i n t h e v i r u s p a r t i c l e , w h i c h i s a r e s u l t o f a l t e r e d s u b u n i t i n t e r a c t i o n s , m a y p r e c l u d e e f f i c i e n t v i r u s b i n d i n g . 8 0 4 C H A P T E R F O U R : C O M P A R A T I V E S E Q U E N C E A N A L Y S I S O F T H E C O A T P R O T E I N S O F F O U R OLPIDIUM BORNOVANUS T R A N S M I T T E D V I R U S E S 4.1 Introduction O n e o b j e c t i v e o f m y t h e s i s i s t o d e t e r m i n e r e g i o n s o f t h e Cucumber necrosis virus ( C N V ) c a p s i d w h i c h are i n v o l v e d i n a t t a c h m e n t t o O. bornovanus z o o s p o r e s . I n C h a p t e r 3, n a t u r a l l y o c c u r r i n g C N V m u t a n t s d e f i c i e n t i n t r a n s m i s s i o n w e r e e x a m i n e d w i t h t h e a i m o f i d e n t i f y i n g s p e c i f i c c o a t p r o t e i n ( C P ) a m i n o a c i d s r e q u i r e d f o r t r a n s m i s s i o n . I n t h i s c h a p t e r , a n a d d i t i o n a l a p p r o a c h h a s b e e n t a k e n , n a m e l y c o m p a r a t i v e s e q u e n c e a n a l y s i s o f t h e C P s o f t r a n s m i s s i b l e a n d n o n - t r a n s m i s s i b l e m e m b e r s o f t h e Tombusviridae. A t t h e t i m e t h i s p a r t o f m y t h e s i s w o r k w a s i n i t i a t e d t h e C P s e q u e n c e s o f t w o o t h e r O. bornovanus t r a n s m i t t e d v i r u s e s w e r e k n o w n , i.e. t h o s e o f Melon necrotic spot carmovirus ( M N S V ) ( f a m i l y Tombusviridae; R i v i e r e et al., 1 9 8 9 ) a n d Red clover necrotic mosaic dianthovirus ( R C N M V ) ( f a m i l y Tombusviridae; X i o n g a n d L o m m e l , 19 8 9 ) . I n a d d i t i o n , t h e C P s e q u e n c e s o f Tobacco necrosis necrovirus ( T N V ) ( " s t r a i n s " A a n d D; f a m i l y Tombusviridae) w e r e a l s o k n o w n ( M e u l e w a e t e r et al., 1 9 8 9 ) . T h e C P s e q u e n c e s o f s e v e r a l o t h e r a p p a r e n t l y n o n - t r a n s m i s s i b l e m e m b e r s o f t h e Tombusviridae w e r e a l s o k n o w n ( s e e T a b l e 4.1). I n t e r e s t i n g l y , c o m p a r i s o n s o f t h e C N V a n d M N S V C P s s h o w e d t h a t t h e i r a m i n o a c i d s e q u e n c e s a r e m o r e s i m i l a r t o e a c h o t h e r t h a n t h e y a r e t o t h e 81 r e s p e c t i v e m e m b e r s o f t h e i r o w n g e n u s ( R i v i e r e et al, 1 9 8 9 ) . M o r e o v e r , C N V a n d M N S V w e r e s h o w n t o s h a r e a r e g i o n o f a m i n o a c i d s e q u e n c e s i m i l a r i t y i n a s h o r t r e g i o n o f t h e o t h e r w i s e n o n - c o n s e r v e d p r o t r u d i n g ( P ) - d o m a i n s . T h i s l e d t o t h e s u g g e s t i o n t h a t t h e s e q u e n c e s i m i l a r i t i e s o b s e r v e d b e t w e e n t h e s e v i r u s e s m a y b e d u e t o t h e c o n s e r v a t i o n o f s e q u e n c e s r e q u i r e d f o r t r a n s m i s s i o n b y O. bornovanus ( R i v i e r e a n d R o c h o n , 1 9 8 9 ) . T o f u r t h e r a s s e s s t h i s h y p o t h e s i s , t h e C P s e q u e n c e o f a n o t h e r O. bornovanus t r a n s m i t t e d v i r u s , Cucumber leaf spot virus ( C L S V ) ( C a m p b e l l et ah, 1 9 9 1 ) w a s d e t e r m i n e d ( M i l l e r et al, 1 9 9 7 ) . T h i s c h a p t e r d e s c r i b e s t h e r e s u l t s o f c o m p a r a t i v e s e q u e n c e a n a l y s i s o f C P s o f C N V , M N S V , C L S V , R C N M V a n d s e v e r a l o t h e r r e l a t e d b u t n o n - t r a n s m i s s i b l e v i r u s e s . T h e d a t a s h o w t h a t t h e C P s o f t h e s e f o u r v i r u s e s a r e m o r e e v o l u t i o n a r i l y c l o s e l y r e l a t e d t o e a c h o t h e r t h a n t h e y a r e t o a n y o f t h e o t h e r v i r u s C P s c o m p a r e d . M o s t p l a n t v i r u s e s r e q u i r e a C P f o r e f f i c i e n t l o n g d i s t a n c e m o v e m e n t ( C a r r i n g t o n et al, 1 9 9 6 ) . H o w e v e r , c e r t a i n v i r u s e s , s u c h as t h e t o m b u s v i r u s e s ( M c L e a n et al, 1993; S c h o l t o f et al, 1993; D a l m a y et al, 1 9 9 2 ) , c a n m o v e ( a l t h o u g h l e s s e f f i c i e n t l y ) w i t h o u t a C P . A n i n v e s t i g a t i o n i n t o t h e r o l e o f t h e C L S V C P g e n e i n v i r u s m o v e m e n t w a s a l s o c o n d u c t e d as p a r t o f a l a r g e r g o a l o f a s s e s s i n g t h e r o l e o f t h e C P i n a s p e c t s o f t h e C L S V m u l t i p l i c a t i o n c y c l e . T h e s e r e s u l t s a r e d e s c r i b e d i n t h e l a s t p a r t o f t h i s c h a p t e r . 4.1.1 Properties of O. bornovanus transmitted viruses used in this study Cucumber leaf spot virus C L S V , o r i g i n a l l y c l a s s i f i e d as a c a r m o v i r u s ( R u s s o et al, 1 9 9 4 ) h a s r e c e n t l y b e e n r e - c l a s s i f i e d as a m e m b e r o f a n e w g e n u s (Aureusvirus) o f t h e f a m i l y Tombusviridae ( M i l l e r et al, 1997; M a r t e l l i et al, 1 9 9 8 ) . C L S V i s k n o w n t o i n f e c t s e v e r a l c u l t i v a r s o f 8 2 Cucumis sativis ( c u c u m b e r s ) i n a d d i t i o n t o a w i d e r a n g e o f h e r b a c e o u s h o s t s b u t i s f o u n d n a t u r a l l y o n l y i n c u c u m b e r s ( W e b e r , 1 9 8 6 ) . Y o u n g l e a v e s o f C L S V - i n f e c t e d c u c u m b e r s a r e l i g h t g r e e n t o y e l l o w , c o n t a i n i n g i r r e g u l a r l y s h a p e d c l e a r i n g s w i t h b r o w n n e c r o t i c c e n t r e s . P l a n t s i n f e c t e d w i t h C L S V b e c o m e s e v e r e l y s t u n t e d a n d e v e n t u a l l y d i e ( W e b e r , 1 9 8 6 ) . C L S V v i r i o n s a r e i c o s a h e d r a l i n s h a p e a n d m e a s u r e 2 8 n m i n d i a m e t e r ( W e b e r , 1 9 8 6 ) . T h e y a r e c o m p r i s e d o f a s i n g l e C P o f 4 1 k D a a n d c o n t a i n p o s i t i v e - s e n s e , s i n g l e s t r a n d e d R N A o f 4.4 k b ( M i l l e r et al., 1 9 9 7 ) a n d are t r a n s m i t t e d i n t h e in vitro m a n n e r b y z o o s p o r e s o f O. bornovanus ( C a m p b e l l et ah, 1 9 9 1 ) . Melon necrotic spot virus M N S V i s a c a r m o v i r u s w i t h a p p r o x i m a t e l y 3 0 n m s p h e r i c a l p a r t i c l e s w h i c h i s t r a n s m i t t e d i n t h e in vitro m a n n e r b y z o o s p o r e s o f O. bornovanus ( F u r u k i , 1 9 8 1 ; R i v i e r e et al., 1989; C a m p b e l l et al., 1 9 9 1 ) . M N S V c a u s e s s i g n i f i c a n t l o s s o f y i e l d o f g r e e n h o u s e g r o w n m e l o n s a n d c u c u m b e r s ( R i v i e r e a n d R o c h o n , 1 9 9 0 ) . A s m e n t i o n e d a b o v e , t h e C P s e q u e n c e o f M N S V i s k n o w n ( R i v i e r e et al., 1 9 8 9 ) a n d s h o w s s i g n i f i c a n t s e q u e n c e s i m i l a r i t y w i t h th a t o f C N V . Red clover necrotic mosaic virus R C N M V i s a d i a n t h o v i r u s w h i c h i n f e c t s c a r n a t i o n . D i a n t h o v i r u s p a r t i c l e s a r e i s o m e t r i c , 3 3 n m i n d i a m e t e r a n d c o n s i s t o f a s i n g l e c a p s i d p r o t e i n o f a p p r o x i m a t e l y 3 7 k D a . V i r i o n s e n c a p s i d a t e t w o m a j o r g e n o m i c ( g ) R N A s p e c i e s ; R N A 1 c o n t a i n s t h e o p e n r e a d i n g f r a m e ( O R F ) f o r t h e C P ( X i o n g a n d L o m m e l , 1 9 8 9 ) . R C N M V i s t r a n s m i t t e d i n t h e in vitro m a n n e r b y z o o s p o r e s o f O. bornovanus ( C a m p b e l l , 1 9 9 6 ) . 8 3 Cucumber necrosis virus P r o p e r t i e s o f C N V w e r e p r e v i o u s l y d e s c r i b e d ( s e e s e c t i o n 1.3). 4.2 Results 4.2.1 Comparative sequence analysis of the CNV, MNSV, and RCNMV coat proteins T h e C P a m i n o a c i d s e q u e n c e s o f s e v e r a l s m a l l s p h e r i c a l p l a n t v i r u s e s w e r e c o m p a r e d t o d e t e r m i n e i f t h o s e v i r u s e s k n o w n t o b e t r a n s m i t t e d b y O. bornovanus (i.e. C N V , C L S V , M N S V , a n d R C N M V ) s h a r e f e a t u r e s i n c o m m o n . A d e n d o g r a m ( F i g u r e 4.1) b a s e d o n t h e s e a l i g n m e n t s s u g g e s t s t h a t t h e C P s o f t h r e e o f t h e f o u r v i r u s e s ( C N V , C L S V , a n d M N S V ) t r a n s m i t t e d b y O. bornovanus a r e e v o l u t i o n a r y m o r e c l o s e l y r e l a t e d t o o n e a n o t h e r t h a n t o a n y o f t h e o t h e r t e n v i r u s C P s c o m p a r e d . It i s s u r p r i s i n g t h a t R C N M V d o e s n o t c l u s t e r w i t h t h e o t h e r O. bornovanus t r a n s m i t t e d v i r u s e s i n t h e d e n d o g r a m ( F i g u r e 4.1). I n a s e p e r a t e d e n d o g r a m u t i l i z i n g a m i n o a c i d s e q u e n c e s f r o m t h e C P P - d o m a i n s o n l y , i t w a s f o u n d t h a t C N V , C L S V , M N S V , a n d R C N M V w e r e p r e s e n t i n t h e s a m e c l u s t e r b u t s e p e r a t e f r o m t h e o t h e r v i r u s e s u s e d i n t h e a n a l y s i s ( D . R o c h o n , p e r s o n a l c o m m u n i c a t i o n ) . T h e C P s o f T N V - A , w h i c h i s t r a n s m i t t e d b y O. brassicae, a n d Oat chlorotic stunt virus ( O C S V ) , w h i c h h a s b e e n s u g g e s t e d t o b e t r a n s m i t t e d b y Olpidium ( B o o n h a m et al., 1995; C a m p b e l l , 1 9 9 6 ) , s h o w o n l y a d i s t a n t e v o l u t i o n a r y r e l a t i o n s h i p t o C L S V , M N S V , a n d C N V . A s w i l l b e d i s c u s s e d , t h e o v e r a l l s e q u e n c e s i m i l a r i t y b e t w e e n C N V , C L S V , a n d M N S V r e f l e c t s t h e i r s i m i l a r t r a n s m i s s i o n s . 8 4 T a b l e 4.1 V i r u s n a m e , g e n u s , a c c e s s i o n n u m b e r a n d r e f e r e n c e f o r v i r u s e s u s e d i n t h e c o a t p r o t e i n s e q u e n c e a l i g n m e n t s a n d d e n d o g r a m f o r F i g u r e s 4.1, 4.2, a n d 4.3. V i r u s 3 G e n u s A c c e s s i o n N u m b e r R e f e r e n c e Cymbidium ringspot virus ( C y R S V ) Pothos latent virus ( P o L V ) Tomato bushy stunt virus, cherry strain ( T B S V - C h ) Artichoke mottle crinkle virus ( A M C V ) Cucumber necrosis virus ( C N V ) Cucumber leaf spot virus ( C L S V ) Melon necrotic spot virus ( M N S V ) Red clover necrotic mosaic virus ( R C N M V ) Turnip crinkle virus ( T C V ) Carnation mottle virus ( C a r M V ) Oat chlorotic stunt virus ( O C S V ) Tobacco necrosis virus strain A ( T N V - A ) Maize chlorotic mottle virus ( M C M V ) Tombusvirus Aureusvirus Tombusvirus Tombusvirus Tombusvirus Aureusvirus Carmovirus Dianthovirus Carmovirus Carmovirus U n c l a s s i f i e d Necrovirus Machlomovirus S 0 5 4 5 7 C A B 5 9 7 9 4 P I 1 6 8 9 P 1 4 8 3 6 P 1 5 1 8 3 P 1 9 8 9 9 P 2 2 9 5 5 A A A 9 6 9 7 1 P 0 4 3 8 3 C A A 5 8 7 9 8 P 2 2 9 5 9 P I 1 6 4 2 G r i e c o etal., 1 9 8 9 R u b i n o etal., 1 9 9 5 H i l l m a n e r a / . , 1 9 8 9 G r i e c o a n d G a l l i t e l l i , 1 9 9 0 R o c h o n a n d T r e m a i n e , 1 9 8 9 M i l l e r etal, 1 9 9 7 R i v i e r e s ai, 1 9 8 9 X i o n g a n d L o m m e l , 1 9 8 9 C a r r i n g t o n et al., 1 9 8 9 a G u i l l e y e r a / . , 1 9 8 5 B o o n h a m et al., 1 9 9 5 M e u l e w a e t e r et al., 1 9 9 0 N u t t e r etal, 1 9 8 9 'The virus name is followed by its acronym in parenthesis. 8 5 CyRSV CP (Tombus) PoLV CP (Aureus) . AMCV CP (Tombus) ~ " I TBSV-Ch CP (Tombus) I *CNV CP (Tombus) . *MNSV CP (Carmo) I *CLSV CP (Aureus) . I *RCNMV CP (Diantho) . CarMV CP (Carmo) I TCV CP (Carmo) I OCSV CP (Unclassified) • MCMV CP (Machlomo) TNV-A CP (Necro) F i g u r e 4.1 D e n d o g r a m d e p i c t i n g r e l a t i o n s h i p s a m o n g t h e C P s o f s e v e r a l i c o s a h e d r a l v i r u s e s . B r a n c h l e n g t h s a r e p r o p o r t i o n a l t o t h e d i s t a n c e s b e t w e e n t h e r e s p e c t i v e s e q u e n c e s . S e e T a b l e 1 f o r f u l l v i r u s n a m e s , a c c e s s i o n n u m b e r s a n d r e f e r e n c e s . T h e a s t e r i s k s i n d i c a t e t h e f o u r v i r u s e s k n o w n t o b e t r a n s m i t t e d b y O. bornovanus. T h e d e n d o g r a m w a s o b t a i n e d u s i n g " G r o w t r e e " a v a i l a b l e t h r o u g h " G e n e w o r k s " . T h e a l i g n m e n t u s e d t o p r o d u c e t h e d e n d o g r a m s h o w n i n F i g u r e 4.1 ( F i g u r e 4.3) w a s e x a m i n e d i n o r d e r t o f u r t h e r a s s e s s s p e c i f i c s e q u e n c e r e l a t i o n s h i p s a m o n g t h e f o u r O. bornovanus t r a n s m i t t e d v i r u s e s . It c a n b e s e e n t h a t t h e r e a r e s e v e r a l r e g i o n s i n t h e 8 6 a l i g n m e n t w h e r e s e q u e n c e s i m i l a r i t y (at l e a s t t h r e e o u t o f f o u r r e s i d u e s , s e e a s t e r i s k s ) o c c u r s a m o n g C N V , C L S V , M N S V a n d R C N M V b u t n o t g e n e r a l l y a m o n g t h e n i n e o t h e r v i r u s e s e x a m i n e d . O n e s o m e w h a t s t r i k i n g r e g i o n o c c u r s i n t h e P - d o m a i n , t h e d o m a i n o f t h e t o m b u s v i r u s c o a t p r o t e i n w h i c h i s l e a s t c o n s e r v e d ( R i v i e r e et al., 1 9 8 9 ) . I n t e r e s t i n g l y , t h i s r e g i o n c o r r e s p o n d s t o a l o o p a n d i t s f l a n k i n g r e g i o n s at a d i s t a l p o r t i o n o f t h e P-d o m a i n . M o r e o v e r , a C N V t r a n s m i s s i o n m u t a n t r e c e n t l y i d e n t i f i e d i n t h i s l a b o r a t o r y ( K . K a k a n i a n d D . R o c h o n , p e r s o n a l c o m m u n i c a t i o n ) m a p s to a s e r i n e r e s i d u e i n a n a d j a c e n t l o o p i n t h e C N V p a r t i c l e . T h i s t r a n s m i s s i o n m u t a n t a l s o f a i l s t o b i n d t o O. bornovanus z o o s p o r e s i n in vitro b i n d i n g a s s a y s . T h e s e o b s e r v a t i o n s s u g g e s t t h a t t h i s r e g i o n o f t h e C N V p a r t i c l e ( a n d p e r h a p s C L S V , M N S V , a n d R C N M V p a r t i c l e s ) m a y c o r r e s p o n d t o a v i r u s a t t a c h m e n t s i t e . 8 7 CarMV CP ME NKGEKIAMNPTVQTLAQKGDKLAVKL VTR--GWASLSTNQKR 42 TCV CP ME NDPRVRKFASDGAQWAIKWQKKGWST LT SRQKQTARAAM 41 AMCV CP MAMVKRN1SDSITGLIPVSTKQLMALGAAAGASALQGFVRNNGAAIVGKWDV 50 TBSV-Ch CP MAMVKRNNNTGMIPVSTKQLLALGAAAGATALQGFVKNNGMAIVEGAVDL 50 CyRSV CP MAMTTTNNNRAMTRAAKQALPALGALATSGMGQQLF MSGVNYAIEK 46 CNV CP MALVSRNNNMRTLAKLAAPLATAGTRTIVDNKEAIW--NGVKWIWGKLPK 48 MNSV CP MAMVKRINNLPTVKLAKQALPLLANPKLVNKAIDW- - PLWQGGRKLSK 48 CLSV CP ME - IARTNKNS WKYVPAAVG-AAYQMGKSIVPYAP - - TIVDALGNWSR 46 RCNMV CP MS - - SKAPKKSKQRSQPRN RTPNT 22 PoLV CP MALVKRNNNMALIASEAGAAIKAGQVMLSPAGRELIW-NGVNWVRRKLGR 49 OCSV CP MTLNLRKVPAYLPGKVDGALTNLVHAAVDHWPGLGKAEKAAAVYNIKQV 50 MCMV CP MAASSRSTRGR KQRGRSVEAKSRAIR ANPPVPR P 34 TNV-A CP MAGKKNNNNGQYIILRTPEQQVEIDQRNARRAQMGRMKKARQPVQRYLQQ 50 Consensus MA...R.NN L -- V 50 CarMV CP TCV CP AMCV CP TBSV-Ch CP CyRSV CP CNV CP MNSV CP CLSV CP RCNMV CP PoLV CP OCSV CP MCMV CP TNV-A CP Consensus ML. LS-- VYKAVKKRGGKKQ--AYKAVRRRGGKKQ-- -F-VPNRRGGKKN--AGYTPA ILAFTPRRPRMTNP 67 -PVAQPV QKVTRLSAPVALAY 66 -QQIKHV GGTGGAIMA-VAVTR 86 -QMINHV GGTGGAIMAPVAVTR 87 -RNTDMVAHPGALSGSMAAPVAISR 84 -ALIAHP QAFPGAIAAPISYAY 7 8 -NISYTE GAKPGAISAPVAISR 80 -EVQNQI VGGIGAIAAPVSITK 78 TVAIPFAKTQ 35 SKK S--DVILHV LPGAIAAPVANTR 72 VKKLGTYTEQGVKKIAKKTLGELGYLNYTPSSHLGMAITGRGTKQINMSR 100 NPQRN R PPPAGTTCSMSEI--LLAVSATT ADQILEIPV 70 HGLRNGLSGRGGYIVAPTSGGWTRPIVPKFSNRGDSTIVRNTEILNNQI 100 100 RAE GIK GQK TKR GKQ GKK GKNG--NG-AAK RLLGAYGG-ATG RKKKSKGK-SVK .K- ...G....- . G. . .APVA. . CarMV CP TCV CP AMCV CP TBSV-Ch CP CyRSV CP CNV CP MNSV CP CLSV CP RCNMV CP PoLV CP OCSV CP MCMV CP TNV-A CP Consensus S->* PPRTSRNS PG-QAGKSMTMSKT-REVSTQPRVS-TARDGITRSGS-QLTGSKPKFTGKTSGSVTVTHR-QLVGSKPKFTGRTSGSVTVTHR-IVRGSKPRFI-RSKGSVTITHR-AVKGRKPRFQ-TAKGSVRITHR-ELLST- -VKGTTG --VI ELITT- -LKKNTD --TE EYLSQ--VNMSTG-F--QVN EYLSQ--VNNSTG-F--QVN ELVGQ--FNSSSA-L--WN EYVSV--LSGTNGEF--LRN EFIAS- -VLP-SSDL--TVN ELVTS- -VINLVGNF--RVN QLVMS- -WGSVQ-M--RTN ELLGQ--FS--SG-L--WN RVRGMRPSFR-QTKGKVRIVHR IIKTVNP PPKPARGILHT IIRASKPKFT-RSKGSVTIAHR STNAGGFALGGTTAAPVSISRNINRRSKPSIKMMGDAWISHSEMLGAIN CAGID-FPAGTSPRYIGAAKWLAAQSQMWNTIVFNSVRITWETFTADTTS LAALGAFNTTNSALIAAAPSWLASIADLYSKYRWLSCEIIYIPKCPTTTS P.F.-.. .GSV.I.HR E --V -.-.VN 101 100 123 124 120 115 116 115 68 106 150 119 150 150 CarMV CP TCV CP AMCV CP TBSV-Ch CP CyRSV CP CNV CP MNSV CP CLSV CP RCNMV CP PoLV CP OCSV CP MCMV CP TNV-A CP Consensus PSF PKY GGI-VG-GGI-VG-GGI-TG-- EDWWS PRNVAVFPQLSLLATNFNKYRITALTVKYS P - TTAVLNP SEPGTFNQLIKEAAQYEKYRFTSLRFRYSP -NLLQLNPLNGTLFSWLPAIASNFDQYSFNSVLLHYVP -NLLQLNPLNGTLFSWLPAIASNFDQYTFNSWLHYVP -NLYKINPANAVLFPWLQTLASNFDQYMFNTLRLQYVP NGTGPN NDFSINPLNPFLFPWLVNIAANFDQYKFNSLRFEYVP NG-DVN IGKYRVNPSNNALFTWLQGQAQLYDMYRFTRLRITYIP NNVSAQ IGQFRINPSNSSLFTWLPTIASNFDSYRFTSIRFVYVP NGK-SN QRFRLNPSNPALFPTLAYEAANYDMYRLKKLTLRYVP GGV-SG NVYRINPSNP WFPWLQGIAASFDQYKFDQ - - LQYVP SGTPSSNVTAFRCTGYRANPGMSTIFPWLSATAVNYEKYKFRRLSFTLVP GYISMAFLSDYMLSIPTGVEDVARIVPSATI-ALKNRGPSIVMPQNRTVF GSIAMAFTYDRNDAAPTARAQLSQSYKAINFPPYAGYDGAAYLNSNQGAG . G. - . . NP.N.. LFPWL ...A.NFD.Y.F..L... YVP 141 140 165 166 162 158 159 159 110 146 200 168' 200 200 8 8 ** * ** CarMV CP ACSFETNGRVALGFNDDASDTPPTTKVGFYDLGKHVETAAQTAKDLVIPV 191 TCV CP MSPSTTGGKVALAFDRDAAKPPPNDLASLYNIEGCVSSVPWTGFILTVPT 190 AMCV CP LCATTEVGRVAMYFDKDSEDPEPADRVELANYSVLAETAPWAERALWVPT 215 TBSV-Ch CP LCSTTEVGRVAIYFDKDSEDPEPADRVELANYSVLKETAPWAEAMLRVPT 216 CyRSV CP MCATTETGRVAIYFDKDSQDLEPVDRIELANMRHLTETAPWCEGSLRVPV 212 CNV CP LVNTTTNGRVALYFDKDSEDPGPDDRAALANYAHLSEISPWAITKLTVPT 208 MNSV CP TTGSTSTGRVSLLWDRDSQDPLPIDRAAISSYAHSADSAPWAENVLWPC 209 CLSV CP LCATTETGRVSLFWDKDSQDPLPVDRAALSSYGHSNEGPPWAETTLNVPT 209 RCNMV CP LVTVQNSGRVAMIWDPDSQDSAPQSRQEISAYSRSVSTAVYEKCSLTIPA 160 PoLV CP MCATTETGRVAIYFDKDSQDVEPADRDELAIMAH--ESAPWCESTLSIPV 194 OCSV CP LVSTNYSGRIGVGFDYDSSDLVPGNRQEFYALSNHCENMPWQESTVEIKC 250 MCMV CP RCIQAG-QFAALG SAADKQMYSPGRFIVAIPKASATQAVGQIKISY 213 TNV-A CP SAIAVQLDVTKLDKPWYPTISSAGFGALSVLDQNQFCPASLWASDGGPA 250 Consensus .C.TT..GRVAL.FD.DS.D..P.DR..L E.APW.E..L.VP. 250 CarMV CP DGKTRFIRDSASDDAKLVDFGRIVL-TCV CP DSTDRFVADGIS-DPKLVDFGKLIM-AMCV CP DRIKRFCDDSSTLDHKLIDLGQLGV-TBSV-Ch CP DKIKRFCDDSSTSDHKLIDLGQLGI-CyRSV CP DSVKRFMNDNSTVDPKLIDLGQVGL-CNV CP DNVKRFISDTSSGDPKLINLGQFGW-MNSV CP DNTWRYMNDTNAVDRKLVDFGQFLF-CLSV CP DGKQRFVTDSNTTDRKLVDLGQFAF-RCNMV CP DNQWRFVADNTTVDRKLVDFGQLLF-PoLV CP DNIKRFMNDNTTTDPKLVDLGQIGL-OCSV CP DNAYRFTGTHVAADNKLIDLGQVWMSDSVSNGGTISAALPLFDLIVNYT MCMV CP SVSYRGAAILQ--PALV-PGPGLANH 236 TNV-A CP TATPAGDLFIKYVIEFIEPINPTMNV 27 6 Consensus D...RF..D....D.KL.DLGQ. * * STYGFDKADTV--VG--ELFIQYT ATYGQGANDAAQLG- -EVRVEYT ATYG--GAGTNA--VG--DIFISYS ATYG--GAGTNA--VG--DIFISYS ATYG--GPGTNA--VG--DLFIHYT VAYS--GP-TAE--LG- -DIFVEYT ATYS--GAGSTA--HG--DLYVEYA ATYA--GGSNNQ--IG--DIYVEYG VTHS--GSDGIE--TG- -DIFLDCE ATGG--S--TNP--VG--DLFIHYT -ATY.-G -.G--D.F. .Y. 236 235 259 260 256 251 253 253 204 236 300 300 CarMV CP TCV CP AMCV CP TBSV-Ch CP CyRSV CP CNV CP MNSV CP CLSV CP RCNMV CP PoLV CP OCSV CP Consensus * P-> IVLSDPTKT VQLKNRTGS VTLYFPQPT VTLYFPQPT VTFYEPQPS VDLFEAQPT VEFKDPQPI VEFSEAQPA VEFKGPQPT ITLFEPQPL -AKIS QASN-DKVSDG-PTYW-PSVNG-NEL--TSDA QIGQFAGVKDG-PRLVSWSKTKGTAGW--NTLLS--TRRLDLAGTPVTASG-PGYI--LLTRTPTVL--NTLLS--TRRLDLAGALVTASG-PGYL--LVSRTATVL-SGLTS--T--LQ-TGTGSANAG-PTLV--AVATTATTT-SPLLE--SLFRESASSVQTRMGLPYFS--LEVASATDL-AGMVCMFDRLVSLSEVGSTIKGVNYIADRDVITTGGNI-GGLTQYITK-- SVGATAST-TGPSYWDANINVNATTA-ASIVQ--KTVIDLGGTLTSFEGPSYLMPPDAFITSSSF-ASLVE - - T EQTGTGAAPFG LV- - TVS SNAT IT -VELIEPQQALFSSQLYSGSTTFTSGIPLGTGADTTTWGPTWNSTTVTN V.L. .PQP.-- -- G....V T..-272 274 301 302 295 294 300 297 249 273 350 350 CarMV CP -QLRWAA-GKWCII-VRGTVE--GGFTKPTLIG—PGISGDVDYESARP 315 TCV CP -EHDCHFL-GTGNFS-LTLFYEK-APVSGLENAD--ASDFSVLGEAAAGS 318 AMCV CP -TMTFRAT-GTFVIS-GAYRCLTSTVLGLTGGVN—VNSITWDNVGTSS 346 TBSV-Ch CP -TMTFRAT-GTFVIS-GTYRCLTATTLGLAGGVN--VNSITWDNIGTDS 347 CyRSV CP -TVTFRSP-GTYLVS-MVQRATTFTGVT-PIALT--FNSNTNTTAAGTNY 339 CNV CP -VWQARVP-GTYWT-IIFNSTVGGLTPSISGGG—TINSSFSVSTAGSS 339 MNSV CP -GVNINIP-GTYLVT-IVLNATSIGPLTFTGNSKLVGNSLNLTSSGASAL 347 CLSV CP -NVEFFSP-GTFLIT-AWYGSTIASPSMAGGNGTLIGDLPWGGSNASI 344 RCNMV CP -GLFVDVA-GTYLLT-LWTCSTTGSVTVGGNSTLVGDGRAAYGSSNYIA 296 PoLV CP -IYTFEGP-GVYLLA-LSQRAASFTTFVTAGGVN--SHTTTITSGPAYQS 318 OCSV CP CWTFKLPAGVFEVSYFIAWSTGTAAWPTVPTTGAGSKLSNTSTGSNSY 400 Consensus - -GT. . . . - — 400 CarMV CP IAVCELV-TQ MEGQILKIT--KTSAEQPL QWWYRM 348 TCV CP VQWAGVK-VA ERGQGVKMV--TTEEQPKG KLQALRI 351 AMCV CP SFFINCT-VS NLPSVITFT-TTGITSATI QCNRRTRQNDVS 385 TBSV-Ch CP AFFINCT-VS NLPSWTFT-STGITSATV HCVRATRQNDVS 386 CyRSV CP SANYNVT-VP VPGAQMRFV-GTGFGNYTL QVTRAKITNAAT 378 CNV CP AYVANIT-IR VNANLSLSG-LTGATNAQL FAVRAITENAVQ 378 MNSV CP TFTLNST-GV PNSSDSSFSVGTWALTRV RMTITRCSPETA 387 CLSV CP WTCVFST-TG VSTSVPTFT-QAGTGLTRV QYTITRVNSQTA 383 RCNMV CP SIVFTSSGVL STTPSVQFSGSSGVSRVQM NICRCKQGNTFI 337 PoLV CP ICEYYCC-YT WGS—ITYN-GTLFGNYTL TRAKISNNAT 353 OCSV CP GVCFINSPVECDLLLTATVLLIIPTLPSSTCVFHAPARRCTTPMCHRLLT 450 Consensus -V. -.T 450 8 9 CarMV CP 348 TCV CP 351 AMCV CP -LI- 387 TBSV-Ch CP -LI- 388 CyRSV CP -LL- 380 CNV CP -W- 380 MNSV CP YLA- 390 CLSV CP YQV- 386 RCNMV CP -LG- 339 PoLV CP -LI- 355 OCSV CP SLAG 454 Consensus -L. - 454 Figure 4.2 A l i g n m e n t o f t h e C P s o f s e v e r a l s m a l l s p h e r i c a l v i r u s e s u s i n g p r o g r a m s a v a i l a b l e t h r o u g h G C G ( D e v e r e u x et a l . , 1 9 8 4 ) . A s t e r i s k s (*) i n d i c a t e a a c o n s e r v e d (at l e a s t t h r e e o f f o u r ) a m o n g t h e O. ^ornova/zMS-transmitted v i r u s e s ( C N V , C L S V , M N S V , a n d R C N M V ) b u t n o t g e n e r a l l y s h a r e d a m o n g t h e o t h e r n o n - t r a n s m i t t e d v i r u s e s . S e e T a b l e 4.1 f o r f u l l v i r u s n a m e s , a c c e s s i o n n u m b e r s a n d r e f e r e n c e s . T h e b o l d l e t t e r s f o l l o w e d b y a r r o w s i n d i c a t e t h e b e g i n n i n g s o f t h e R N A b i n d i n g d o m a i n ( R ) , t h e a r m (a), t h e s h e l l d o m a i n ( S ) a n d t h e p r o t r u d i n g d o m a i n ( P ) . CNV CP --AYVANITI RVNANLSLSG LTGATNAQLF AVRAITENAV QW 380 MNSV CP FTLNSTGVPN SSDSSFSVGT WALTRVRMT ITRCSPETAY -LA 3 90 CLSV CP TCVFSTTGVS TSVPTFT-QA GTGLTRVQYT ITRVNSQTAY -QV 3 86 RCNMV CP SIVFTSSGVL STTPSVQFSG SSGVSRVQMN ICRCKQGNTF ILG 339 Consensus G.TRVQ. . I.R A. ... 393 Figure 4.3 A l i g n m e n t o f t h e C P a m i n o a c i d s e q u e n c e s o f f o u r O. bornovanus-t r a n s m i t t e d v i r u s e s ( C N V , M N S V , C L S V , a n d R C N M V ) u s i n g p r o g r a m s a v a i l a b l e t h r o u g h G C G ( D e v e r e u x et a l . , 1 9 8 4 ) s h o w i n g t h e t e r m i n a l r e g i o n o f t h e C P ( P - d o m a i n ) . S i m i l a r a m i n o a c i d s (at l e a s t t h r e e o f f o u r ) w h i c h d o n o t o c c u r i n t h e a l i g n m e n t i n F i g u r e 4.2 a r e h i g h l i g h t e d i n b o l d t y p e . S e e T a b l e 4.1 f o r f u l l v i r u s n a m e s , a c c e s s i o n n u m b e r s a n d r e f e r e n c e s . 4.2.2 The CLSV coat protein is not required for cell-to-cell movement but is required for systemic movement in A7, benthamiana. A f r a m e s h i f t m u t a t i o n w a s i n t r o d u c e d i n t h e 5' t e r m i n a l r e g i o n o f t h e C L S V C P O R F ( C L S V nt 2 5 9 1 ) i n a f u l l - l e n g t h i n f e c t i o u s C L S V c D N A c l o n e , J R 3 , t o p r o d u c e m u t a n t J R 3 A X h o . T h e m u t a t i o n r e s u l t s i n a t r u n c a t e d (81 aa) C P . F o l l o w i n g i n o c u l a t i o n o f J R 3 a n d J R 3 A X h o T 7 R N A p o l y m e r a s e r u n - o f f t r a n s c r i p t s o n t o N. benthamiana, p r o g r e s s i o n o f s y m p t o m s w a s o b s e r v e d o v e r t h e c o u r s e o f 2 4 d a y s . W i l d - t y p e C L S V 9 0 ( J R 3 ) p r o d u c e d f a i n t c h l o r o s i s o n i n o c u l a t e d l e a v e s t w o d a y s p o s t - i n o c u l a t i o n ( d p i ) w i t h c h l o r o t i c l e s i o n s a p p e a r i n g t h r e e d p i . C h l o r o t i c l e s i o n s w e r e v i s i b l e o n J R 3 s y s t e m i c a l l y i n f e c t e d l e a v e s ( n o t i n o c u l a t e d ) s i x d p i a c c o m p a n i e d b y s e v e r e s t u n t i n g a n d n e c r o s i s o f t h e p l a n t at 12 d p i a n d d e a t h b y 2 4 d p i ( F i g u r e 4.4 A , B , a n d C ) . I n t h r e e s e p a r a t e e x p e r i m e n t s i t w a s f o u n d th a t t h e C P f r a m e s h i f t m u t a n t J R 3 A X h o p r o d u c e d c h l o r o s i s o n t h e i n o c u l a t e d l e a v e s w i t h i n t w o t o t h r e e d p i s i m i l a r t o J R 3 b u t n o s y s t e m i c s y m p t o m s o c c u r r e d as l a t e as 2 4 d p i ( F i g u r e 4.4 A , B , a n d C ) . I n t e r e s t i n g l y , b l a c k - r i m m e d n e c r o t i c l e s i o n s w e r e o b s e r v e d o n t h e i n o c u l a t e d l e a v e s o f J R 3 A X h o at s i x d p i b u t n o t o n J R 3 i n o c u l a t e d l e a v e s , w h i c h s t i l l d i s p l a y e d c h l o r o t i c l e s i o n s ( F i g u r e 4.5 A a n d B ) . J R 3 A X h o - i n f e c t e d p l a n t s d i s p l a y e d n o n e o f t h e s t u n t i n g o r d e a t h s e e n i n J R 3 i n f e c t i o n s ( F i g u r e 4.4 C ) , a s i d e f r o m d e a t h o f t h e o r i g i n a l t r a n s c r i p t - i n o c u l a t e d l e a v e s ( F i g u r e 4.4 B a n d C ) . S a p f r o m J R 3 A X h o - i n o c u l a t e d l e a v e s w a s i n f e c t i o u s w h e n p a s s e d t o n e w N. benthamiana p l a n t s , a l t h o u g h f e w e r l e s i o n s w e r e o b s e r v e d f r o m J R 3 A X h o as c o m p a r e d t o J R 3 a n d n o s y s t e m i c i n f e c t i o n o c c u r r e d ( n o t s h o w n ) . 91 F i g u r e 4.4 S y m p t o m s o n N. benthamiana i n o c u l a t e d w i t h t r a n s c r i p t s o f J R 3 ( l e f t p o t ) J R 3 A X h 0 ( r i g h t p o t ) at ( A ) s i x d p i , ( B ) 12 d p i , a n d ( C ) 2 4 d p i . 9 2 Figure 4.5 S y m p t o m s o n K benthamiana o f l e a v e s i n o c u l a t e d w i t h t r a n s c r i p t s o f ( A ) J R 3 A X h o o r ( B ) J R 3 ( w i l d - t y p e C L S V ) . P h o t o g r a p h s w e r e t a k e n s i x d p i . 9 3 Total R N A was extracted from inoculated and systemically infected leaves of JR3 and JR3AXho-inoculated N. benthamiana plants and elecrophoresed through agarose gels (Figure 4.6). Genomic length (g)RNA was readily observed in both inoculated plants (Figure 4.6) demonstrating that JR3AXho infects and moves cell-to-cell in transcript-inoculated leaves. JR3 gRNA was observed in total R N A extracts of systemically infected leaves of JR3 transcript-inoculated plants but JR3AXho gRNA was not detected in total RNA extracts of similar leaves of plants inoculated with JR3AXho transcripts (Figure 4.6). These results demonstrate that the C L S V CP is not required for cell-to-cell movement but is required for systemic movement. Similar observations were made following sap transmission of JR3AXho-transcript-inoculated leaves (not shown). JR3 JR3AXho mock tx syst tx syst Figure 4.6 Agarose gel of total RNA extracted from single leaves of N. benthamiana. Equal volumes of total leaf R N A extracted from a single leaf were loaded in wells. Lane 1 contains total R N A from a mock-inoculated leaf. Lanes 2 and 3 contain total R N A from JR3 transcript-inoculated and systemically infected leaves, respectively. Lanes 4 and 5 contain total R N A from JR3AXho transcript-inoculated and systemically infected leaves, respectively. The arrow indicates the location of the viral genomic (g)RNA band. 94 4.3 Discussion 4.3.1 Comparative sequence analysis I n t h i s c h a p t e r c o m p a r a t i v e a m i n o a c i d s e q u e n c e a n a l y s i s h a s s h o w n t h a t t h e C P s o f t h r e e O. bornovanus-transmitted v i r u s e s ( C N V , C L S V , a n d M N S V ) a r e m o r e s i m i l a r t o e a c h o t h e r t h a n t o t h e t e n o t h e r s m a l l s p h e r i c a l v i r u s e s u s e d i n t h e p h y l o g e n e t i c a n a l y s i s ( M i l l e r et al, 1997; F i g u r e 4.1). T h e c o n s e r v a t i o n o f s e q u e n c e a m o n g t h e C P s o f t h e s e t h r e e v i r u s e s i s p a r t i c u l a r l y s t r i k i n g i n v i e w o f t h e a f f i n i t i e s o f t h e s e v i r u s e s w i t h d i s t i n c t g e n e r a i n t h e f a m i l y Tombusviridae ( T a b l e 4.1). T o e x a m i n e f u r t h e r t h e s e q u e n c e s i m i l a r i t y t h a t o c c u r s b e t w e e n C N V , M N S V , C L S V , a n d R C N M V , a n a m i n o a c i d s e q u e n c e a l i g n m e n t w a s p e r f o r m e d u s i n g t h e C P a m i n o a c i d s e q u e n c e s o f t h i r t e e n s m a l l s p h e r i c a l p l a n t v i r u s e s f r o m t h e Tombusviridae ( F i g u r e 4.2). S e v e r a l r e g i o n s o f a m i n o a c i d s e q u e n c e s i m i l a r i t y w e r e i d e n t i f i e d , i n c l u d i n g a r e g i o n i n t h e o t h e r w i s e v a r i a b l e p r o t r u d i n g d o m a i n . T h e c o n s e r v e d r e g i o n i n t h e P-d o m a i n w a s p r e v i o u s l y i d e n t i f i e d f r o m a m i n o a c i d s e q u e n c e a l i g n m e n t s b e t w e e n t h e C P s o f C N V a n d M N S V ( R i v i e r e et al, 1 9 8 9 ) . A n e x a m i n a t i o n o f t w o - d i m e n s i o n a l s t r u c t u r a l r e p r e s e n t a t i o n s o f C N V a n d M N S V , b a s e d o n t h e k n o w n T B S V P - d o m a i n s t r u c t u r e ( s e e s e c t i o n 1.3.5), i n d i c a t e d t h a t t h e a m i n o a c i d s c o r r e s p o n d i n g t o t h e c o n s e r v e d r e g i o n o c c u r i n a l o o p a n d f l a n k i n g r e g i o n s i n t h e P - d o m a i n s o f t h e s e v i r u s e s . M u t a t i o n s w e r e m a d e i n t h i s r e g i o n i n C N V c h a n g i n g a S e r t o A l a ( C N V C P a a 3 1 2 ) a n d a T h r t o A l a ( C N V C P a a 3 1 3 ) i n t w o s e p a r a t e C N V c D N A c l o n e s ( M . R o b b i n s , u n p u b l i s h e d r e s u l t s ) . H o w e v e r , C N V p a r t i c l e s c o n t a i n i n g t h e s e t w o m u t a t i o n s a p p e a r e d t o b e t r a n s m i t t e d as e f f i c i e n t l y as w i l d - t y p e C N V . It w o u l d b e i n t e r e s t i n g t o p e r f o r m f u r t h e r m u t a g e n e s i s o f t h e s e a m i n o 9 5 a c i d s a n d o t h e r s i n t h i s r e g i o n i n o r d e r t o f u r t h e r a s s e s s t h e i r r o l e i n f u n g u s t r a n s m i s s i o n . F o r e x a m p l e , t h e S e r a n d T h r c o u l d b e m u t a t e d e i t h e r t o G l y ( r e m o v i n g t h e s i d e - c h a i n s ) o r t o c h a r g e d o r a r o m a t i c a m i n o a c i d s t o a l t e r t h e p u t a t i v e i n t e r a c t i o n s w i t h a z o o s p o r e r e c e p t o r . A n o t h e r r e g i o n o f a m i n o a c i d s e q u e n c e s i m i l a r i t y b e t w e e n t h e P - d o m a i n s o f t h e O. £>0ra0vanws-transmitted v i r u s e s w a s i d e n t i f i e d f r o m a m i n o a c i d s e q u e n c e a l i g n m e n t s o f t h e s e f o u r v i r u s e s a l o n e ( G . T R V Q ) ( F i g u r e 4.3). B a s e d o n a m i n o a c i d s e q u e n c e c o m p a r i s o n s b e t w e e n C N V a n d T B S V , t h i s s e q u e n c e i s l o c a t e d i n a l o o p o n t h e P-d o m a i n , a g a i n a d j a c e n t t o t h e t w o o t h e r i d e n t i f i e d l o o p s . T h e f a c t t h a t t h i s r e g i o n o f s i m i l a r i t y i s n o t o b s e r v e d i n t h e a l i g n m e n t c o n t a i n i n g t h e 13 m e m b e r s o f t h e Tombusviridae i n d i c a t e s t h a t c a u t i o n s h o u l d b e t a k e n i n i n t e r p r e t a t i o n o f t h e r e s u l t s . M u t a g e n e s i s o f t h i s r e g i o n w o u l d h e l p e s t a b l i s h i t s r o l e i n f u n g u s t r a n s m i s s i o n . 4.3.2 Role of the CLSV CP in virus movement T o f u r t h e r e x a m i n e t h e r o l e o f t h e C L S V C P i n t h e m u l t i p l i c a t i o n - c y c l e o f t h i s v i r u s , a f r a m e s h i f t m u t a t i o n w a s i n t r o d u c e d i n t o t h e 5' t e r m i n a l r e g i o n o f t h e C P O R F . T r a n s c r i p t s o f t h i s m u t a n t w e r e i n o c u l a t e d o n t o N. benthamiana a n d e x a m i n e d f o r t h e i r a b i l i t y t o c a u s e a n i n f e c t i o n , t o m o v e c e l l - t o - c e l l , a n d t o m o v e s y s t e m i c a l l y . It w a s f o u n d t h a t l o s s o f t h e C P d i d n o t a f f e c t c e l l - t o - c e l l m o v e m e n t b u t d i d r e s u l t i n t h e i n a b i l i t y o f the v i r u s t o m o v e s y s t e m i c a l l y i n t h e s e p l a n t s ( F i g u r e 4.4 a n d 4.5). A n o t h e r Aureusvirus, Pothos latent virus ( P o L V ) , h a s b e e n r e p o r t e d t o b e a b l e t o m o v e s y s t e m i c a l l y i n p l a n t s i n t h e a b s e n c e o f a f u n c t i o n a l C P ( R u b i n o a n d R u s s o , 1 9 9 7 ) . I n t h e s e s t u d i e s , s e v e r a l d i f f e r e n t C P - m u t a n t s o f P o L V w e r e p r o d u c e d ( R u b i n o a n d R u s s o , 1 9 9 7 ) . T h e s e m u t a n t s 9 6 a l l h a d t h e a b i l i t y t o m o v e c e l l - t o - c e l l b u t s h o w e d v a r i a b i l i t y i n t h e i r a b i l i t y t o m o v e s y s t e m i c a l l y . O n e d e l e t i o n m u t a n t , D B g / B s , c o n t a i n e d a l a r g e d e l e t i o n i n t h e P o L V C P O R F ( i t r e t a i n e d t h e C P R - d o m a i n b u t n o t t h e S- o r P - d o m a i n s ) . D B g / B s c o u l d i n f e c t t r a n s c r i p t - i n o c u l a t e d l e a v e s o f N. benthamiana b u t w a s u n a b l e t o m o v e s y s t e m i c a l l y ( R u b i n o a n d R u s s o , 1 9 9 7 ) . S e v e r a l o t h e r m u t a n t s w e r e p r o d u c e d w h i c h l a c k e d a P-d o m a i n o r w h i c h c o n t a i n e d m u t a t i o n s i n t h e S - d o m a i n . T h e s e m u t a n t s w e r e i n f e c t i o u s a n d s p r e a d s y s t e m i c a l l y i n N. benthamiana w i t h t h e a p p e a r a n c e o f s y s t e m i c s y m p t o m s v a r y i n g f r o m 4 t o 21 d p i d e p e n d i n g o n t h e m u t a n t ( R u b i n o a n d R u s s o , 1 9 9 7 ) . I n t e r e s t i n g l y , s y m p t o m s e l i c i t e d b y t h e s e P o L V C P m u t a n t s w e r e m o r e s e v e r e t h a n w i l d -t y p e , w i t h n e c r o s i s o f v a s c u l a r t i s s u e s i n d u c i n g r a p i d d e a t h o f t h e w h o l e p l a n t . It w a s n o t e d t h a t c o n c e n t r a t i o n s o f t h e 0.8 k b s g R N A ( w h i c h e n c o d e s t h e s y m p t o m - i n d u c i n g p r o t e i n ) w e r e h i g h e r t h a n t h a t o f w i l d - t y p e v i r u s ( R u b i n o a n d R u s s o , 1 9 9 7 ) . It i s p o s s i b l e t h a t e x c e s s p r o d u c t i o n o f t h e n e c r o s i s - i n d u c i n g 14 k D a p r o t e i n w a s r e s p o n s i b l e f o r t h e l e t h a l p h e n o t y p e s o f t h e s e m u t a n t s ( R u b i n o a n d R u s s o , 1 9 9 7 ) . T h e J R 3 A X h o m u t a n t w a s f o u n d t o p r o d u c e d a r k - r i m m e d n e c r o t i c l e s i o n s 6 d p i w h i c h w e r e s t r i k i n g l y d i f f e r e n t f r o m t h e u s u a l c h l o r o t i c l e s i o n s o b s e r v e d s i x d p i w i t h w i l d - t y p e i n f e c t i o n s . It m a y b e th a t J R 3 A X h o i n f e c t i o n s p r o d u c e m o r e o f t h e n e c r o s i s -i n d u c i n g 14 k D a p r o t e i n , as w a s h y p o t h e s i z e d f o r C P m u t a n t s o f P o L V ( R u b i n o a n d R u s s o , 1 9 9 7 ) . T h e s e m u t a n t s w e r e u s u a l l y d e l a y e d i n t h e i r p r o d u c t i o n o f s y s t e m i c s y m p t o m s ( R u b i n o a n d R u s s o , 1 9 9 7 ) . T h e n e c r o s i s c a u s e d b y J R 3 A X h o m a y h a v e b e e n s o s e v e r e th a t t h i s m u t a n t c o u l d n o t e s c a p e t h e n e c r o t i c a r e a t o e n t e r t h e p h l o e m f o r l o n g -d i s t a n c e t r a n s p o r t . 9 7 5 C H A P T E R F I V E : E V I D E N C E T H A T F U N G A L Z O O S P O R E S C O N T A I N S P E C I F I C R E C E P T O R S F O R T R A N S M I S S I O N O F C N V 5.1 Introduction I n f e c t i o n o f c e l l s b y a n i m a l , i n s e c t a n d b a c t e r i a l v i r u s e s r e q u i r e s s p e c i f i c c e l l u l a r r e c e p t o r s that, i n p a r t , d e t e r m i n e h o s t r a n g e a n d t i s s u e t r o p i s m . ( M a r s h a n d H e l e n i u s , 1989; R o s s m a n n , 1 9 9 4 ) . P l a n t v i r u s e s , h o w e v e r , g e n e r a l l y g a i n e n t r y t o p l a n t c e l l s t h r o u g h s p e c i f i c i n v e r t e b r a t e o r f u n g a l v e c t o r s w h i c h b r e a c h t h e c e l l w a l l a n d e n a b l e a c c e s s o f t h e v i r u s t o t h e p l a n t c y t o s o l w h e r e u n c o a t i n g a n d r e p l i c a t i o n o c c u r s ( M a t t h e w s , 1 9 9 1 ) . C e l l - t o - c e l l s p r e a d o f t h e v i r u s b e y o n d t h e i n i t i a l s i t e o f i n f e c t i o n t h e n o c c u r s v i a p r e - e x i s t i n g i n t e r c e l l u l a r j u n c t i o n s ( f o r r e v i e w s e e C a r r i n g t o n et al., 1 9 9 6 ) . T h e r e a r e s e v e r a l i n d i c a t i o n s i n t h e l i t e r a t u r e t h a t h i g h l y s p e c i a l i z e d i n t e r a c t i o n s e x i s t b e t w e e n p l a n t v i r u s e s a n d t h e i r v e c t o r s ( C a m p b e l l et a l . , 1 9 9 5 ; ) . I n m a n y c a s e s t h e s p e c i f i c i t y o f i n t e r a c t i o n h a s b e e n f o u n d t o r e s i d e , at l e a s t i n p a r t , i n p r o t e i n s e n c o d e d b y t h e v i r a l g e n o m e . S u c h p r o t e i n s i n c l u d e t h e v i r a l c o a t p r o t e i n , h e l p e r c o m p o n e n t , a n d c e r t a i n o t h e r n o n - s t r u c t u r a l p r o t e i n s ( f o r r e v i e w s s e e G r a y , 1996; P i r o n e a n d B l a n c , 1 9 9 6 ) . H o w e v e r , t h e r e h a v e o n l y b e e n a f e w r e p o r t s o f t h e p o s s i b l e i n v o l v e m e n t o f r e c e p t o r s i n o r o n v e c t o r s w h i c h m e d i a t e t r a n s m i s s i o n . G i l d o w ( 1 9 9 3 ) , u s i n g t r a n s m i s s i o n e l e c t r o n m i c r o s c o p y , s h o w e d t h a t r e c e p t o r m e d i a t e d e n d o c y t o s i s m a y b e i n v o l v e d i n b a r l e y y e l l o w d w a r f l u t e o v i r u s m o v e m e n t i n t o a p h i d g u t c e l l s . I n a d d i t i o n , B a n d l a et al. ( 1 9 9 8 ) h a v e r e c e n t l y i d e n t i f i e d a p r o t e i n f r o m t h e t h r i p s m i d g u t w h i c h i s a p o t e n t i a l r e c e p t o r f o r 9 8 t o m a t o s p o t t e d w i l t t o s p o v i r u s . S y m b i o n i n , a h o m o l o g u e o f t h e Escherichia coli G r o E L c h a p e r o n i n p r o t e i n w h i c h i s h i g h l y a b u n d a n t i n a p h i d v e c t o r h e m o l y m p h , h a s b e e n s h o w n t o b i n d l u t e o v i r u s e s a n d p l a y a c r u c i a l r o l e i n t r a n s m i s s i o n . H o w e v e r , s y m b i o n i n d o e s n o t a p p e a r t o p l a y a r e c e p t o r r o l e i n t r a n s m i s s i o n ( v a n d e n H e u v e l et al., 1 9 9 7 ) . Cucumber necrosis tombusvirus ( C N V ) i s o n e o f s e v e r a l s m a l l i c o s a h e d r a l v i r u s e s i n t h e f a m i l y Tombusviridae k n o w n t o b e t r a n s m i t t e d b y Olpidium spp. ( C a m p b e l l , 1 9 9 6 ) . T r a n s m i s s i o n o c c u r s f o l l o w i n g i n d e p e n d e n t r e l e a s e o f z o o s p o r e s a n d v i r u s i n t o t h e s o i l a n d s u b s e q u e n t a d s o r p t i o n o f v i r u s p a r t i c l e s o n t o t h e s u r f a c e m e m b r a n e o f m o t i l e z o o s p o r e s . V i r u s p a r t i c l e s g a i n e n t r y i n t o r o o t c e l l s f o l l o w i n g e n c y s t m e n t o f f u n g a l z o o s p o r e s ( C a m p b e l l , 1996; A d a m s 1 9 9 1 ) . E l e c t r o n m i c r o s c o p y s t u d i e s h a v e s u g g e s t e d t h a t a d s o r p t i o n o f v i r u s t o t h e z o o s p o r e p l a s m a l e m m a i s v e r y s p e c i f i c ; Tobacco necrosis virus ( T N V ) b i n d s O. brassicae z o o s p o r e s b u t n o t O. bornovanus z o o s p o r e s a n d C N V b i n d s O. bornovanus z o o s p o r e s b u t n o t O. brassicae z o o s p o r e s ( T e m m i n k et al, 1 9 7 0 ) . I n a d d i t i o n , b i o l o g i c a l s t u d i e s h a v e s h o w n t h a t t h e r e a r e s t r a i n s o f Olpidium s p p . w h i c h v a r y i n t h e i r a b i l i t y t o t r a n s m i t a g i v e n v i r u s ( T e m m i n k et al., 1970; C a m p b e l l et al., 1994; C a m p b e l l et al., 1 9 9 1 ) . T h i s s p e c i f i c i t y o f i n t e r a c t i o n h a s s u g g e s t e d t h a t b o t h v i r u s a n d z o o s p o r e s p o s s e s s s p e c i f i c c o m p o n e n t s w h i c h d e t e r m i n e t r a n s m i s s i b i l i t y ( s e e s e c t i o n f o r m o r e d e t a i l s ) . I n p r e v i o u s w o r k , w e h a v e s h o w n t h a t t h e C N V c o a t p r o t e i n g e n e c o n t a i n s d e t e r m i n a n t s f o r t h e s p e c i f i c i t y o f t r a n s m i s s i o n b y O. bornovanus ( M c L e a n et al., 1 9 9 4 ) . I n a d d i t i o n , s t u d i e s o f a n a t u r a l l y o c c u r r i n g C N V m u t a n t d e f i c i e n t i n t r a n s m i s s i o n ( L L 5 ) h a v e l e d t o t h e i d e n t i f i c a t i o n o f a s p e c i f i c a m i n o a c i d i n t h e C N V c o a t p r o t e i n s h e l l d o m a i n w h i c h i s c r i t i c a l f o r e f f i c i e n t f u n g u s t r a n s m i s s i o n ( C h a p t e r 3; R o b b i n s et al., 99 1 9 9 7 ) . I n t e r e s t i n g l y , in vitro b i n d i n g a s s a y s s h o w e d t h a t L L 5 b o u n d z o o s p o r e s t o o n l y a p p r o x i m a t e l y 5 0 % o f t h e l e v e l o f C N V . T h i s s u g g e s t e d t h a t at l e a s t p a r t o f t h e r e d u c e d t r a n s m i s s i o n o f L L 5 c a n b e a t t r i b u t e d t o i n e f f i c i e n t z o o s p o r e b i n d i n g . W e w i s h e d t o d e t e r m i n e w h e t h e r a c q u i s i t i o n a n d s u b s e q u e n t t r a n s m i s s i o n o f C N V b y O. bornovanus i n v o l v e s s p e c i f i c z o o s p o r e r e c e p t o r s . T o d o t h i s , w e h a v e d e v e l o p e d a v i r u s / z o o s p o r e in vitro b i n d i n g a s s a y . W e s h o w t h a t b i n d i n g o f Olpidium t r a n s m i t t e d v i r u s t o z o o s p o r e s i s s p e c i f i c a n d s a t u r a b l e a n d t h a t C N V c a n c o m p e t i t i v e l y i n h i b i t b i n d i n g o f t w o o t h e r v i r u s e s . T h e s e f i n d i n g s s u g g e s t t h a t C N V a t t a c h m e n t t o O. bornovanus z o o s p o r e s i n v o l v e s s p e c i f i c z o o s p o r e r e c e p t o r s . 5.2 Results 5.2.1 Development of an in vitro assay for binding of CNV to O. bornovanus zoospores. T o o p t i m i z e t h e b i n d i n g a s s a y , w e f i r s t e x a m i n e d t h e e f f e c t o f t i m e a n d p H o n t h e a b i l i t y o f C N V t o b i n d z o o s p o r e s . F o r t h e t i m e c o u r s e e x p e r i m e n t , C N V (6.77 X 1 0 1 2 p a r t i c l e s ) w a s i n c u b a t e d w i t h 4 X 1 0 5 O. bornovanus z o o s p o r e s i n 1 m l 5 0 m M NaPC>4 , p H 7.6 f o r 0 t o 1 2 0 m i n . F o l l o w i n g l o w s p e e d c e n t r i f u g a t i o n t o p e l l e t z o o s p o r e s a n d w a s h i n g t o r e m o v e u n b o u n d v i r u s , t h e a m o u n t o f b o u n d v i r u s w a s d e t e r m i n e d u s i n g W e s t e r n b l o t a n a l y s i s f o l l o w e d b y d e n s i t o m e t r y . T h e t i m e c o u r s e a n a l y s i s i n F i g u r e 5.1 s h o w s t h a t a p p r o x i m a t e l y 5 0 % o f t o t a l b i n d i n g o c c u r s w i t h i n 10 m i n a n d t h a t b i n d i n g i n c r e a s e s u n t i l 4 0 m i n a f t e r w h i c h t h e r a t e o f b i n d i n g a p p r o a c h e s e q u i l i b r i u m . 1 0 0 5.5 5 4.5 0.5 0* , , , , , , , 0 20 40 60 80 100 120 140 Time in minutes Figure 5.1 E f f e c t o f t i m e o n b i n d i n g o f C N V t o O. bornovanus z o o s p o r e s . O. bornovanus z o o s p o r e s ( 4 X 1 0 ) w e r e i n c u b a t e d w i t h 6.77 X 10 p a r t i c l e s o f C N V f o r 0 t o 1 2 0 m i n i n 5 0 m M NaPC>4 b u f f e r , p H 7.6. T h e l e v e l o f b i n d i n g w a s d e t e r m i n e d u s i n g W e s t e r n b l o t a n a l y s i s f o l l o w e d b y d e n s i t o m e t r y . E a c h d a t a p o i n t r e p r e s e n t s t h e a v e r a g e o f t h r e e e x p e r i m e n t s u s i n g t r i p l i c a t e s a m p l e s f o r e a c h t i m e p o i n t . E r r o r b a r s r e p r e s e n t s t a n d a r d e r r o r . T h e a m o u n t o f v i r u s b o u n d t o w a s h e s o f u n i n f e c t e d r o o t s w a s a l s o d e t e r m i n e d a n d t h i s v a l u e w a s s u b t r a c t e d f r o m t h e a m o u n t o f v i r u s b o u n d t o z o o s p o r e s t o g i v e t h e v a l u e s s h o w n . W e a l s o w i s h e d t o e x a m i n e t h e e f f e c t o f b u f f e r a n d p H o n b i n d i n g o f C N V t o O. bornovanus. F u n g u s t r a n s m i s s i o n a s s a y s u s i n g C N V a n d O. bornovanus h a v e c u s t o m a r i l y u s e d 5 0 m M g l y c i n e b u f f e r , p H 7.6 ( R o b b i n s et al, 1997; C a m p b e l l et al, 1 9 9 1 ) . W e w i s h e d t o e x a m i n e t h i s b u f f e r as w e l l as o t h e r b u f f e r s at p H 7.6 f o r t h e i r 101 e f f e c t o n C N V b i n d i n g . It w a s d e t e r m i n e d t h a t 5 0 m M N a P C v b u f f e r ( p H 7.6) g a v e c o n s i s t e n t l y h i g h b i n d i n g v a l u e s ( d a t a n o t s h o w n ) . T h e e f f e c t o f v a r y i n g t h e p H b e t w e e n 5.6 a n d 8.2 u s i n g 5 0 m M NaPC>4 b u f f e r w a s t h e n e x a m i n e d . F i g u r e 5.2 s h o w s t h a t b i n d i n g o f C N V t o O. bornovanus z o o s p o r e s i s p H d e p e n d e n t w i t h t h e h i g h e s t l e v e l o f b i n d i n g o c c u r r i n g a r o u n d p H 7.2. S i g n i f i c a n t l y l o w e r l e v e l s o f b i n d i n g o c c u r r e d at p H v a l u e s l e s s t h a n 7.0 a n d g r e a t e r t h a n p H 8.0. 25 i 0 J , , , , , , 5 5.5 6 6.5 7 7.5 8 8.5 pH F i g u r e 5.2 E f f e c t o f p H o n b i n d i n g o f C N V t o O. bornovanus z o o s p o r e s . O. bornovanus z o o s p o r e s (1 X 10 6 ) w e r e i n c u b a t e d w i t h 6.77 X 1 0 1 2 p a r t i c l e s o f C N V f o r o n e h o u r i n 5 0 m M N a P C v b u f f e r at p H 5.6, 6.2, 6.8, 7.2, 7.6, o r 8.2 a n d t h e l e v e l o f b i n d i n g d e t e r m i n e d u s i n g W e s t e r n b l o t a n a l y s i s as i n F i g . 5.1. E a c h d a t a p o i n t r e p r e s e n t s t h e a v e r a g e o f t h r e e r e p l i c a t e s a n d t h e e r r o r b a r s t h e s t a n d a r d e r r o r . T h e a m o u n t o f v i r u s b o u n d t o w a s h e s o f u n i n f e c t e d r o o t s w a s d e t e r m i n e d i n t r i p l i c a t e at e a c h p H a n d t h i s v a l u e w a s s u b t r a c t e d f r o m t h e a m o u n t o f v i r u s b o u n d t o z o o s p o r e s t o g i v e t h e v a l u e s s h o w n . 102 D u r i n g t h e d e v e l o p m e n t o f t h e b i n d i n g a s s a y i t w a s n o t e d t h a t a l o w l e v e l o f C N V (ca . 5 % o f t h e t o t a l b o u n d t o z o o s p o r e s ) c o u l d b e p e l l e t e d i n N a P C U b u f f e r i n t h e a b s e n c e o f z o o s p o r e s . I n a d d i t i o n , a l o w l e v e l o f b i n d i n g ( c a . 2 0 % o f t o t a l b i n d i n g t o z o o s p o r e s ) a l s o o c c u r r e d t o c u c u m b e r r o o t w a s h e s f r o m p l a n t s n o t c o n t a i n i n g z o o s p o r e s . T h e r e f o r e e a c h b i n d i n g e x p e r i m e n t i n c l u d e d a r o o t w a s h c o n t r o l t o a c c o u n t f o r b a c k g r o u n d l e v e l s o f v i r u s p r e c i p i t a t i o n a n d n o n - s p e c i f i c b i n d i n g t o r o o t w a s h m a t e r i a l . T h e f i n a l b i n d i n g a s s a y a d o p t e d u s e d 4 X 1 0 5 t o 1 X 1 0 6 z o o s p o r e s , 5 0 m M s o d i u m p h o s p h a t e , p H 7.6 i n a o n e m l f i n a l v o l u m e a n d a o n e h o u r a c q u i s i t i o n t i m e . U s i n g t h e s e c o n d i t i o n s a n d 6.77 X 1 0 1 2 p a r t i c l e s o f C N V , i t w a s f o u n d t h a t a p p r o x i m a t e l y 3 X 1 0 9 t o 1 X 1 0 1 0 p a r t i c l e s o f C N V a s s o c i a t e d w i t h t h e z o o s p o r e p e l l e t ( s e e F i g u r e s 5.1 a n d 5.2). T h i s c o r r e s p o n d s t o 4 0 t o 133 t i m e s t h e a m o u n t o f b i n d i n g o b s e r v e d i n o u r p r e v i o u s a s s a y ( R o b b i n s et al, 1 9 9 7 ) . 5.2.2 B i n d i n g o f v i r u s t o z o o s p o r e s i s s p e c i f i c . T o a s s e s s t h e p o s s i b i l i t y t h a t a s p e c i f i c r e c e p t o r i s i n v o l v e d i n t r a n s m i s s i o n b y Olpidium spp., t h r e e v i r u s e s k n o w n t o b e t r a n s m i t t e d b y O. bornovanus, [ C N V , Melon necrotic spot carmovirus ( M N S V ) a n d Cucumber leaf spot aureusvirus ( C L S V ) ; C a m p b e l l , 1 9 9 6 ] , a n d o n e k n o w n t o b e t r a n s m i t t e d b y O. brassicae ( T N V ; C a m p b e l l , 1 9 9 6 ) w e r e e x a m i n e d f o r t h e i r a b i l i t y t o b i n d t o z o o s p o r e s o f O. bornovanus a n d O. brassicae u s i n g t h e a b o v e d e s c r i b e d b i n d i n g a s s a y . F i g u r e 5.3 A s h o w s tha t C N V , M N S V a n d C L S V e a c h b i n d O. bornovanus z o o s p o r e s a n d t h a t b i n d i n g o f C N V a n d M N S V o c c u r s t o a p p r o x i m a t e l y t w o t i m e s t h e l e v e l t h a t o c c u r s w i t h T N V . T h e l e v e l o f b i n d i n g o f C L S V w a s t h e g r e a t e s t b e i n g a p p r o x i m a t e l y f i v e - f o l d h i g h e r t h a n t h a t o f e i t h e r 103 C N V o r M N S V . F i g u r e 3 B s h o w s t h a t t h e l e v e l o f b i n d i n g o f T N V t o O. brassicae w a s a l w a y s g r e a t e r t h a n t h a t o f C N V , C L S V , o r M N S V . 5.2.3 B i n d i n g o f v i r u s t o z o o s p o r e s i s s a t u r a b l e . I f a p u t a t i v e r e c e p t o r m o l e c u l e i s l o c a t e d o n t h e s u r f a c e o f Olpidium z o o s p o r e s , t h e b i n d i n g o f v i r u s e s t o t h e z o o s p o r e s s h o u l d b e s a t u r a b l e ( T a r d i e u et ah, 1 9 8 2 ) . T o d e t e r m i n e w h e t h e r C N V b i n d i n g t o O. bornovanus z o o s p o r e s ' i s s a t u r a b l e , i n c r e a s i n g a m o u n t s o f C N V p a r t i c l e s w e r e i n c u b a t e d w i t h 4 X 1 0 5 O. bornovanus z o o s p o r e s a n d t h e a m o u n t o f b o u n d v i r u s d e t e r m i n e d u s i n g W e s t e r n b l o t a n a l y s i s f o l l o w e d b y d e n s i t o m e t r y . F i g u r e 5.4 A s h o w s t h a t O. bornovanus z o o s p o r e s e x h i b i t s a t u r a b l e b i n d i n g at h i g h c o n c e n t r a t i o n s o f C N V . A t s a t u r a t i o n , a p p r o x i m a t e l y 7 x 1 0 9 C N V p a r t i c l e s w e r e b o u n d to 4 x 1 0 5 z o o s p o r e s . T h i s c o r r e s p o n d s t o 1.75 x 1 0 4 p a r t i c l e s o f C N V b o u n d p e r z o o s p o r e at s a t u r a t i o n . B i n d i n g o f T N V o f t o O. bornovanus d i d n o t a p p e a r s a t u r a b l e ( F i g u r e 5.4 A ) . 104 cn u « a. u X-B. 14 12 10 O X •c 4 a cn fl 3 u CNV MNSV *CLSV TNV CNV MNSV CLSV TNV F i g u r e 5.3 S p e c i f i c i t y o f v i r u s b i n d i n g t o Olpidium spp. O n e h u n d r e d m i c r o g r a m s o f e i t h e r C N V , M N S V , C L S V , T N V o r T B S V - C h w a s i n c u b a t e d w i t h 1 X 1 0 6 O. bornovanus ( A ) o r O. brassicae z o o s p o r e s ( B ) i n 5 0 m M NaP04, p H 7.6 f o r 1 h r a n d t h e a m o u n t o f b o u n d v i r u s d e t e r m i n e d . b y W e s t e r n b l o t t i n g f o r C N V , M N S V , C L S V a n d T N V o r b y E L I S A f o r T B S V - C h . T h e a m o u n t o f v i r u s b o u n d t o w a s h e s o f u n i n f e c t e d r o o t s o f c u c u m b e r o r l e t t u c e w a s a l s o d e t e r m i n e d a n d t h i s v a l u e w a s s u b t r a c t e d f r o m t h e a m o u n t o f v i r u s b o u n d t o z o o s p o r e s t o g i v e t h e v a l u e s s h o w n . A l l v a l u e s r e p r e s e n t t h e a v e r a g e o f t r i p l i c a t e t r e a t m e n t s f r o m t w o s e p a r a t e e x p e r i m e n t s . * T h e a c t u a l l e v e l o f C L S V b i n d i n g i s f i v e f o l d g r e a t e r t h a n t h a t i n d i c a t e d i n t h e g r a p h (i.e., 5.5 x 1 0 1 0 p a r t i c l e s / 1 0 6 z o o s p o r e s ) . 105 F i g u r e 5.4 S a t u r a t i o n b i n d i n g o f v i r u s t o Olpidium s p p . I n c r e a s i n g c o n c e n t r a t i o n s o f e i t h e r C N V o r T N V w e r e a d d e d t o 4 X 1 0 5 (A)<9. bornovanus o r ( B j O. brassicae z o o s p o r e s a n d t h e a m o u n t o f b o u n d v i r u s d e t e r m i n e d u s i n g W e s t e r n b l o t a n a l y s i s as d e s c r i b e d i n F i g u r e 1. T h e a m o u n t o f v i r u s b o u n d t o w a s h e s o f u n i n f e c t e d r o o t s w a s a l s o d e t e r m i n e d a n d t h i s v a l u e w a s s u b t r a c t e d f r o m t h e a m o u n t o f v i r u s b o u n d t o z o o s p o r e s t o g i v e t h e v a l u e s h o w n . A l l v a l u e s r e p r e s e n t t h e a v e r a g e o f t r i p l i c a t e t r e a t m e n t s f r o m o n e r e p r e s e n t a t i v e e x p e r i m e n t . 1 0 6 S i m i l a r s a t u r a t i o n b i n d i n g e x p e r i m e n t s w e r e c o n d u c t e d u s i n g O. brassicae z o o s p o r e s ( F i g u r e 5.4 B ) . It c a n b e s e e n t h a t b i n d i n g o f T N V i s s a t u r a b l e . A t s a t u r a t i o n a p p r o x i m a t e l y 5 x 1 0 9 p a r t i c l e s b o u n d t o 4 x 1 0 5 z o o s p o r e s . T h i s c o r r e s p o n d s t o 1.25 x 1 0 4 T N V p a r t i c l e s b o u n d p e r z o o s p o r e at s a t u r a t i o n . C N V b i n d i n g t o O. brassicae z o o s p o r e s w a s s i g n i f i c a n t l y l e s s t h a n t h a t a c h i e v e d b y T N V a n d d i d n o t a p p e a r t o b e s a t u r a b l e . 5.2.4 C N V c a n c o m p e t e w i t h M N S V a n d T N V b u t n o t w i t h C L S V f o r b i n d i n g s i t e s . A n o t h e r c r i t e r i o n f o r r e c e p t o r s p e c i f i c i t y i s b a s e d o n c o m p e t i t i o n f o r r e c e p t o r s b y r e l a t e d o r u n r e l a t e d v i r u s e s ( T a r d i e u et al, 1 9 8 2 ) . M N S V (3.39 x 1 0 1 2 p a r t i c l e s ) w a s i n c u b a t e d w i t h i n c r e a s i n g a m o u n t s o f C N V a n d t h e a m o u n t o f M N S V b o u n d w a s d e t e r m i n e d . F i g u r e 5.5 A s h o w s t h a t a t e n - f o l d e x c e s s o f c o m p e t i t o r C N V r e s u l t s i n a n a p p r o x i m a t e 6 2 % r e d u c t i o n i n t h e l e v e l o f b o u n d M N S V . C N V w a s a l s o c a p a b l e o f c o m p e t i t i v e l y i n h i b i t i n g T N V . I n t h i s c a s e a t e n f o l d e x c e s s o f c o m p e t i t o r r e s u l t e d i n a b o u t 9 0 % r e d u c t i o n o f T N V b i n d i n g ( F i g u r e 5.5 B ) . I n b o t h c a s e s c o m p e t i t i o n w a s e v i d e n t u s i n g as l i t t l e as a 2 - f o l d e x c e s s o f C N V . N o c o m p e t i t i o n w a s o b s e r v e d b e t w e e n C N V a n d C L S V e v e n w h e n a 2 0 f o l d e x c e s s o f C N V w a s u s e d as c o m p e t i t o r ( F i g u r e 5.5 C ) . 1 0 7 0 1.4 6.8 33.9 Number of CNV particles x 10' 2 added Number of CNV particles x 101 2 added F i g u r e 5.5 C o m p e t i t i o n b i n d i n g e x p e r i m e n t s u s i n g C N V a g a i n s t M N S V , T N V o r C L S V . I n c r e a s i n g a m o u n t s (0-3.4 x 1 0 1 3 p a r t i c l e s ) o f C N V w e r e a d d e d c o n c u r r e n t l y t o e i t h e r ( A ) M N S V (3.4 x 1 0 1 2 p a r t i c l e s ) , ( B ) T N V (4.5 x 1 0 1 2 p a r t i c l e s ) o r ( C ) C L S V (1.4 x 1 0 1 2 p a r t i c l e s ) , a n d 4 X 1 0 5 O. bornovanus z o o s p o r e s . T h e a m o u n t o f v i r u s b o u n d w a s d e t e r m i n e d u s i n g W e s t e r n b l o t a n a l y s i s . T h e a m o u n t o f v i r u s b o u n d t o w a s h e s o f u n i n f e c t e d r o o t s w a s d e t e r m i n e d a n d s u b t r a c t e d f r o m v i r u s b o u n d t o z o o s p o r e s t o g i v e t h e v a l u e s h o w n . V a l u e s s h o w n f o r M N S V , a n d T N V , a r e f r o m t r i p l i c a t e t r e a t m e n t s o f a r e p r e s e n t a t i v e e x p e r i m e n t w h i l e v a l u e s f o r C L S V a r e t h e a v e r a g e o f f o u r t r e a t m e n t s f r o m a s i n g l e e x p e r i m e n t . E r r o r b a r s r e p r e s e n t s t a n d a r d e r r o r . 108 5.3 Discussion W e h a v e p r e v i o u s l y s h o w n t h a t C N V v i r i o n s b i n d O. bornovanus z o o s p o r e s in vitro ( C h a p t e r 3; R o b b i n s et al, 1 9 9 7 ) . W e w i s h e d t o f u r t h e r d e v e l o p t h e in vitro b i n d i n g a s s a y i n o r d e r t o a s s e s s t h e p o s s i b l e i n v o l v e m e n t o f s p e c i f i c z o o s p o r e r e c e p t o r s i n C N V a t t a c h m e n t t o z o o s p o r e s . It w a s f o u n d t h a t b i n d i n g o f C N V t o z o o s p o r e s o f O. bornovanus i n c r e a s e s w i t h t i m e , r e a c h i n g 5 0 % o f t h e f i n a l l e v e l o f b i n d i n g w i t h i n 10 m i n a n d e q u i l i b r i u m at a p p r o x i m a t e l y 6 0 m i n . T h e t i m e d e p e n d e n c e o f b i n d i n g as w e l l as t h e a b i l i t y t o r e a c h e q u i l i b r i u m i s s u g g e s t i v e o f a s p e c i f i c i n t e r a c t i o n b e t w e e n v i r u s a n d z o o s p o r e s . I n a d d i t i o n , t h e r a p i d a d s o r p t i o n o f C N V t o z o o s p o r e s i s c o n s i s t e n t w i t h e a r l i e r f i n d i n g s b y D i a s ( 1 9 7 0 ) w h o s u g g e s t e d t h a t a n a c q u i s t i o n t i m e o f b e t w e e n 5 a n d 10 m i n w a s s u f f i c i e n t f o r C N V t r a n s m i s s i o n . It i s n o t e d t h a t i n s o m e e x p e r i m e n t s b i n d i n g l e v e l s d e c r e a s e d u p t o 5 0 % a f t e r 8 0 m i n ( n o t s h o w n ) . T h e b a s i s f o r t h e d e c r e a s e i n b i n d i n g i s n o t k n o w n b u t i t m a y b e r e l a t e d t o c e l l m e m b r a n e c h a n g e s t h a t t a k e p l a c e p r i o r t o z o o s p o r e e n c y s t m e n t w h i c h g e n e r a l l y o c c u r s 1-2 h r s a f t e r z o o s p o r e r e l e a s e ( S t o b b s et al, 1 9 8 2 ) . A t i m e o f 6 0 m i n . w a s c h o s e n f o r t h e s t a n d a r d b i n d i n g a s s a y s i n c e e q u i l i b r i u m w a s a c h i e v e d b y t h i s t i m e a n d s i n c e i t p r e c e d e d a d e c r e a s e i n b i n d i n g o b s e r v e d i n s o m e e x p e r i m e n t s . T h e p H d e p e n d e n c e o f b i n d i n g s u g g e s t s t h a t s p e c i f i c i n t e r a c t i o n s a r e r e q u i r e d f o r v i r u s / z o o s p o r e b i n d i n g . I n a d d i t i o n , t h e p H d e p e n d e n c e o f b i n d i n g r e f l e c t s e a r l i e r t r a n s m i s s i o n s t u d i e s . D i a s ( 1 9 7 0 b ) s h o w e d tha t O. bornovanus t r a n s m i t s C N V at p H 6, 7, a n d 8 b u t f a i l s t o t r a n s m i t at p H 4, 9, a n d 10. A l t h o u g h i t w a s s u g g e s t e d t h a t t h e l a c k o f t r a n s m i s s i o n w a s d u e t o p o o r z o o s p o r e m o t i l i t y ( D i a s , 1 9 7 0 b ) , o u r in vitro b i n d i n g d a t a 1 0 9 s u g g e s t s t h a t t h e f a i l u r e t o t r a n s m i t at t h e l a t t e r p H v a l u e s c a n a l s o b e a t t r i b u t e d t o i n e f f i c i e n t b i n d i n g o f C N V t o z o o s p o r e s . T h r e e m a j o r c r i t e r i a f o r v i r a l r e c o g n i t i o n s i t e s as r e c e p t o r s a r e s a t u r a b i l i t y , s p e c i f i c i t y , a n d c o m p e t i t i o n ( T a r d i e u et al, 1 9 8 2 ) . P r e v i o u s w o r k h a s s h o w n t h a t s p e c i f i c i n t e r a c t i o n s o c c u r b e t w e e n Olpidium s p p . a n d t h e v i r u s e s i t t r a n s m i t s . O. brassicae a n d O. bornovanus e a c h t r a n s m i t v i r u s e s t h a t a r e n o t t r a n s m i t t e d b y t h e o t h e r s p e c i e s ( T e m m i n k , 1970; C a m p b e l l etal., 1 9 9 5 ) . I n t h e c a s e o f T N V that i s t r a n s m i t t e d b y O. brassicae a n d C N V t r a n s m i t t e d b y O. bornovanus, e l e c t r o n m i c r o s c o p y h a s s h o w n tha t t h e r e s p e c t i v e v i r u s a d s o r b s o n l y t o t h e z o o s p o r e o f t h e v e c t o r s p e c i e s ( T e m m i n k et al., 1 9 7 0 ) . F u r t h e r m o r e , t h e r e a r e s t r a i n s o f e a c h s p e c i e s t h a t v a r y i n a b i l i t y t o t r a n s m i t a g i v e n v i r u s ( T e m m i n k et al., 1970; C a m p b e l l et al, 1995, C a m p b e l l et al, 1 9 9 1 ) . T h i s b i o l o g i c a l s p e c i f i c i t y s u g g e s t s t h a t a s p e c i f i c r e c e p t o r m a y b e i n v o l v e d i n t r a n s m i s s i o n b y Olpidium s p p . U s i n g t h e b i n d i n g a s s a y d e v e l o p e d i n C h a p t e r 3 w e h a v e d e t e r m i n e d t h a t C N V , M N S V a n d C L S V , w h i c h a r e t r a n s m i t t e d b y O. bornovanus, e a c h b i n d O. bornovanus z o o s p o r e s a n d tha t b i n d i n g o f C N V a n d M N S V o c c u r s t o a p p r o x i m a t e l y t w o t i m e s t h e l e v e l t h a t o c c u r s w i t h T N V . B i n d i n g o f C L S V o c c u r s at a p p r o x i m a t e l y 10 t i m e s t h e l e v e l as that f o r T N V . A d d i t i o n a l l y , b i n d i n g t o O. brassicae z o o s p o r e s i s g r e a t e s t u s i n g T N V , w h i c h i s t r a n s m i t t e d b y t h i s f u n g u s . T h e s e b i n d i n g e x p e r i m e n t s s h o w t h a t s p e c i f i c i t y o c c u r s i n b i n d i n g o f t h e s e v i r u s e s t o Olpidium z o o s p o r e s . M o r e o v e r , t h e o b s e r v e d s p e c i f i c i t y r e f l e c t s t h e p r e v i o u s l y d e s c r i b e d b i o l o g i c a l s p e c i f i c i t y ( C a m p b e l l , 1 9 9 6 ) . T h i s o b s e r v a t i o n s t r o n g l y s u g g e s t s t h a t s p e c i f i c z o o s p o r e r e c e p t o r s a r e i n v o l v e d i n a c q u i s i t i o n a n d t r a n s m i s s i o n o f t h e s e v i r u s e s i n n a t u r e . 1 1 0 A n o t h e r c r i t e r i o n f o r t h e p r e s e n c e o f s p e c i f i c r e c e p t o r s o n c e l l s i s t h a t b i n d i n g s h o u l d b e s a t u r a b l e ( T a r d i e u et al., 1 9 8 2 ) . S e v e r a l r e p e t i t i o n s o f t h e s a t u r a t i o n b i n d i n g e x p e r i m e n t w i t h C N V p a r t i c l e s a n d O. bornovanus z o o s p o r e s i n d i c a t e t h a t b i n d i n g o f C N V t o O. bornovanus i s s a t u r a b l e , i n d i c a t i n g t h a t b i n d i n g t o O. bornovanus o c c u r s v i a a s p e c i f i c , l i m i t e d n u m b e r o f r e c e p t o r s . T h e l i n e a r i n c r e a s e o b s e r v e d w i t h T N V i n d i c a t e s t h a t b i n d i n g o f T N V t o O. bornovanus z o o s p o r e s m a y b e l a r g e l y n o n - s p e c i f i c . S a t u r a b l e b i n d i n g o f T N V t o O. brassicae z o o s p o r e s i s s u g g e s t i v e o f a s p e c i f i c r e c e p t o r i n t e r a c t i o n w h e r e a s th e l i n e a r c u r v e o b t a i n e d w i t h C N V i s i n d i c a t i v e o f a n o n - s p e c i f i c a s s o c i a t i o n . T h e s a t u r a t i o n b i n d i n g a s s a y s i n d i c a t e t h a t s a t u r a t i o n o f C N V b i n d i n g s i t e s o n O. bornovanus o c c u r s w h e n a p p r o x i m a t e l y 1.75 X 1 0 4 C N V p a r t i c l e s a r e b o u n d p e r z o o s p o r e . T h i s s u g g e s t s t h a t t h e r e a r e a p p r o x i m a t e l y 1.75 X 1 0 4 p u t a t i v e C N V r e c e p t o r m o l e c u l e s p e r z o o s p o r e . T h e n u m b e r o f T N V p a r t i c l e s b o u n d p e r O. brassicae z o o s p o r e i s c a l c u l a t e d t o b e 1.25 X 10 4 . It i s n o t e d t h a t w e h a v e n o t y e t d e t e r m i n e d t h e l e v e l o f n o n - s p e c i f i c b i n d i n g o f C N V o r T N V to z o o s p o r e s s o t h e s e v a l u e s s h o u l d b e c o n s i d e r e d t o b e t h e m a x i m u m n u m b e r o f p a r t i c l e s b o u n d . T h e a b i l i t y o f C N V t o c o m p e t e w i t h M N S V a n d T N V f o r z o o s p o r e b i n d i n g p r o v i d e s f u r t h e r e v i d e n c e f o r t h e s p e c i f i c i t y o f i n t e r a c t i o n b e t w e e n t h e s e v i r u s e s a n d O. bornovanus z o o s p o r e s . I n a d d i t i o n , t h e s e d a t a s u g g e s t t h a t C N V s h a r e s r e c e p t o r ( s ) i n c o m m o n w i t h M N S V a n d p e r h a p s T N V o n O. bornovanus z o o s p o r e s . E x p e r i m e n t s h a v e n o t b e e n c o n d u c t e d t o d e t e r m i n e i f C L S V , M N S V , o r T N V c a n c o m p e t i t i v e l y i n h i b i t b i n d i n g o f C N V , p a r t l y d u e t o t h e v e r y l a r g e a m o u n t s o f p u r i f i e d v i r u s r e q u i r e d t o d o t h e s e e x p e r i m e n t s . A t t e m p t s t o l a b e l C N V p a r t i c l e s h a v e b e e n u n s u c c e s s f u l . T h e r e f o r e , c o m p e t i t i o n e x p e r i m e n t s u s i n g l a b e l e d C N V w e r e n o t c o n d u c t e d . S u c h e x p e r i m e n t s a r e 111 r e q u i r e d t o m o r e f u l l y a s s e s s t h e s p e c i f i c i t y o f C N V b i n d i n g t o z o o s p o r e s as w e l l as t h e l e v e l o f b a c k g r o u n d b i n d i n g . W e h a v e r e c e n t l y i d e n t i f i e d a d e t e r m i n a n t i n t h e s h e l l d o m a i n o f t h e C N V c o a t p r o t e i n w h i c h i s r e q u i r e d f o r e f f i c i e n t t r a n s m i s s i o n a n d b i n d i n g ( R o b b i n s et al, 1 9 9 7 ) . A d d i t i o n a l s t u d i e s h a v e s h o w n t h a t t w o p a r t i c u l a r r e g i o n s w i t h i n t h e C N V p r o t r u d i n g d o m a i n a l s o c o n t a i n t r a n s m i s s i o n d e t e r m i n a n t s ( D . R o c h o n a n d K. K a k a n i , u n p u b l i s h e d o b s e r v a t i o n s ) . T N V l a c k s a p r o t r u d i n g d o m a i n s o t h e T N V a t t a c h m e n t s i t e i s m o s t l i k e l y i n e x p o s e d r e g i o n s o f t h e s h e l l d o m a i n . It i s p o s s i b l e t h a t t h e m o r e e f f i c i e n t b i n d i n g o f C N V , M N S V a n d C L S V t o O. bornovanus i s at l e a s t i n p a r t d u e t o t h e i r p o s s e s s i o n o f p r o t r u d i n g d o m a i n d e t e r m i n a n t s a b s e n t i n T N V . A l t h o u g h w e h a v e p r o v i d e d b i o c h e m i c a l e v i d e n c e t h a t Olpidium m a y c o n t a i n r e c e p t o r s f o r C N V a n d T N V w e d o n o t y e t k n o w t h e n a t u r e o f t h i s r e c e p t o r . T r e a t m e n t o f z o o s p o r e s w i t h p h o s p h o l i p a s e C d i d n o t e l i m i n a t e b i n d i n g w h i l e t r e a t m e n t w i t h t r y p s i n d i d s i g n i f i c a n t l y r e d u c e b i n d i n g ( K . K a k a n i a n d D. R o c h o n , u n p u b l i s h e d o b s e r v a t i o n s ) . T h e s e r e s u l t s s u g g e s t t h a t p r o t e i n s m a y b e i n v o l v e d i n p a r t i c l e a t t a c h m e n t . 112 6 C H A P T E R S I X : U S E O F F I T C - L E C T I N S T O I D E N T I F Y S U G A R S O N T H E S U R F A C E O F O. BORNOVANUS A N D O. BRASSICAE Z O O S P O R E S 6.1 Introduction Olpidium s p p . b e l o n g t o t h e C h y t r i d i o m y c e t e s , w h i c h a r e p o s t e r i o r l y u n i f l a g e l l a t e C h y t r i d i o m y c o t a . A p r o m i n e n t c e l l c o a t c o n s i s t i n g o f g l y c o c o n j u g a t e s , p r o d u c e d f r o m G o l g i - d e r i v e d v e s i c l e s d u r i n g z o o s p o r o g e n e s i s , h a s b e e n o b s e r v e d a r o u n d z o o s p o r e s o f s o m e c h y t r i d i o m y c e t e s ( D o r w a r d a n d P o w e l l , 1 9 8 3 ; L i et a l . , 1 9 9 1 ; M a n i e r a n d L o u b e s , 1978; M u n n et a l . , 1 9 8 1 ; P o w e l l , 1 9 8 1 ; T a y l o r a n d F u l l e r , 1 9 8 1 ) . It i s m o s t l i k e l y t h a t a l l c h y t r i d s h a v e v a r y i n g d e g r e e s o f e x t r a c e l l u l a r m a t e r i a l c o a t i n g t h e p l a s m a m e m b r a n e o f z o o s p o r e s ( P o w e l l , 1 9 9 4 ) . M e c h a n i s m s f o r c e l l r e s p o n s e t o e n v i r o n m e n t a l t r i g g e r s o f t e n i n v o l v e g l y c o p r o t e i n r e c e p t o r s at t h e c e l l s u r f a c e ( S h a r o n a n d L i s , 1 9 9 3 ) . D i f f e r e n c e s i n c e l l s u r f a c e s o f z o o s p o r e s c a n h a v e m a j o r f u n c t i o n a l i m p l i c a t i o n s , s u c h as s e l e c t i v e b i n d i n g o f v i r u s e s f o r w h i c h s o m e c h y t r i d i o m y c e t e s s e r v e as v e c t o r s ( r e v i e w e d i n P o w e l l , 1 9 9 3 ) . S u r f a c e c a r b o h y d r a t e s a r e i m p o r t a n t i n f u n g a l - p l a n t i n t e r a c t i o n s as a d h e s i v e s t o t h e p l a n t s u r f a c e ( N i c h o l s o n , 1 9 8 4 ) a n d as d e t e r m i n a n t s o f c e l l - c e l l r e c o g n i t i o n ( C a l l o w , 1 9 8 7 ) . F l u o r e s c e n t l y l a b e l l e d p l a n t l e c t i n s h a v e b e e n u s e d t o d e t e r m i n e t h e n a t u r e o f s u r f a c e s u g a r s o n f u n g a l c e l l w a l l s ( O ' C o n n e l l , 1 9 9 1 ) a n d t h e z o o s p o r e p l a s m a m e m b r a n e ( G u i l l o t et al, 1990; B u r r a n d B e a k e s , 1994; B e r b e e a n d K e r w i n , 1 9 9 3 ; L e h n e n a n d 113 P o w e l l , 1 9 9 3 ) . L e c t i n s a r e p r o t e i n s a n d g l y c o p r o t e i n s w h i c h h a v e a f f i n i t y f o r s p e c i f i c m o n o - a n d o l i g o s a c c h a r i d e s ( R i n i , 1 9 9 5 ) . T h e T B S V C P s h e l l d o m a i n ( a n d t h e C N V C P s h e l l b y a n a l o g y ) c o n t a i n s a s t a n d a r d c l a s s I j e l l y r o l l m o t i f , as d o s e v e r a l o t h e r i c o s a h e d r a l a n i m a l a n d p l a n t v i r u s C P s as w e l l as t h e h e m a g g l u t i n i n o f i n f l u e n z a v i r u s ( C h e l v a n a y a g a m et al, 1 9 9 2 ) . N o n - v i r a l s t r u c t u r e s w i t h t h i s j e l l y - r o l l m o t i f i n c l u d e t h e l e c t i n c o n c a n a v a l i n A ( C o n A ) , t u m o r n e c r o s i s f a c t o r ( T N F ) , a n d t h e l a r g e d o m a i n o f t h e c a t a b o l i t e g e n e a c t i v a t o r p r o t e i n ( G A P ) ( C h e l v a n a y a g a m et al, 1 9 9 2 ) . T h e T B S V C P p r o t r u d i n g d o m a i n ( a n d t h e C N V C P p r o t r u d i n g d o m a i n b y a n a l o g y ) i s a u n i q u e e x a m p l e o f a c l a s s LT j e l l y r o l l w h i c h h a s b e e n h y p o t h e s i z e d t o b e a c a p t u r e d c e l l u l a r g e n e ( G i b s o n a n d A r g o s , 1 9 9 0 ) . S e v e r a l o f t h e v i r u s e s a n d p r o t e i n s k n o w n t o h a v e a c l a s s I j e l l y r o l l a r e l e c t i n s . C o n A h a s a s p e c i f i c i t y f o r D ( + ) - m a n n o s e . I n f l u e n z a v i r u s h e m a g g l u t i n i n i s t h e v i r a l s u r f a c e g l y c o p r o t e i n r e s p o n s i b l e f o r a t t a c h m e n t t o s i a l i c a c i d ( N - a c e t y l n e u r a m i n i c a c i d ) o f o l i g o s a c c h a r i d e s o n h o s t - c e l l s u r f a c e g l y c o p r o t e i n s a n d g l y c o l i p i d s a n d i s c o n s i d e r e d a l e c t i n ( W i l e y a n d S k e h e l , 1987; R i n i , 1 9 9 5 ) . T N F h a s a l e c t i n - l i k e s p e c i f i c i t y f o r t h e c a r b o h y d r a t e N , N ' - d i a c e t y l c h i t o b i o s e ( S h e r b l o m et al, 1 9 8 8 ) . T h e s t u d i e s d e s c r i b e d i n t h i s c h a p t e r w e r e u n d e r t a k e n t o d e t e r m i n e s o m e o f t h e s u g a r r e s i d u e s o n t h e s u r f a c e o f Olpidium z o o s p o r e s . F i v e F I T C - l a b e l l e d l e c t i n s r e p r e s e n t i n g f o u r d i f f e r e n t c l a s s e s o f s u g a r - b i n d i n g s p e c i f i c i t y ( T a b l e 4 ) w e r e u s e d t o p r o b e t h e s u r f a c e o f O. bornovanus o r O. brassicae z o o s p o r e s . I n a d d i t i o n , i t w a s o f i n t e r e s t t o d e t e r m i n e i f t h e r e a r e d i f f e r e n t t y p e s o f s u g a r s o n z o o s p o r e s o f t h e s e t w o s p e c i e s o f Olpidium, s i n c e t h e s e f u n g i h a v e d i f f e r e n t s p e c i f i c i t i e s i n t r a n s m i s s i o n o f v i r u s e s a n d v i r u s b i n d i n g in vitro ( s e e C h a p t e r 5). 1 1 4 Table 6.1 L e c t i n s u s e d i n b i n d i n g a s s a y s w i t h Olpidium z o o s p o r e s a n d t h e i r m a i n b i n d i n g s p e c i f i c i t i e s . Lectin Abbreviation Binding Specificity and Relative Affinity3 Mannose Group C o n c a n a v a l i n A b C o n A M e t h y l o c - D - m a n n o p y r a n o s i d e > D ( + ) -M a n n o s e > D ( + ) - g l u c o s e Chitin Group W h e a t g e r m a g g l u t i n i n 0 W G A N , N ' , N ' - T r i a c e t y l c h i t o t r i o s e > > N , N'-D i a c e t y l c h i t o b i o s e Galactose/lactose Group Bauhinia purpurea a g g l u t i n i n Erythrina corallodendron a g g l u t i n i n B P A E C A N - A c e t y l g a l a c t o s a m i n e > D ( + ) - G a l a c t o s e N - A c e t y l l a c t o s a m i n e > a - l a c t o s e Fucose Group Tetragonolobus purpurea a g g l u t i n i n T P A L ( - ) - F u c o s e "Binding specificity and relative affinity to specific sugars are indicated in the order of greatest to least. bfrom Canavalia ensiformis °from Triticum vulgaris 6.2 Results 6.2.1 Concanavalin A-FITC binds to Olpidium zoospores. C o n c a n a v a l i n A - F I T C f r o m Canavalia ensiformis ( j a c k b e a n ) ( C o n A - F I T C ) , w h i c h r e c o g n i z e s D ( + ) - m a n n o s e ( T a b l e 6.1), b o u n d t o t h e z o o s p o r e s o f b o t h O. bornovanus a n d O. brassicae ( F i g u r e 6.1 B - D a n d F i g u r e 6.2 B ). C o n A - F I T C w a s a d d e d i n c o n c e n t r a t i o n s o f 1, 16, a n d 1 2 0 p.g/ml t o z o o s p o r e s u s p e n s i o n s . C o r i A - F I T C b o u n d d e n s e l y a n d u n i f o r m l y o v e r t h e s u r f a c e o f t h e z o o s p o r e b o d y a n d f l a g e l l u m o f z o o s p o r e s o f b o t h Olpidium spp. w h e n as l i t t l e as 16 p.g/ml o f C o n A - F I T C w a s a d d e d ( F i g u r e s 6.1 a n d 6.2). W h e n 1 2 0 p g / m l C o n A - F I T C w a s a d d e d , a h i g h l y f l u o r e s c e n t 1 15 b a c k g r o u n d w a s o b s e r v e d ( n o t s h o w n ) . F a i n t f l u o r e s c e n c e o f z o o s p o r e s w a s o b s e r v e d w i t h t h e a d d i t i o n o f 1 | i g / m l o f C o n A - F I T C t o t h e z o o s p o r e s u s p e n s i o n ( n o t s h o w n ) . T h e a d d i t i o n o f 16 p g / m l o f C o n A - F I T C p r o d u c e d s t r o n g f l u o r e s c e n c e o f a l l o b s e r v a b l e z o o s p o r e s w i t h m i n i m a l b a c k g r o u n d a n d s o t h e s e c o n d i t i o n s w e r e u s e d i n a l l f u r t h e r e x p e r i m e n t s u s i n g C o n A - F I T C , u n l e s s o t h e r w i s e s p e c i f i e d . T h e p r e s e n c e o f C o n A -F I T C i n t h e O. bornovanus z o o s p o r e s u s p e n s i o n s o m e t i m e s c a u s e d t h e l o s s o f z o o s p o r e m o t i l i t y a n d t h e f o r m a t i o n o f l a r g e a g g r e g a t e s o f z o o s p o r e s ( F i g u r e 6.1 D ) , a l t h o u g h i n s o m e e x p e r m e n t s z o o s p o r e s m a i n t a i n e d t h e i r m o t i l i t y ( F i g u r e s 6.1 C a n d 6.2 B ) . N o n e o f t h e f u n g a l s t r u c t u r e s s h o w e d a u t o f l u o r e s c e n c e ( n o t s h o w n ) . D ( + ) - m a n n o s e , at c o n c e n t r a t i o n s o f 1, 2 0 a n d 1 0 0 mg/ml, w a s a d d e d t o 16 p.g/ml C o n A - F I T C f o r 3 0 m i n u t e s i n t h e d a r k b e f o r e t h e a d d i t i o n o f z o o s p o r e s t o d e t e r m i n e i f t h e b i n d i n g o f C o n - F I T C t o Olpidium z o o s p o r e s w a s s p e c i f i c . T h e a d d i t i o n o f 2 0 m g / m l D ( + ) - m a n n o s e s l i g h t l y r e d u c e d t h e f l u o r e s c e n c e o f t h e z o o s p o r e s a n d e l i m i n a t e d t h e f o r m a t i o n o f a g g r e g a t e s ( n o t s h o w n ) a n d t h e a d d i t i o n o f 1 0 0 m g / m l D ( + ) - m a n n o s e u s u a l l y e l i m i n a t e d m o s t o f t h e b i n d i n g o f C o n A - F I T C t o t h e z o o s p o r e s o f b o t h s p e c i e s o f Olpidium ( F i g u r e s 6.1 E a n d F, 6.2 C a n d D ) . W i t h t h e a d d i t i o n o f 1 0 0 m g / m l o f D ( + ) -m a n n o s e t h e z o o s p o r e s m a i n t a i n e d t h e i r m o t i l i t y . S o m e t i m e s f a i n t f l u o r e s c e n c e o f O. bornovanus b u t n o t O. brassicae z o o s p o r e s w a s o b s e r v e d w i t h t h e a d d i t i o n o f 1 0 0 m g / m l o f t h e D ( + ) - m a n n o s e c o m p e t i t o r , i n d i c a t i n g t h a t s o m e C o n A - F I T C w a s s t i l l a v a i l a b l e f o r b i n d i n g ( F i g u r e 6.1 F ) . 1 1 6 6.2.2 Triticum vulgaris lectin-FITC does not bind to secondary zoospores of Olpidium but does bind to to primary zoospores of Olpidium. Triticum vulgaris ( w h e a t g e r m ) l e c t i n - F I T C ( W G A - F I T C ) , w h i c h r e c o g n i z e s c h i t i n ( N , N ' , N ' - t r i a c e t y l c h i t o t r i o s e ) ( T a b l e 4 ) , d i d n o t b i n d t o s e c o n d a r y z o o s p o r e s o f Olpidium spp. b u t d i d b i n d t o w h a t a p p e a r t o b e r e s t i n g s p o r e s o f O. bornovanus a n d O. brassicae ( F i g u r e 6.3 A - D ; T a b l e 6.2). Z o o s p o r e s r e m a i n e d m o t i l e a n d d i d n o t f l u o r e s c e w i t h t h e a d d i t i o n o f 125 ixg/ml W G A - F I T C ( F i g u r e 6.3 A a n d B ) . A f t e r t h e a d d i t i o n o f 125 u.g/ml W G A - F I T C , r o o t s w e r e o b s e r v e d w h i c h c o n t a i n e d r o u n d f l u o r e s c e n t b o d i e s w i t h t h i c k w a l l s a n d n o f l a g e l l a w h i c h w e r e d e t e r m i n e d t o b e r e s t i n g s p o r e s o f O. bornovanus a n d O. brassicae ( F i g u r e 6.3 B a n d 6.3 D ) . C o m p e t i t i o n e x p e r i m e n t s u s i n g c h i t i n w e r e n o t p e r f o r m e d . 1 17 F i g u r e 6.1 Binding of Con A - F I T C to 0. bornovanus zoospores (A) Photograph of a differential interference contrast (DIC) image of aggregated and free (). bornovanus zoospores after treatment with 16 ug/ml Con A - F I T C (B) Fluorescence image of A showing zoospores treated with Con A - F I T C (C) Fluorescence image of individual (). bornovanus zoospores after treatment with 16 Ug /ml Con A - F I T C (D) Fluorescence image of a large aggregate of (). bornovanus zoospores after treatment with 16 Ug /ml Con A - F I T C (E) DIC image of 0. bornovanus zoospores after the addition of 16 ug/ml Con A - F I T C pre-incubated with 100 mg/ml D(+)-mannose (F) Fluorescence image of E The photographs in B and F were exposed for equivalent times Images were observed using a Zeiss AxioPhot with DIC and epifluorescence optics Zeiss filter set 487910 (excitation 450 to 490 nm) was used 118 F i g u r e 6.2 B i n d i n g o f C o n A - F I T C to (). brassicae zoospores ( A ) Photograph o f D I C image o f free (). brassicae zoospores after addit ion o f 16 p g / m l C o n A - F I T C (B) Fluorescence image o f A (C) D I C image o f O. brassicae zoospores after addit ion o f 16 ug /ml C o n A - F I T C pre-incubated wi th 100 m g / m l D(+)-mannose (D) Fluorescence image o f C The photographs in B and D were exposed for equivalent times See Figure 6 1 for details o f microscopy 119 F i g u r e 6.3 B i n d i n g o f W G A - F I T C t o O. bornovanus a n d (). brassicae r e s t i n g s p o r e s . ( A ) P h o t o g r a p h o f D I C i m a g e o f 0. bornovanus z o o s p o r e s a n d r e s t i n g s p o r e s i n c u c u m b e r r o o t s a f t e r t h e a d d i t i o n o f 125 u g / m l W G A - F I T C . ( B ) F l u o r e s c e n c e i m a g e o f A . ( C ) P h o t o g r a p h o f D I C i m a g e o f l e t t u c e r o o t c o n t a i n i n g O. brassicae r e s t i n g s p o r e s a f t e r a d d i t i o n o f 1 2 5 p g / m l W G A - F I T C . D. F l u o r e s c e n c e i m a g e o f C . S e e F i g u r e 6.1 f o r d e t a i l s o f m i c r o s c o p y . F i g u r e 6.4 B i n d i n g o f B P A - F I T C t o 0. brassicae z o o s p o r e s . ( A ) P h o t o g r a p h o f a D I C i m a g e o f (). brassicae z o o s p o r e s a f t e r a d d i t i o n o f 125 |Jg/ml B P A - F I T C . ( B ) F l u o r e s c e n c e i m a g e o f A . ( C ) P h o t o g r a p h o f D I C i m a g e o f z o o s p o r e s o f (). brassicae a f t e r a d d i t i o n o f 1 2 5 p g / m l B P A - F I T C p r e - i n c u b a t e d w i t h 100 m g / m l D ( + ) -g a l a c t o s e . ( D ) F l u o r e s c e n c e i m a g e o f C . ( E ) P h o t o g r a p h o f D I C i m a g e o f 0. bornovanus z o o s p o r e s a f t e r a d d i t i o n o f 125 ( i g / m l B P A - F I T C . ( F ) F l u o r e s c e n t i m a g e o f E . T h e p h o t o g r a p h s i n B, D, a n d F w e r e e x p o s e d f o r e q u i v a l e n t t i m e s . S e e F i g u r e 6.1 f o r d e t a i l s o f m i c r o s c o p y . 121 F i g u r e 6.5 E C A - F I T C does not b ind to 0. bornovanus or (). brassicae zoospores ( A ) Photograph o f D I C image o f 0. bornovanus zoospores after the addit ion o f 125 ( lg/ml E C A - F I T C (B) Fluorescence image o f A (C) Photograph o f D I C image o f (). brassicae zoospores after addit ion o f 125 ug /ml E C A - F I T C (D) Fluorescence image o f C See Figure 6 1 for details o f microscopy 122 F i g u r e 6.6 Binding of TPA-FITC to (). bornovanus and (). brassicae zoospores (A) Photograph of a DIC image of free I), brassicae zoospores after addition of 125 ug/ml TPA-FITC (B) Fluorescence image of A (C) Photograph of fluorescent image of free and aggregated (). bornovanus secondary zoospores after addition of 125 ug/ml TPA-FITC (DIC image not available) See Figure 6 1 for details of microscoy 123 Table 6.2 B i n d i n g o f F I T C - l e c t i n c o n j u g a t e s t o Olpidium z o o s p o r e s in vitro a. O. bornovanus O. brassicae Lectin Resting spores Zoospores Resting spores Zoospores C o n A - + - + W G A + - + B P A + E C A . . . . T P A + - + "Fluorescent labelling is shown as follows: (+) labelled, (-) unlabelled. 6.2.3 Bauhinia purpurea lectin-FITC binds to O. brassicae but not O. bornovanus zoospores. Bauhinia purpurea ( c a m e l s f o o t tree) l e c t i n - F I T C ( B P A - F I T C ) , w h i c h b i n d s t o D ( + ) - g a l a c t o s e ( T a b l e 6.1), b o u n d u n i f o r m l y o v e r t h e s u r f a c e o f w a s h e d O. brassicae b u t n o t t o w a s h e d O. bornovanus z o o s p o r e s w h e n u s e d at a c o n c e n t r a t i o n o f 125 p.g/ml ( F i g u r e 6.4 A , B , E , a n d F; T a b l e 6.2). B P A - F I T C b i n d i n g d i d n o t a l t e r O. brassicae z o o s p o r e m o t i l i t y o r c a u s e a g g r e g a t i o n o f z o o s p o r e s . D ( + ) - g a l a c t o s e at 1 0 0 m g / m l w a s a d d e d t o 125 u.g/ml B P A - F I T C a n d a l l o w e d t o i n c u b a t e f o r 3 0 m i n i n t h e d a r k b e f o r e t h e a d d i t i o n o f O. brassicae z o o s p o r e s t o d e t e r m i n e i f t h e b i n d i n g o f B P A - F I T C w a s s p e c i f i c . A l l O. brassicae z o o s p o r e s r e m a i n e d i n t a c t a n d m o t i l e a f t e r t r e a t m e n t w i t h t h e l e c t i n -s u g a r s o l u t i o n . N o b i n d i n g o f B P A - F I T C w a s o b s e r v e d t o O. brassicae z o o s p o r e s a f t e r t h e p r e - i n c u b a t i o n o f l e c t i n w i t h D ( + ) - g a l a c t o s e ( F i g u r e 6.4 C a n d D ) . 124 6.2.4 Erythrina corallodendron lectin-FITC does not bind Olpidium zoospores. E r y t h r i n a c o r a l l o d e n d r o n ( c o r a l t r e e ) l e c t i n - F I T C ( E C A - F I T C ) , w h i c h b i n d s Ga-l a c t o s e ( T a b l e 6.1), d i d n o t b i n d t o e i t h e r O. bornovanus o r O. brassicae z o o s p o r e s ( F i g u r e 6.5 A - D ; T a b l e 6.2). Z o o s p o r e s w e r e e i t h e r w a s h e d o r u n w a s h e d w i t h n o b i n d i n g o b s e r v e d w i t h as m u c h as 8 0 u g / m l o f E C A - F I T C . Z o o s p o r e s r e m a i n e d m o t i l e a n d d i d n o t a g g r e g a t e i n t h e p r e s e n c e o f E C A - F I T C . 6.2.5 Tetragonolobus purpureas lectin-FITC binds to Olpidium zoospores. Tetragonolobus purpureas ( w i n g e d p e a ) l e c t i n - F I T C ( T P A - F I T C ) , w h i c h r e c o g n i z e s L ( - ) - f u c o s e ( T a b l e 6.1), b o u n d t o z o o s p o r e s o f O. bornovanus a n d O. brassicae ( F i g u r e 6.6 A - C ; T a b l e 6.2). B i n d i n g d i d n o t o c c u r u n l e s s t h e z o o s p o r e s w e r e w a s h e d b e f o r e t h e a d d i t i o n o f t h e l e c t i n . F l u o r e s c e n c e w a s u n i f o r m o v e r t h e z o o s p o r e b o d y a n d f l a g e l l u m ( F i g u r e 6.6 B a n d D ) . T h e a d d i t i o n o f T P A - F I T C t o O. bornovanus z o o s p o r e s c a u s e d t h e m t o l o s e t h e i r m o t i l i t y a n d t o a g g r e g a t e ( F i g u r e 6.6 C ) . T h e m a j o r i t y o f O. bornovanus z o o s p o r e s f o r m e d t h e s e l a r g e f l u o r e s c e n t a g g r e g a t e s , m a k i n g i t d i f f i c u l t t o l o c a t e i n d i v i d u a l z o o s p o r e s , a l t h o u g h t h e o c c a s i o n a l f r e e f l u o r e s c e n t z o o s p o r e c o u l d b e o b s e r v e d ( F i g u r e 6.6 C ) . I n t h e l a r g e a g g r e g a t e s o f z o o s p o r e s , s o m e o f t h e o u t e r z o o s p o r e s w e r e n o t f l u o r e s c i n g as b r i g h t l y as t h e c e n t r a l l y l o c a t e d z o o s p o r e s ( F i g u r e 6.6 C ) . T h e i n d i v i d u a l z o o s p o r e s o b s e r v e d w e r e f l u o r e s c i n g u n i f o r m l y o v e r t h e b o d y a n d f l a g e l l u m ( F i g u r e 6.6 B a n d 6.6 C ) . O. brassicae z o o s p o r e s l o s t m o t i l i t y w i t h t h e a d d i t i o n o f T P A - F I T C b u t n o f l u o r e s c e n t a g g r e g a t e s o f z o o s p o r e s w e r e o b s e r v e d ( F i g u r e 6.6 B ) . C o m p e t i t i o n b e t w e e n L ( - ) - f u c o s e a n d T P A - F I T C f o r b i n d i n g t o Olpidium z o o s p o r e s w a s n o t p e r f o r m e d . 1 25 6.2.6 D i s c u s s i o n T h e p r e s e n t s t u d y w a s u n d e r t a k e n t o a s s e s s t h e n a t u r e o f s u g a r s o n t h e s u r f a c e o f O. bornovanus a n d O. brassicae z o o s p o r e s . F i v e F I T C - l a b e l l e d l e c t i n s w i t h d i f f e r e n t c a r b o h y d r a t e b i n d i n g a f f i n i t i e s w e r e u s e d i n c o n j u n c t i o n w i t h e p i f l u o r e s c e n c e m i c r o s c o p y . T h e r e s u l t s o f t h e s e b i n d i n g s t u d i e s s u g g e s t t h a t t h e s u r f a c e o f b o t h O. bornovanus a n d O. brassicae z o o s p o r e s c o n t a i n D ( + ) - m a n n o s e a n d / o r D ( + ) - g l u c o s e a n d L ( - ) - f u c o s e - c o n t a i n i n g o l i g o s a c c h a r i d e s . D ( + ) - g a l a c t o s e a p p e a r s t o b e o n t h e s u r f a c e o f O. brassicae s e c o n d a r y z o o s p o r e s b u t n o t o n t h e s u r f a c e o f O. bornovanus z o o s p o r e s . C h i t i n c o v e r s t h e s u r f a c e s o f r e s t i n g s p o r e s o f b o t h Olpidium s p e c i e s . W a s h i n g o f t h e z o o s p o r e s u s p e n s i o n b e f o r e t h e a d d i t i o n o f F I T C - l a b e l l e d l e c t i n s ( e x c e p t f o r C o n A - F I T C ) f a c i l i t a t e d b i n d i n g . B i n d i n g o f C o n A - F I T C t o Olpidium z o o s p o r e s o c c u r r e d t o s i m i l a r l e v e l s w i t h o r w i t h o u t p r e v i o u s w a s h i n g o f t h e z o o s p o r e s . I n i t i a l l y , w i t h o u t p r e v i o u s w a s h i n g o f t h e z o o s p o r e s , o n l y d e b r i s w a s o b s e r v e d f l u o r e s c i n g w i t h t h e a d d i t i o n o f a l l l e c t i n s ( e x c e p t f o r C o n A - F I T C ) . A f t e r i n c l u d i n g t h e i n i t i a l z o o s p o r e - w a s h i n g step, s t r o n g f l u o r e s c e n c e w a s o b s e r v e d f o r T P A - F I T C b i n d i n g o f O. bornovanus z o o s p o r e s a n d s t r o n g f l u o r e s c e n c e f o r T P A - F I T C a n d B P A - F I T C b i n d i n g o f O. brassicae z o o s p o r e s . W i t h t h e a d d i t i o n o f t h i s i n i t i a l w a s h i n g step, b a c k g r o u n d f l u o r e s c e n c e w a s r e d u c e d . It i s p o s s i b l e t h a t w a s h i n g r e m o v e d s u b s t a n c e s f r o m t h e z o o s p o r e s o l u t i o n w h i c h s e q u e s t e r e d t h e F I T C - l e c t i n s , m a k i n g t h e m u n a v a i l a b l e f o r b i n d i n g t o t h e z o o s p o r e s u r f a c e . T h e s e i n h i b i t o r s m a y h a v e s l o u g h e d o f f o f t h e z o o s p o r e s u r f a c e o r t h e y m a y h a v e b e e n r e l e a s e d f r o m t h e m a t u r e t h a l l u s c o n c u r r e n t l y w i t h z o o s p o r e r e l e a s e f r o m r o o t c e l l s . It i s p o s s i b l e t h a t t h e i n h i b i t o r s w e r e c a r b o h y d r a t e s o r t h e y c o u l d a l s o b e n o n - s p e c i f i c i n h i b i t o r s o f u n k n o w n b i o c h e m i c a l o r i g i n . 1 2 6 T w o F I T C - l e c t i n s b o u n d t o z o o s p o r e s o f b o t h s p e c i e s o f Olpidium, C o n A - F I T C , a n d T P A - F I T C . C o n A - F I T C b i n d s D ( + ) - m a n n o s e , a n d D ( + ) - g l u c o s e w i t h l o w e r a f f i n i t y , s o i t i s l i k e l y t h a t t h e r e a r e m a n n o s e a n d / o r g l u c o s e - c o n t a i n i n g o l i g o s a c c h a r i d e s o n t h e s u r f a c e s o f z o o s p o r e s o f b o t h O. bornovanus a n d O. brassicae. D ( + ) - m a n n o s e at 1 0 0 m g / m l w a s a b l e t o c o m p e t i t i v e l y i n h i b i t t h e b i n d i n g o f C o n A - F I T C t o t h e z o o s p o r e s o f b o t h Olpidium s p e c i e s , i n d i c a t i n g t h a t C o n A b i n d i n g i s s p e c i f i c . A l t h o u g h D ( + ) - m a n n o s e i s a b l e t o c o m p e t i t i v e l y i n h i b i t C o n A - F I T C b i n d i n g t o Olpidium s e o n d a r y z o o s p o r e s , t h i s d o e s n o t p r o v e t h a t D ( + ) - m a n n o s e i s t h e z o o s p o r e s u g a r w h i c h i s r e c o g n i z e d b y C o n A -F I T C . T h e p o s s i b i l i t y t h a t C o n A - F I T C i s b i n d i n g t o o t h e r c e l l s u r f a c e c o m p o n e n t s c a n n o t b e e x c l u d e d . T h e b i n d i n g o f T P A - F I T C , w h i c h b i n d s L ( - ) - f u c o s e w i t h h i g h a f f i n i t y , t o t h e z o o s p o r e s o f b o t h s p e c i e s o f Olpidium s u g g e s t s t h a t L ( - ) - f u c o s e i s a l s o o n t h e s u r f a c e o f t h e s e f u n g i . It w i l l b e n e c e s s a r y t o a d d L ( - ) - f u c o s e t o T P A - F I T C p r i o r t o z o o s p o r e b i n d i n g t o d e t e r m i n e i f t h i s b i n d i n g i s s p e c i f i c . B P A - F I T C d i d n o t b i n d t o O. bornovanus z o o s p o r e s b u t d i d b i n d t o O. brassicae z o o s p o r e s . B P A r e c o g n i z e s N - a c e t y l g a l a c t o s a m i n e a n d D ( + ) - g a l a c t o s e a n d s o i t i s l i k e l y t h a t o n e o f t h e s e s u g a r s i s o n t h e s u r f a c e o f O. brassicae ( b u t n o t o n O. bornovanus z o o s p o r e s ) . T h e a d d i t i o n o f D ( + ) - g a l a c t o s e t o B P A - F I T C p r i o r t o a d d i t i o n o f t h e O. brassicae z o o s p o r e s u s p e n s i o n i n d i c a t e d t h a t b i n d i n g w a s s p e c i f i c . P r e l i m i n a r y c o m p e t i t i o n b i n d i n g a s s a y s , w i t h t h e a d d i t i o n o f 1 0 0 m g / m l D ( + ) - g a l a c t o s e t o T N V f o r 6 0 m i n b e f o r e t h e a d d i t i o n o f t h e O. brassicae z o o s p o r e s u s p e n s i o n i n t h e b i n d i n g a s s a y s h o w e d a s i g n i f i c a n t r e d u c t i o n i n T N V b i n d i n g t o O. brassicae ( M . R o b b i n s , u n p u b l i s h e d o b s e r v a t i o n ) . A l t h o u g h f u r t h e r w o r k i s s t i l l r e q u i r e d , t h e s e d a t a s u g g e s t t h a t D ( + ) -g a l a c t o s e i s a c o m p o n e n t o f a p u t a t i v e z o o s p o r e r e c e p t o r f o r T N V a t t a c h m e n t . 127 W G A - F I T C d i d n o t b i n d t o z o o s p o r e s o f O. bornovanus o r O. brassicae b u t d i d b i n d t o w h a t a p p e a r s t o b e r e s t i n g s p o r e s o f b o t h s p e c i e s o f Olpidium w i t h i n t h e r o o t s . T h e b i n d i n g o f W G A , w h i c h b i n d s c h i t i n ( N , N ' , N ' - t r i a c e t y l c h i t o t r i o s e a n d N , N'-d i a c e t y l c h i t o b i o s e ) , i n d i c a t e s t h a t t h e r e i s c h i t i n o n t h e s u r f a c e o f Olpidium r e s t i n g s p o r e s . C e l l w a l l s o f f u n g i u s u a l l y c o n t a i n m i c r o f i b r i l l a r c h i t i n ( S e l i t r e n n i k o f f et al., 1 9 8 0 ) . T h e r e s t i n g s p o r e s o f Olpidium a r e t h e f u n g a l s t r u c t u r e s w h i c h m u s t s u r v i v e i n s o i l i n t h e a b s e n c e o f a p p r o p r i a t e c o n d i t i o n s f o r g r o w t h . O n e r o l e o f t h e c e l l w a l l i s p r o t e c t i o n o f t h e f u n g u s f r o m o t h e r m i c r o b e s s u c h as b a c t e r i a ( P o w e l l , 1 9 9 4 ) . E C A - F I T C d i d n o t b i n d t o z o o s p o r e s o f O. bornovanus o r O. brassicae. E C A -F I T C b i n d s t o N - a c e t y l l a c t o s a m i n e a n d oc-lactose, i n d i c a t i n g t h a t n e i t h e r o f t h e s e s u g a r s a r e o n t h e s u r f a c e s o f Olpidium z o o s p o r e s . A d i f f e r e n t i a l e x p r e s s i o n o f s u g a r s b e t w e e n O. bornovanus a n d O. brassicae m a y h e l p t o e x p l a i n t h e d i f f e r e n t i a l a b i l i t i e s t o b i n d a n d t r a n s m i t s e v e r a l s o i l - t r a n s m i t t e d v i r u s e s . S t u d i e s o f z o o s p o r e s o f C h y t r i d i o m y c e t e r u m e n f u n g i u s i n g l e c t i n p r o b e s i n d i c a t e d t h a t t h e l e c t i n b i n d i n g p a t t e r n f o r d i f f e r e n t i s o l a t e s o f t h e s a m e g e n u s v a r i e d ( G u i l l o t et al., 1 9 9 0 ) . T h e s e r e s u l t s s u g g e s t e d t h a t c e l l c o a t s o f r u m e n f u n g a l z o o s p o r e s v a r y i n c o m p o s i t i o n , p e r h a p s e n a b l i n g t h e m t o a d a p t t o d i f f e r e n c e s i n t h e r u m e n e n v i r o n m e n t ( P o w e l l , 1 9 9 4 ) . G l y c o p r o t e i n s at t h e c e l l s u r f a c e o f o t h e r c h y t r i d z o o s p o r e s b i n d l e c t i n s a n d m a y s e r v e as p o t e n t i a l s i t e s t r i g g e r i n g e n c y s t m e n t o r i n r e c o g n i t i o n o f e n v i r o n m e n t a l c u e s ( D a l l e y a n d S o n n e b o r n , 1982; J e n a n d H a u g , 1 9 7 9 ) . T h i s w o r k h a s s h o w n t h a t s u g a r s a r e l o c a t e d o n t h e s u r f a c e s o f O. bornovanus a n d O. brassicae z o o s p o r e s , i n c l u d i n g D ( + ) - m a n n o s e a n d / o r D ( + ) - g l u c o s e a n d L ( - ) - f u c o s e . T h e s e s u g a r s a r e l i k e l y p r e s e n t as o l i g o s a c c h a r i d e s c o v a l e n t l y l i n k e d t o p r o t e i n s 128 ( g l y c o p r o t e i n s ) o r l i p i d s ( g l y c o l i p i d s ) . I n t h e f u t u r e , e x a m i n a t i o n o f t h e b i n d i n g o f o t h e r F I T C - l e c t i n s t o Olpidium z o o s p o r e s m a y p r o v i d e f u r t h e r i n f o r m a t i o n a b o u t s u g a r s l o c a t e d o n t h e s u r f a c e o f t h e s e f u n g i . T h e i d e n t i f i c a t i o n o f a d i f f e r e n t i a l e x p r e s s i o n o f s u g a r s b e t w e e n O. bornovanus a n d O. brassicae, w h e r e N - a c e t y l g a l a c t o s a m i n e a n d / o r D ( + ) -g a l a c t o s e a p p e a r t o b e l o c a t e d o n t h e s u r f a c e o f O. brassicae b u t n o t o n O. bornovanus, i s i n t e r e s t i n g i n l i g h t o f t h e d i f f e r e n t i a l b i n d i n g o f t h e s e f u n g i t o v i r u s e s w h i c h t h e y t r a n s m i t . It i s h o p e d t h a t t h e r e s e a r c h d e s c r i b e d i n t h i s c h a p t e r w i l l c o n t r i b u t e t o t h e i d e n t i f i c a t i o n o f a s p e c i f i c r e c e c p t o r s i t e f o r v i r u s e s o n t h e s u r f a c e o f Olpidium z o o s p o r e s . 1 2 9 7 C H A P T E R S E V E N : G E N E R A L D I S C U S S I O N I n t h i s t h e s i s t h e i n t e r a c t i o n b e t w e e n a p l a n t v i r u s , C N V , a n d i t s f u n g a l v e c t o r , O. bornovanus, w a s e x a m i n e d at t h e m o l e c u l a r l e v e l t o d e t e r m i n e i f t h e r e a r e s p e c i f i c s e q u e n c e s a n d / o r s t r u c t u r e s a s s o c i a t e d w i t h v i r u s p a r t i c l e s a n d / o r f u n g a l z o o s p o r e s m e d i a t i n g t r a n s m i s s i o n . A t t h e start o f t h i s t h e s i s , t h e f i r s t g o a l w a s t o d e t e r m i n e i f s p e c i f i c s e q u e n c e s a n d / o r s t r u c t u r e s o f t h e C N V C P w e r e i n v o l v e d i n t r a n s m i s s i o n s p e c i f i c i t y . P r e v i o u s w o r k i n o u r l a b o r a t o r y s h o w e d tha t t h e C N V C P i s r e s p o n s i b l e f o r t h e s p e c i f i c i t y o f C N V t r a n s m i s s i o n b y z o o s p o r e s o f O. bornovanus ( M c L e a n et al., 1 9 9 4 ) . V i r u s e s w i t h m u t a t i o n s i n t h e i r C P g e n e s w i t h a l t e r e d t r a n s m i s s i b i l i t y w e r e r e q u i r e d t o f u r t h e r d e l i n e a t e r e g i o n s o f t h e C N V C P i n v o l v e d i n t r a n s m i s s i o n s p e c i f i c i t y . N o C N V v a r i a n t s h a d y e t b e e n i d e n t i f i e d w i t h a r e d u c e d a b i l i t y t o b e t r a n s m i t t e d b y O. bornovanus. T o i d e n t i f y s u c h t r a n s m i s s i o n m u t a n t s , a p o p u l a t i o n o f C N V w h i c h h a d b e e n m e c h a n i c a l l y p a s s a g e d f o r 13 g e n e r a t i o n s i n t h e a b s e n c e o f i t s f u n g a l v e c t o r ( R o c h o n , 1 9 9 1 ) w a s i n o c u l a t e d o n t o a l o c a l l e s i o n h o s t a n d i n d i v i d u a l l o c a l l e s i o n s e x a m i n e d f o r t h e i r a b i l i t y t o b e t r a n s m i t t e d b y z o o s p o r e s o f O. bornovanus ( C h a p t e r 3). S e v e r a l n a t u r a l v a r i a n t s o f C N V w e r e i d e n t i f i e d w h i c h w e r e i n e f f i c i e n t l y t r a n s m i t t e d b y O. bornovanus ( 0 - 2 0 % o f w i l d - t y p e C N V ) . T h e C N V t r a n s m i s s i o n m u t a n t s w e r e c h a r a c t e r i z e d at t h e m o l e c u l a r l e v e l t o a s s e s s t h e b a s i s f o r t h e i r r e d u c e d t r a n s m i s s i b i l i t y . A r e d u c t i o n i n t r a n s m i s s i o n c o u l d b e t h e r e s u l t o f p r o b l e m s i n a n y o f s e v e r a l a s p e c t s o f t h e v i r a l l i f e - c y c l e i n c l u d i n g r e d u c e d r e p l i c a t i o n , l o w e r p a r t i c l e s t a b i l i t y , o r i n e f f i c i e n t a t t a c h m e n t t o p u t a t i v e r e c e p t o r 1 3 0 m o l e c u l e s a s s o c i a t e d w i t h t h e v e c t o r . It w a s h y p o t h e s i z e d t h a t s o m e v i r a l v a r i a n t s w o u l d b e i d e n t i f i e d w h i c h h a d l o s t t h e i r a b i l i t y t o a t t a c h t o t h e f u n g a l v e c t o r . T h e s e a t t a c h m e n t -d e f i c i e n t v a r i a n t s c o u l d b e a n a l y z e d t o d e t e r m i n e s e q u e n c e s a n d / o r s t r u c t u r e s d i f f e r i n g f r o m w i l d - t y p e i n t h e h o p e s o f i d e n t i f y i n g v i r a l a t t a c h m e n t s i t e s o n t h e p a r t i c l e s u r f a c e . It w a s f o u n d t h a t s o m e C N V m u t a n t s r e p l i c a t e d p o o r l y as a r e s u l t o f t h e p r e s e n c e o f D I R N A s a n d o t h e r s w e r e m i s s i n g t h e C P c o d i n g r e g i o n f r o m t h e i r g R N A ( C h a p t e r 3). O t h e r m u t a n t s l i k e l y h a d m u t a t i o n s w i t h i n t h e i r C P g e n e s as t h e s e v i r u s e s d i d n o t p r o d u c e C P d e s p i t e c o n t a i n i n g w i l d - t y p e l e n g t h g R N A . O n e m u t a n t , L L 5 , h a d s t a b l e p a r t i c l e s a n d r e p l i c a t e d t o w i l d - t y p e l e v e l s i n p l a n t s . It w a s h y p o t h e s i z e d t h a t L L 5 h a d o n e o r m o r e m u t a t i o n s i n i t s C P p r e v e n t i n g v i r i o n s f r o m a t t a c h i n g t o t h e z o o s p o r e s u r f a c e . O n e p r o b l e m w i t h t h i s n e g a t i v e s e l e c t i o n s t r a t e g y f o r o b t a i n i n g v i r a l m u t a n t s i s t h a t r e a s o n s f o r t h e p h e n o t y p e o t h e r t h a n t h o s e w h i c h ar e s o u g h t m u s t b e e l i m i n a t e d b y c a r e f u l e x a m i n a t i o n o f s e v e r a l c h a r a c t e r i s t i c s o f t h e m u t a n t . L L 5 w a s f u r t h e r c h a r a c t e r i z e d b y c l o n i n g a n d s e q u e n c i n g o f i t s C P g e n e t o d e t e r m i n e i f t h e r e w e r e d i f f e r e n c e s b e t w e e n i t s C P a n d tha t o f w i l d - t y p e C N V . T h e C P g e n e o f L L 5 c o n t a i n e d t w o s i n g l e n u c l e o t i d e s u b s t i t u t i o n s ; o n e , i n t h e s h e l l d o m a i n w h i c h p r o d u c e d a n a m i n o a c i d s u b s t i t u t i o n o f G l u t o L y s , a n d a s e c o n d i n t h e a r m w h i c h c h a n g e d a P h e t o C y s ( C h a p t e r 3). T h e L L 5 C P g e n e w a s c l o n e d i n t o t h e C N V c D N A c l o n e a n d i t w a s d e t e r m i n e d t h a t t h e L L 5 C P i s r e s p o n s i b l e f o r r e d u c e d t r a n s m i s s i o n . S i t e - d i r e c t e d m u t a g e n e s i s t o p r o d u c e t h e t w o n u c l e o t i d e s u b s t i t u t i o n s i n d i v i d u a l l y i n s e p a r a t e C N V c D N A c l o n e s i n d i c a t e d t h a t i t w a s t h e G l u t o L y s c h a n g e i n t h e L L 5 C P s h e l l d o m a i n w h i c h w a s r e s p o n s i b l e f o r i t s r e d u c e d t r a n s m i s s i b i l i t y ( C h a p t e r 3). I n t e r e s t i n g l y , t h e L L 5 G l u t o L y s c h a n g e i s i m m e d i a t e l y a d j a c e n t t o a n a s p a r t i c a c i d 131 r e s i d u e k n o w n t o m e d i a t e s u b u n i t - s u b u n i t c o n t a c t s i n t h e v i r u s p a r t i c l e b y b i n d i n g C a + + . It i s p o s s i b l e t h a t t h e G l u t o L y s m u t a t i o n i n t h e L L 5 s h e l l d o m a i n c a u s e d a d e s t a b i l i z a t i o n o f t h e p a r t i c l e s o t h a t t h e A s p r e s i d u e s c o u l d n o t b i n d C a + + , t h e r e b y c a u s i n g s w e l l i n g o f t h e p a r t i c l e a n d a r e d u c e d a b i l i t y t o b i n d t o t h e z o o s p o r e s u r f a c e d u e t o a l o s s o f t h e v i r a l a t t a c h m e n t s i t e . A l t e r n a t i v e l y , t h e c h a r g e c h a n g e r e s u l t a n t f r o m t h e G l u t o L y s c h a n g e c o u l d h a v e e l i m i n a t e d t h e a b i l i t y o f a p u t a t i v e r e c e p t o r m o l e c u l e o n t h e z o o s p o r e s u r f a c e t o b i n d t o t h e v i r a l a t t a c h m e n t s i t e . A s l o w e r m i g r a t i o n w a s o b s e r v e d f o r L L 5 p a r t i c l e s , w h i c h w o u l d r e s u l t f r o m a c h a r g e c h a n g e a n d c o u l d a l s o b e a f f e c t e d b y s w e l l i n g ( C h a p t e r 3). I n t h e f u t u r e , e x p e r i m e n t s t o e x a m i n e t h e s e d i m e n t a t i o n c o e f f i c i e n t s o f C N V a n d L L 5 s h o u l d b e a b l e t o d e t e r m i n e i f p a r t i c l e s h a v e a n a l t e r e d c o n f o r m a t i o n . T h e m e t h o d o l o g y d e v e l o p e d f o r t h e c h a r a c t e r i z a t i o n o f L L 5 w i l l b e u s e f u l i n t h e f u t u r e t o e x a m i n e m o r e l o c a l l e s i o n s f r o m t h i s p a s s a g e d p o p u l a t i o n o f C N V t o f u r t h e r i d e n t i f y r e g i o n s o f t h e C N V C P i n v o l v e d i n t r a n s m i s s i o n a n d a l s o t o d e t e r m i n e t h e f r e q u e n c y o f t h e t y p e s o f m u t a n t s i d e n t i f i e d i n t h i s s t u d y . S u c h s t u d i e s a r e i n f a c t u n d e r w a y ( K . K a k a n i a n d D. R o c h o n ) a n d s i x a d d i t i o n a l C N V m u t a n t s h a v e b e e n i d e n t i f i e d a n d c h a r a c t e r i z e d . A l s o , o t h e r f u n g u s - t r a n s m i t t e d v i r u s e s , s u c h as M N S V , C L S V , o r T N V , c o u l d b e p a s s a g e d m e c h a n i c a l l y i n t h e a b s e n c e o f t h e i r Olpidium v e c t o r . T h e l o c a l l e s i o n a s s a y c o u l d b e u s e d t o i d e n t i f y v a r i a n t s f r o m t h e s e p o p u l a t i o n s o f v i r u s w h i c h h a v e a r e d u c e d a b i l i t y t o b e t r a n s m i t t e d t o d e t e r m i n e i f s i m i l a r o r d i f f e r e n t r e g i o n s o n t h e c a p s i d s o f v i r u s e s o t h e r t h a n C N V a r e i n v o l v e d i n t h e s p e c i f i c i t y o f t r a n s m i s s i o n . T o test t h e h y p o t h e s i s t h a t L L 5 h a d r e d u c e d t r a n s m i s s i o n d u e t o a r e d u c e d a b i l i t y t o b i n d t o O. bornovanus z o o s p o r e s a b i n d i n g a s s a y w a s d e v e l o p e d ( C h a p t e r 3). U s i n g 132 t h i s b i n d i n g a s s a y i t w a s d e t e r m i n e d t h a t L L 5 v i r i o n s b o u n d t o 5 0 % t h e l e v e l s o f w i l d -t y p e C N V , i n d i c a t i n g t h a t at l e a s t p a r t o f i t s r e d u c t i o n i n t r a n s m i s s i o n i s d u e t o a r e d u c e d a b i l i t y t o b i n d t o O. bornovanus z o o s p o r e s . T h e n o n - t r a n s m i s s i b l e b u t c l o s e l y r e l a t e d T B S V - C h d i d n o t b i n d t o O. bornovanus, i n d i c a t i n g t h a t t h e b i n d i n g a s s a y i s c o n s i s t e n t w i t h t h e b i o l o g y o f t h e s e v i r u s - f u n g u s i n t e r a c t i o n s . T h e b i n d i n g a s s a y c o u l d b e u s e d i n f u t u r e a n a l y s e s o f l o c a l l e s i o n s t o d e t e r m i n e w h i c h p o t e n t i a l C N V m u t a n t s s h o w r e d u c e d b i n d i n g t o O. bornovanus, t h e r e b y e l i m i n a t i n g m u t a n t s w i t h d e f e c t s i n o t h e r a r e a s o f t h e i n f e c t i o n c y c l e . T h e a m i n o a c i d s e q u e n c e o f t h e C L S V C P w a s a l i g n e d w i t h o t h e r O. bornovanus-t r a n s m i t t e d v i r u e s ( C N V , M N S V , a n d R C N M V ) a n d n i n e s m a l l s p h e r i c a l v i r u s e s n o t t r a n s m i t t e d b y O. bornovanus t o d e t e r m i n e i f r e g i o n s o f s i m i l a r a m i n o a c i d s e q u e n c e c o u l d b e i d e n t i f i e d i n c o m m o n b e t w e e n t h e O. boraovanw.s'-transmitted v i r u s e s w h i c h w e r e n ' t p r e s e n t i n t h e n o n - t r a n s m i t t e d v i r u s e s ( C h a p t e r 4 ) . S e v e r a l r e g i o n s o f C P s e q u e n c e i d e n t i t y w e r e i d e n t i f i e d w h i c h a r e c a n d i d a t e s f o r m u t a t i o n a l a n a l y s i s as p o t e n t i a l v i r a l a t t a c h m e n t s i t e s t o p u t a t i v e r e c e p t o r m o l e c u l e s o n t h e z o o s p o r e s u r f a c e . A d d i t i o n a l l y , p h y l o g e n e t i c a n a l y s i s b a s e d o n t h e s e a l i g n m e n t s s u g g e s t e d t h a t t h e C P s o f th e f o u r O. bornovanus-transmitted v i r u s e s a r e e v o l u t i o n a r y c l o s e l y r e l a t e d t o o n e a n o t h e r d e s p i t e t h e i r b e i n g a s s i g n e d t o d i s t i n c t t a x o n o m i c g r o u p s . T h e b i n d i n g a s s a y d e v e l o p e d i n C h a p t e r 3 t o c h a r a c t e r i z e L L 5 w a s u s e d i n C h a p t e r 5 to d e t e r m i n e i f a p u t a t i v e r e c e p t o r f o r C N V e x i s t s o n t h e s u r f a c e o f O. bornovanus z o o s p o r e s . O n e i n t e r e s t i n g o b s e r v a t i o n w a s t h a t b i n d i n g w a s p H - d e p e n d e n t , w i t h m a x i m u m b i n d i n g o c c u r r i n g at p H 7.2 t o 7.6. B i n d i n g w a s a l s o f o u n d t o i n c r e a s e w i t h t i m e , w i t h 5 0 % o f t h e b i n d i n g o c c u r r i n g w i t h i n t h e f i r s t 10 m i n a n d e q u i l i b r i u m 133 b e i n g r e a c h e d a f t e r 6 0 m i n . T h e s p e c i f i c i t y o f v i r u s t r a n s m i s s i o n b y Olpidium spp. w a s r e f l e c t e d i n o u r b i n d i n g a s s a y d a t a , w h e r e C N V , M N S V , a n d C L S V , w h i c h a r e t r a n s m i t t e d b y O. bornovanus z o o s p o r e s , b o u n d O. bornovanus t o h i g h e r l e v e l s t h a n T N V , w h i c h i s n o t t r a n s m i t t e d b y O. bornovanus. T N V , w h i c h i s t r a n s m i t t e d b y O. brassicae z o o s p o r e s , b o u n d t o O. brassicae t o h i g h e r l e v e l s t h a n C N V , M N S V , o r C L S V . B i n d i n g o f C N V t o O. bornovanus a n d T N V to O. brassicae w e r e f o u n d t o b e s a t u r a b l e , w i t h a p p r o x i m a t e l y 1.75 X 1 0 4 C N V v i r i o n s b o u n d p e r z o o s p o r e a n d 1.25 X 1 0 4 T N V v i r i o n s b o u n d p e r z o o s p o r e . C N V w a s f o u n d t o c o m p e t e w i t h M N S V a n d T N V f o r b i n d i n g t o O. bornovanus b u t d i d n o t c o m p e t e w i t h C L S V . T a k e n t o g e t h e r , t h e s e r e s u l t s i n d i c a t e t h a t s p e c i f i c m o l e c u l e s e x i s t o n t h e s u r f a c e o f Olpidium z o o s p o r e s w h i c h f a c i l i t a t e v i r u s b i n d i n g a n d t r a n s m i s s i o n . F u r t h e r e x p e r i m e n t s u s i n g g l y c o s i d a s e a n d p r o t e a s e t r e a t m e n t o f z o o s p o r e s p r i o r t o b i n d i n g m a y h e l p t o d e t e r m i n e t h e n a t u r e o f t h e s e p u t a t i v e r e c e p t o r m o l e c u l e s . T o c o m p l e m e n t o t h e r s t u d i e s u n d e r w a y i n m y l a b o r a t o r y o n t h e n a t u r e o f p u t a t i v e r e c e p t o r s o n t h e s u r f a c e o f Olpidium z o o s p o r e s , F I T C - l e c t i n s w e r e a d d e d t o z o o s p o r e s i n t h e b i n d i n g a s s a y t o d e t e r m i n e t h e n a t u r e o f s u g a r s o n t h e s u r f a c e o f t h e s e z o o s p o r e s . T h e b i n d i n g o f C o n A - F i T C t o O. bornovanus a n d O. brassicae i n d i c a t e d t h a t D ( + ) -m a n n o s e a n d / o r D ( + ) - g l u c o s e a r e p o s s i b l y c o m p o n e n t s o f t h e s u r f a c e s o f z o o s p o r e s o f b o t h o f t h e s e f u n g i . T P A - F I T C a l s o b o u n d t o z o o s p o r e s o f b o t h f u n g i , i n d i c a t i n g t h a t L ( -) - f u c o s e i s p r o b a b l y a l s o o n t h e s u r f a c e s o f b o t h s p e c i e s o f Olpidium. E C A - F I T C d i d n o t b i n d t o z o o s p o r e s o f e i t h e r f u n g u s , s u g g e s t i n g t h a t a - l a c t o s e i s n o t p r e s e n t o n s u r f a c e s o f e i t h e r O. bornovanus o r O. brassicae. I n t e r e s t i n g l y , B P A - F I T C , w h i c h b i n d s D ( + ) -g a l a c t o s e , b o u n d t o z o o s p o r e s o f O. brassicae b u t n o t t o O. bornovanus, i n d i c a t i n g t h a t 134 D ( + ) - g a l a c t o s e i s o n l y l o c a t e d o n t h e s u r f a c e o f O. brassicae z o o s p o r e s . T h e i d e n t i f i c a t i o n o f a d i f f e r e n t i a l e x p r e s s i o n o f s u g a r s b e t w e e n O. bornovanus a n d O. brassicae i n d i c a t e s t h a t t h i s s u g a r ( D ( + ) - g a l a c t o s e ) c o u l d b e p a r t o f a c a n d i d a t e v i r a l r e c e p t o r o n t h e z o o s p o r e s u r f a c e . M o r e F I T C - l e c t i n s s h o u l d b e e x a m i n e d f o r b i n d i n g t o Olpidium z o o s p o r e s i n p a r a l l e l t o o t h e r m e a n s o f e x a m i n a t i o n o f c a n d i d a t e m o l e c u l e s f o r t h e i r r o l e i n f a c i l i t a t i n g t r a n s m i s s i o n o f p l a n t v i r u s e s . T h e m a j o r s i g n i f i c a n c e o f t h e w o r k i n t h i s t h e s i s i s t h a t s e v e r a l m e t h o d o l o g i e s w e r e d e v e l o p e d i n c l u d i n g t h e i s o l a t i o n a n d e x a m i n a t i o n o f l o c a l l e s i o n m u t a n t s o f C N V a n d t h e d e v e l o p m e n t o f a b i n d i n g a s s a y b e t w e e n C N V a n d O. bornovanus z o o s p o r e s . T h e s e m e t h o d o l o g i e s w e r e u s e d t o c h a r a c t e r i z e o n e C N V t r a n s m i s s i o n m u t a n t , L L 5 , w i t h a m u t a t i o n i n t h e C N V C P s h e l l d o m a i n w h i c h m a y c o n t a i n a v i r a l a t t a c h m e n t s i t e t o a p u t a t i v e r e c e p t o r m o l e c u l e o n t h e z o o s p o r e s u r f a c e . A m i n o a c i d a l i g n m e n t s u s i n g t h e C P s o f f o u r O. bornovanus-transmitted v i r u s e s i n d i c a t e d n e w s e q u e n c e s w h i c h s h o u l d b e m u t a g e n i z e d t o d e t e r m i n e t h e i r r o l e i n t h e s p e c i f i c i t y o f t r a n s m i s s i o n , t o f u r t h e r d e l i n e a t e t h e v i r a l a t t a c h m e n t s i t e . U s i n g t h e b i n d i n g a s s a y , t h e s p e c i f i c i t y , s a t u r a b i l i t y , a n d c o m p e t i t i o n o f v i r u s b i n d i n g t o Olpidium z o o s p o r e s i n d i c a t e d t h a t a s p e c i f i c r e c e p t o r m o l e c u l e e x i s t s o n t h e s u r f a c e o f z o o s p o r e s o f t h e s e f u n g i . P r e l i m i n a r y w o r k t o d e t e r m i n e t h e n a t u r e o f s u g a r s o n t h e s u r f a c e o f Olpidium z o o s p o r e s u s i n g t h e b i n d i n g o f F I T C - l e c t i n s m a y a i d i n c h a r a c t e r i z a t i o n o f t h e p u t a t i v e r e c e p t o r . I n t h e n e x t p h a s e o f t h i s r e s e a r c h , o t h e r b i o c h e m i c a l t e c h n i q u e s s h o u l d b e u t i l i z e d t o d e t e r m i n e t h e n a t u r e o f t h e p u t a t i v e r e c e p t o r o n t h e Olpidium z o o s p o r e s u r f a c e . T h e u s e o f c a n d i d a t e s u g a r s t o c o m p e t e w i t h v i r u s b i n d i n g t o z o o s p o r e s i n t h e b i n d i n g a s s a y a n d a l s o t o z o o s p o r e e x t r a c t s o n m e m b r a n e s ( s u c h as t h e u s e o f D ( + ) - g a l a c t o s e t o 135 c o m p e t e w i t h T N V b i n d i n g t o O. brassicae z o o s p o r e s ) m a y b e u s e f u l i n d e t e r m i n i n g i f c a n d i d a t e s u g a r s i d e n t i f i e d v i a F I T C - l e c t i n b i n d i n g a r e i n d e e d i n v o l v e d i n v i r u s b i n d i n g . G e n e t i c t e c h n i q u e s s u c h as t h e p r o d u c t i o n o f c D N A l i b r a r i e s f o r O. bornovanus a n d O. brassicae a n d t h e u t i l i z a t i o n o f s u b t r a c t i v e h y b r i d i z a t i o n m a y a i d i n t h e i s o l a t i o n o f • c a n d i d a t e g e n e s w h i c h a r e i n v o l v e d i n v i r u s b i n d i n g a n d t h e s p e c i f i c i t y o f t r a n s m i s s i o n . C o l u m n c h r o m a t o g r a p h y c o u l d b e u s e d t o p u r i f y a n d s e q u e n c e t h e p o t e n t i a l r e c e p t o r . A d d i t i o n a l l y , t h e d e v e l o p m e n t o f v i r u s o v e r l a y s o f w e s t e r n b l o t s o f e x t r a c t s f r o m t h e m e m b r a n e s o f O. bornovanus a n d / o r O. brassicae w o u l d b e u s e f u l i n a t t e m p t s t o f u r t h e r c h a r a c t e r i z e t h e p u t a t i v e r e c e p t o r . 1 3 6 References A c h a r y a , R., F r y , E., S t u a r t , D., F o x , G., R o w l a n d s , D., a n d B r o w n , F. ( 1 9 8 9 ) . T h e t h r e e -d i m e n s i o n a l s t r u c t u r e o f f o o t - a n d - m o u t h d i s e a s e v i r u s at 2.9 A r e s o l u t i o n . Nature 337:709-716. A d a m s , M . J. ( 1 9 9 1 ) . T r a n s m i s s i o n o f p l a n t v i r u s e s b y f u n g i . Ann. Appl. Biol. 118:479-4 9 2 . A l l i s o n , R.F., D o u g h e r t y , W.G., P a r k s , T.D., W i l l i s , L., J o h n s t o n , R.E., K e l l y , M., a n d A r m s t r o n g , F.B. ( 1 9 8 5 ) . Virology 147:309-316. A m m a r , E . D., J a r l f o r s , U., a n d P i r o n e , T. P. ( 1 9 9 4 ) . A s s o c i a t i o n o f p o t y v i r u s h e l p e r c o m p o n e n t p r o t e i n w i t h v i r i o n s a n d t h e c u t i c l e l i n i n g t h e m a x i l l a r y f o o d c a n a l a n d f o r e g u t o f a n a p h i d v e c t o r . Phytopathology 84:1054-1060. A t r e y a , C . D., R a c c a h , B., a n d P i r o n e , T . P. ( 1 9 9 0 ) . A p o i n t m u t a t i o n i n t h e c o a t p r o t e i n a b o l i s h e s a p h i d t r a n s m i s s i b i l i t y o f a p o t y v i r u s . Virology 178:161-165. A t r e y a , C.D., A t r e y a , P.L., T h o r n b u r y , D.W., a n d P i r o n e , T.P. ( 1 9 9 2 ) . S i t e d i r e c t e d m u t a g e n e n i s i n t h e p o t y v i r u s H C - P r o g e n e a f f e c t h e l p e r c o m p o n e n t a c t i v i t y , v i r u s a c c u m u l a t i o n a n d s y m p t o m e x p r e s s i o n i n i n f e c t e d t o b a c c o p l a n t s . Virology 191:106-111. A t r e y a , C D . , a n d P i r o n e , T.P. ( 1 9 9 3 ) . M u t a t i o n a l a n a l y s i s o f t h e h e l p e r c o m p o n e n t -p r o t e i n a s e g e n e o f a p o t y v i r u s : e f f e c t s o f a m i n o a c i d s u b s t i t u t i o n s , d e l e t i o n s , a n d g e n e r e p l a c e m e n t o n v i r u l e n c e a n d a p h i d t r a n s m i s s i b i l i t y . Proc. Natl. Acad. Sci. USA 9 0:11919-11923. A t r e y a , P.L., A t r e y a , C D . , a n d P i r o n e , T.P. ( 1 9 9 1 ) . A m i n o a c i d s u b s t i t u t i o n s i n t h e c o a t p r o t e i n r e s u l t i n l o s s o f i n s e c t t r a n s m i s s i b i l i t y o f a p l a n t v i r u s . Proc. Natl. Acad. Sci. USA 88:7887-7891. A t r e y a , P.L., L o p e z - M o y a , J.J., C h u , M., A t r e y a , C D . , a n d P i r o n e , T.P. ( 1 9 9 5 ) . M u t a t i o n a l a n a l y s i s o f t h e c o a t p r o t e i n N - t e r m i n a l a m i n o a c i d s i n v o l v e d i n p o t y v i r u s t r a n s m i s s i o n b y a p h i d s . J. Gen. Virol. 76:265-270. B a h n e r , I., L a m b , J., M a y o , M.A., a n d H a y , R.T. ( 1 9 9 0 ) . E x p r e s s i o n o f t h e g e n o m e o f p o t a t o l e a f r o l l v i r u s : r e a d t h r o u g h o f t h e c o a t p r o t e i n t e r m i n a t i o n c o d o n in vivo. J. Gen. Virol. 71:2251-2256. B a n d l a , M . D., C a m p b e l l , L . R., U l l m a n , D . E., a n d S h e r w o o d , J . L . ( 1 9 9 8 ) . I n t e r a c t i o n o f t o m a t o s p o t t e d w i l t t o s p o v i r u s ( T S W V ) g l y c o p r o t e i n s w i t h a t h r i p s m i d g u t p r o t e i n , a p o t e n t i a l c e l l u l a r r e c e p t o r f o r T S W V . Phytopathology 88:98-104. B a r r , D.J.S. ( 1 9 6 8 ) . A n e w s p e c i e s o f Olpidium p a r a s i t i c o n c u c u m b e r r o o t s . Can. J. Bot. 46: 1 0 8 7 - 1 0 9 1 . 137 B e r g e r , P.H., a n d P i r o n e , T.P. ( 1 9 8 6 ) . T h e e f f e c t o f h e l p e r c o m p o n e n t o n t h e u p t a k e a n d l o c a l i z a t i o n o f p o t y v i r u s e s i n Myzus persicae. Virology 153:256-261. B e r b e e , M . L . a n d K e r w i n , J.L. ( 1 9 9 3 ) . U l t r a s t r u c t u r a l a n d l i g h t m i c r o s c o p i c l o c a l i z a t i o n o f c a r b o h y d r a t e s a n d p e r o x i d a s e / c a t a l a s e s i n Lagenidium giganteum z o o s p o r e s . Mycologia 85:734-743. B l a n c , S., C e r u t t i , M., C h a a b i h i , H., L o u i s , C , D e v a u c h e l l e , G., a n d H u l l , R. ( 1 9 9 3 ) . G e n e JJ p r o d u c t o f a n a p h i d - n o n t r a n s m i s s i b l e i s o l a t e o f c a u l i f l o w e r m o s a i c v i r u s e x p r e s s e d i n a b a c u l o v i r u s s y s t e m p o s s e s s e s a p h i d t r a n s m i s s i o n f a c t o r a c t i v i t y . Virology 192:651-654. B l a n c , S., L o p e z - M o y a , J.J., W a n g , R.Y., G a r c i a - L a m p a s o n a , S., T h o r n b u r y , D.W., a n d P i r o n e , T.P. ( 1 9 9 7 ) . A s p e c i f i c i n t e r a c t i o n b e t w e e n c o a t p r o t e i n a n d h e l p e r c o m p o n e n t c o r r e l a t e s w i t h a p h i d t r a n s m i s s i o n o f a p o t y v i r u s . Virology 231:141-147. B o o n h a m , N., H e n r y , C.M., a n d W o o d , K.R. ( 1 9 9 5 ) . T h e n u c l e o t i d e s e q u e n c e a n d p r o p o s e d g e n o m e o r g a n i s a t i o n o f o a t c h l o r o t i c s t u n t v i r u s , a n e w s o i l - b o r n e v i r u s o f c e r e a l s . J. Gen. Virol. 76:2025-2034. B r a d l e y , R.H.E. ( 1 9 6 4 ) . A p h i d t r a n s m i s s i o n o f s t y l e t - b o r n e v i r u s e s . I n Plant Virology, pp. 148-174. E d . M .K. C o r b e t t a n d H.D. S i s l e r . G a i n e s v i l l e : U n i v . o f F l o r i d a P r e s s . B r a u l t , V., v a n d e n H e u v e l , J . F. J. M., V e r b e e k , M., Z i e g l e r - G r a f f , V., R e u t e n a u e r , A., H e r r b a c h , E., G a r a u d , J.-C., G u i l l e y , H., R i c h a r d s , K., a n d J o n a r d , G . ( 1 9 9 5 ) . A p h i d t r a n s m i s s i o n o f b e e t w e s t e r n y e l l o w s l u t e o v i r u s r e q u i r e s t h e m i n o r c a p s i d r e a d - t h r o u g h p r o t e i n P 7 4 . EMBO J. 14:650-659. B r o w n , D.J.F., P l o e g , A.T., a n d R o b i n s o n , D.J. ( 1 9 8 9 ) . T h e a s s o c i a t i o n b e t w e e n s e r o t y p e s o f t o b r a v i r u s e s a n d Trichodoms a n d Paratrichodorus s p e c i e s . OEPP/EPPO Bull. 19:611-617. B r o w n , D . J. F., R o b e r t s o n , W. M., a n d T r u d g i l l , D . L . 1995. T r a n s m i s s i o n o f v i r u s e s b y p l a n t n e m a t o d e s . Annu. Rev. Phytopathol. 33:223-49. B r o w n , D.J.F., R o b e r t s o n , W.M., N e i l s o n , R., B e r n , F., a n d R o b i n s o n , D.J. ( 1 9 9 6 ) . C h a r a c t e r i z a t i o n a n d v e c t o r r e l a t i o n o f a s e r o l o g i c a l l y d i s t i n c t i s o l a t e o f t o b a c c o r a t t l e v i r u s ( T R V ) t r a n s m i t t e d b y Trichodoms similis i n n o r t h e r n G r e e c e . Eur. J. Plant Path. 102:61-68. B r o w n , K.E., A n d e r s o n , S.M., a n d Y o u n g , N.S. ( 1 9 9 3 ) . E r y t h r o c y t e P a n t i g e n : c e l l u l a r r e c e p t o r f o r B 1 9 p a r v o v i r u s . Science 262:114-117. B r u y e r e , A., B r a u l t , V., Z i e g l e r - G r a f f , V., S i m o n i s , M.-T., V a n d e n H e u v e l , J.F.J.M., R i c h a r d s , K., G u i l l e y , H., J o n a r d , G., a n d H e r r b a c h , E . ( 1 9 9 7 ) . E f f e c t s o f m u t a t i o n s i n t h e b e e t w e s t e r n y e l l o w s v i r u s r e a d t h r o u g h p r o t e i n o n i t s e x p r e s s i o n a n d p a c k a g i n g a n d o n v i r u s a c c u m u l a t i o n , s y m p t o m s , a n d a p h i d t r a n s m i s s i o n . Virology 230:323-334. 138 B u r g y a n , J., G r i e c o , F., a n d R u s s o , M . ( 1 9 8 9 ) . A d e f e c t i v e i n t e r f e r i n g R N A m o l e c u l e i n c y m b i d i u m r i n g s p o t v i r u s i n f e c t i o n s . J. Gen. Virol. 70:2325-239. B u r r , A.W., a n d B e a k e s , G.W. ( 1 9 9 4 ) . C h a r a c t e r i z a t i o n o f z o o s p o r e a n d c y s t s u r f a c e s t r u c t u r e i n s a p r o p h y t i c a n d f i s h p a t h o g e n i c Saprolegnia s p e c i e s ( o o m y c e t e f u n g a l p r o t i s t s ) . Protoplasma 181:142-163. C a l l o w , J A . ( 1 9 8 7 ) . M o d e l s f o r h o s t - p a t h o g e n i n t e r a c t i o n . I n Genetics of Plant Pathogenesis, P.R. D a y a n d G.J. J e l l i s , e d s , pp. 2 8 3 - 2 9 5 . B l a c k w e l l S c i e n t i f i c P u b l i c a t i o n s : O x f o r d . C a m p b e l l , R.N., G r o g a n , R.G., a n d P u r c i f u l l , D . E . ( 1 9 6 1 ) . G r a f t t r a n s m i s s i o n o f b i g - v e i n o f l e t t u c e . Virology 15:82-85. C a m p b e l l , R.N. ( 1 9 6 2 ) . R e l a t i o n s h i p b e t w e e n t h e l e t t u c e b i g - v e i n v i r u s a n d i t s v e c t o r , Olpidium brassicae. Nature 195:675-677'. C a m p b e l l , R.N. a n d G r o g a n , R.G. ( 1 9 6 3 ) . B i g - v e i n v i r u s o f l e t t u c e a n d i t s t r a n s m i s s i o n b y Olpidium brassicae. Phytopathology 53:252-259. C a m p b e l l , R.N. a n d G r o g a n , R.G. ( 1 9 6 4 ) . A c q u i s i t i o n a n d t r a n s m i s s i o n o f l e t t u c e b i g -v e i n v i r u s b y Olpidium brassicae. Phytopathology 54:681-690. C a m p b e l l , R.N. ( 1 9 8 5 ) . L o n g e v i t y o f Olpidium brassicae i n a i r - d r y s o i l a n d t h e p e r s i s t e n c e o f t h e l e t t u c e b i g v e i n agent. Can. J. Bot. 63:2288-2289. C a m p b e l l , R.N. ( 1 9 8 8 ) . C u l t u r a l c h a r a c t e r i s t i c s a n d m a n i p u l a t i v e m e t h o d s . I n Viruses with Fungal vectors, p p . 153-165, C o o p e r , J,K., A s h e r , M.J.C., eds. W e l l e s b o u r n e , U K : A s s o c . A p p l . B i o l . 3 3 5 p p . C a m p b e l l , R.N., L e c o q , H., W i p f - S c h e i b e l , C , a n d S i m , S.T. ( 1 9 9 1 ) . T r a n s m i s s i o n o f c u c u m b e r l e a f s p o t v i r u s b y Olpidium radicale. J. Gen. Virol. 72:3115-3119. C a m p b e l l , R. N . ( 1 9 9 3 ) . P e r s i s t e n c e : a v e c t o r r e l a t i o n s h i p n o t a p p l i c a b l e t o f u n g a l v e c t o r s . Phytopathology 83:363-364. C a m p b e l l , R. N., a n d S i m , S. T. ( 1 9 9 4 ) . H o s t s p e c i f i c i t y a n d n o m e n c l a t u r e o f Olpidium bornovanus (=Olpidium radicale) a n d c o m p a r i s o n s t o Olpidium brassicae. Can. J. Bot. 72:1136-1143. C a m p b e l l , R. N., S i m , S. T., a n d L e c o q , H . ( 1 9 9 5 ) . V i r u s t r a n s m i s s i o n b y h o s t - s p e c i f i c s t r a i n s o f Olpidium bornovanus a n d Olpidium brassicae. Eur. J. Plant Pathol. 101:273-2 8 2 . C a m p b e l l , R. N . ( 1 9 9 6 ) . F u n g a l t r a n s m i s s i o n o f p l a n t v i r u s e s . Annu. Rev. Phytopathol. 34:87-108. 139 C a r r i n g t o n , J.C., H e a t o n , L.A., Z u i d e m a , D., H i l l m a n , B.I., a n d M o r r i s , T . J . ( 1 9 8 9 a ) . T h e g e n o m e s t r u c t u r e o f t u r n i p c r i n k l e v i r u s . Virology 170:219-226. C a r r i n g t o n , J.C., C a r y , S.M., P a r k s , T.D., a n d D o u g h e r t y , W.G. ( 1 9 8 9 b ) . A s e c o n d p r o t e i n a s e e n c o d e d b y a p l a n t p o t y v i r u s g e n o m e . EMBO J. 8: 3 6 5 - 3 7 0 . C a r r i n g t o n , J.C., K a s s c h a u , K.D., M a h a j a n , S.K., a n d S c h a a d , M . C . ( 1 9 9 6 ) . C e l l - t o - c e l l a n d l o n g d i s t a n c e t r a n s p o r t o f v i r u s e s i n p l a n t s . Plant Cell 8:1669-1681. C h a y , C.A., G u n a s i n g e , U.G., D i n e s h - K u m a r , S.P., M i l l e r , W.A., a n d G r a y , S.M. ( 1 9 9 6 ) . A p h i d t r a n s m i s s i o n a n d s y s t e m i c p l a n t i n f e c t i o n d e t e r m i n a n t s o f b a r l e y y e l l o w d w a r f l u t e o v i r u s - P A V a r e c o n t a i n e d i n t h e c o a t p r o t e i n r e a d t h r o u g h d o m a i n a n d 1 7 - k D a p r o t e i n , r e s p e c t i v e l y . Virology 219:57-65. C h e l v a n a y a g a m , G., H e r i n g a , J., a n d A r g o s , P. ( 1 9 9 2 ) . A n a t o m y a n d e v o l u t i o n o f p r o t e i n s d i s p l a y i n g t h e v i r a l c a p s i d j e l l y r o l l t o p o l o g y . /. Mol. Biol. 228:220-242. C h e n , B., a n d F r a n c k i , R.I.B. ( 1 9 9 0 ) . C u c u m o v i r u s t r a n s m i s s i o n b y t h e a p h i d Myzus persicae i s d e t e r m i n e d s o l e l y b y t h e v i r a l c o a t p r o t e i n . J. Gen. Virol. 7 1 : 9 3 9 - 9 4 4 . C h e n , J.P., M a c F a r l a n e , S.A., a n d W i l s o n , T.M.A. ( 1 9 9 5 ) . A n a n a l y s i s o f s p o n t a n e o u s d e l e t i o n s i t e s i n s o i l - b o r n e w h e a t m o s a i c v i r u s R N A - 2 . Virology 209:213-217. C h o i , A.H.C., P a u l , R.W., a n d L e e , P.W.K. ( 1 9 9 0 ) . R e o v i r u s b i n d s t o m u l t i p l e p l a s m a m e m b r a n e p r o t e i n s o f m o u s e L f i b r o b l a s t s . Virology 178:316-320. C l a r k e , M . F., L i s t e r , R. M., a n d B a r - J o s e p h , M . ( 1 9 8 6 ) . E l i s a T e c h n i q u e s . Methods in Enzymology 118:742-766. C r o n i n , S., V e r c h o t , J., H a l d e m a n - C a h i l l , R., S c h a a d , M . C , a n d C a r r i n g t o n , J.C. ( 1 9 9 5 ) . L o n g - d i s t a n c e m o v e m e n t f a c t o r : a t r a n s p o r t f u n c t i o n o f t h e p o t y v i r u s h e l p e r c o m p o n e n t p r o t e i n a s e . Plant Cell 7:549-559. C r o w e l l , R.L., a n d L a n d a u , B . L . ( 1 9 7 9 ) . R e c e p t o r s as d e t e r m i n a n t s o f c e l l u l a r t r o p i s m i n p i c o r n a v i r u s i n f e c t i o n s . I n Receptors and Human Diseases, p p . 1-33. E d . B y A . G . B e a m a n d P.W. C h o p p i n . N e w Y o r k : M a c y F o u n d a t i o n . D a l e s , S. ( 1 9 7 3 ) . E a r l y e v e n t s i n c e l l - a n i m a l v i r u s i n t e r a c t i o n s . Bacteriol. Rev. 37:103-135. D a l g l e i s h , A.G., B e v e r l e y , P.C.L., C l a p h a m , P.R., C r a w f o r d , D.H., G r e a v e s , M.F., a n d W e i s s , R.A. ( 1 9 8 4 ) . T h e C D 4 ( T 4 ) a n t i g e n i s a n e s s e n t i a l c o m p o n e n t o f t h e r e c e p t o r f o r t h e A I D S r e t r o v i r u s . Nature 312:763-767. D a l l e y , N.E., a n d S o n n e b o r n , D.R. ( 1 9 8 2 ) . E v i d e n c e t h a t Blasotcladiella emersonii z o o s p o r e c h i t i n s y n t h a s e i s l o c a t e d at t h e p l a s m a m e m b r a n e . Biochim. Biophys. Acta. 686:65-76. 1 4 0 D a l m a y , T., R u b i n o , L., B u r g y a n , J., a n d R u s s o , M . ( 1 9 9 2 ) . R e p l i c a t i o n a n d m o v e m e n t o f a c o a t p r o t e i n m u t a n t o f c y m b i d i u m r i n g s p o t t o m b u s v i r u s . Molecular Plant-Microbe Interactions 5:379-383. D a l m a y , T., R u b i n o , L., B u r g y a n , J., K o l l a r , A., a n d R u s s o , M . ( 1 9 9 3 ) . F u n c t i o n a l a n a l y s i s o f c y m b i d i u m r i n g s p o t v i r u s g e n o m e . Virology 193:697-704. d e R e s e n d e , O.R., d e H a n n , P., d e A v i l a , A.C., K i t a j i m a , E.W., K o r m e l i n k , R., G o l d b a c h , R., a n d P e t e r s , D . ( 1 9 9 1 ) . G e n e r a t i o n o f e n v e l o p e a n d d e f e c t i v e i n t e r f e r i n g R N A m u t a n t s o f t o m a t o s p o t t e d w i l t v i r u s b y m e c h a n i c a l p a s s a g e . J. Gen. Virol. 72:2375-2383. D e l m a s , B., G e l f i , J., L ' H a r i d o n , R., V o g e l , L.K., S j o s t r o m , H., N o r e n , O., a n d L a u d e , H . ( 1 9 9 2 ) . A m i n o p e p t i d a s e N i s a m a j o r r e c e p t o r f o r t h e e n t e r o p a t h o g e n i c c o r o n a v i r u s T G E V . Nature 357:417-420. D e s s e n s , J . T. a n d M e y e r , M.. ( 1 9 9 5 ) . C h a r a c t e r i z a t i o n o f f u n g a l l y a n d m e c h a n i c a l l y t r a n s m i t t e d i s o l a t e s o f b a r l e y m i l d m o s a i c v i r u s : t w o s t r a i n s i n c o m p e t i t i o n . Virology 212:383-391. D e s s e n s , J.T., N g u y e n , M., M e y e r , M . ( 1 9 9 5 ) . P r i m a r y s t r u c t u r e a n d s e q u e n c e a n a l y s i s o f R N A - 2 o f a m e c h a n i c a l l y t r a n s m i t t e d b a r l e y m i l d m o s a i c i s o l a t e : a n e v o l u t i o n a r y r e l a t i o n s h i p b e t w e e n b y m o - a n d f u r o v i r u s e s . Arch. Virol. 140:325-333. D e v e r e u x , J., H a e b e r l i , P., S m i t h i e s , G. ( 1 9 8 4 ) . A c o m p r e h e n s i v e set o f s e q u e n c e a n a l y s i s p r o g r a m s f o r t h e V A X . Nucleic Acids Res. 12:387-395. D i a s , H . F. ( 1 9 7 0 a ) . T r a n s m i s s i o n o f c u c u m b e r n e c r o s i s v i r u s b y Olpidium cucurbitacearum B a r r & D i a s . Virology 40:828-839. D i a s , H.F. ( 1 9 7 0 b ) . T h e r e l a t i o n s h i p b e t w e e n c u c u m b e r n e c r o s i s v i r u s a n d i t s v e c t o r O l p i d i u m c u c u r b i t a c e a r u m . Virology 42:204-211. D i m m o c k , N.J. ( 1 9 8 2 ) . I n i t i a l s t a g e s i n i n f e c t i o n w i t h a n i m a l v i r u s e s . J. Gen. Virol. 59:1022. D o m i n g o , E., S a b o , D., T a n i g u c h i , T., a n d W e i s s m a n n , C . ( 1 9 7 8 ) . N u c l e o t i d e s e q u e n c e h e t e r o g e n e i t y o f a n R N A p h a g e p o p u l a t i o n . Cell 13:735-744. D o r w a r d , D.W., a n d P o w e l l , M . J . ( 1 9 8 3 ) . C y t o c h e m i c a l d e t e c t i o n o f p o l y s a c c h a r i d e s a n d the u l t r a s t r u c t u r e o f t h e c e l l c o a t o f z o o s p o r e s o f Chytridiomyces aureus a n d Chytridiomyces hyalinus. Mycologia 75:209-220. D u v e , C . d e a n d W a t t i a u x , R. ( 1 9 6 6 ) . F u n c t i o n s o f l y s o s o m e s . Ann. Rev. Physiol. 28:435-492. E i g e n , M . ( 1 9 9 3 ) . T h e o r i g i n o f g e n e t i c i n f o r m a t i o n : v i r u s e s as m o d e l s . Gene 135:37-47. 141 F i l i c h k i n , S.A., L i s t e r , R.M., M c G r a t h , P.F., a n d Y o u n g , M . J . ( 1 9 9 4 ) . In vivo e x p r e s s i o n a n d m u t a t i o n a l a n a l y s i s o f t h e b a r l e y y e l l o w d w a r f v i r u s r e a d t h r o u g h g e n e . Virology 205:290-299. F i l i c h k i n , S.A., B r u n f i e l d , S., F i l i c h k i n , T.P., a n d Y o u n g , M . J . ( 1 9 9 7 ) . In vitro i n t e r a c t i o n s o f t h e a p h i d e n d o s y m b i o n t s y m L c h a p e r o n i n w i t h b a r l e y y e l l o w d w a r f v i r u s . J. Virol. 71:569-577. F i n n e n , R.L., a n d R o c h o n , D.M. ( 1 9 9 3 ) . S e q u e n c e a n d s t r u c t u r e o f d e f e c t i v e i n t e r f e r i n g R N A s a s s o c i a t e d w i t h c u c u m b e r n e c r o s i s v i r u s i n f e c t i o n s . J. Gen. Virol. 74:1715-1720. F r i e d , H., C a h a n , L.D., a n d P a u l s o n , J.C. ( 1 9 8 1 ) . P o l y o m a v i r u s r e c o g n i z e s s p e c i f i c s i a l y l o l i g o s a c c h a r i d e r e c e p t o r s o n h o s t c e l l s . Virology 109:188-192. F r y , P.R. ( 1 9 5 8 ) . T h e r e l a t i o n s h i p o f O l p i d i u m b r a s s i c a e ( W o r . ) D a n g . T o t h e b i g - v e i n d i s e a s e o f l e t t u c e . N. Z. J. Agric. Res. 1:301-304. F u r u k i , I. ( 1 9 8 1 ) . E p i d e m i o l o g i c a l s t u d i e s o n m e l o n n e c r o t i c s p o t . Shizuoka Agric. Exp. Station Tech. Bull. 14. G e r a , A., L o e b e s t e i n , G., a n d R a c c a h , B . ( 1 9 7 9 ) . P r o t e i n c o a t s o f t w o s t r a i n s o f c u c u m b e r m o s a i c v i r u s a f f e c t t r a n s m i s s i o n b y Aphis gossypii. Phytopathology 69:396-399. G i b s o n , T . J . a n d A r g o s , P. ( 1 9 9 0 ) . P r o t r u d i n g d o m a i n o f t o m a t o b u s h y s t u n t v i r u s c o a t p r o t e i n i s a h i t h e r t o u n r e c o g n i z e d c l a s s o f j e l l y r o l l c o n f o r m a t i o n . J. Mol. Biol. 212:7-9. G i l d o w , F . E . a n d R o c h o w , W.F. ( 1 9 8 0 ) . R o l e o f a c c e s s o r y s a l i v a r y g l a n d s i n a p h i d t r a n s m i s s i o n o f B Y D V . Virology 104:97-108. G i l d o w , F . E . ( 1 9 8 7 ) . V i r u s - m e m b r a n e i n t e r a c t i o n s i n v o l v e d i n c i r c u l a t i v e t r a n s m i s s i o n o f l u t e o v i r u s e s b y a p h i d s . Curr. Top. Vector Res. 4:93-120. G i l d o w , F. E . ( 1 9 9 3 ) . E v i d e n c e o f r e c e p t o r - m e d i a t e d e n d o c y t o s i s r e g u l a t i n g l u t e o v i r u s a c q u i s i t i o n b y a p h i d s . Phytopathology 8 3 : 2 7 0 - 2 7 7 . G i l d o w , F . E . a n d G r a y , S.M. ( 1 9 9 3 ) . T h e a p h i d s a l i v a r y g l a n d b a s a l l a m i n a as a s e l e c t i v e b a r r i e r a s s o c i a t e d w i t h v e c t o r s p e c i f i c t r a n s m i s s i o n o f b a r l e y y e l l o w d w a r f v i r u s e s . Phytopathology 8 3 : 1 2 9 3 - 1 3 0 2 . G o u l d e n , M . G., D a v i e s , J. W., W o o d , K. R., a n d L o m o n o s s o f f , G . P. ( 1 9 9 2 ) . S t r u c t u r e o f t o b r a v i r a l p a r t i c l e s : a m o d e l s u g g e s t e d f r o m s e q u e n c e c o n s e r v a t i o n i n t o b r a v i r a l a n d t o b a m a v i r a l c o a t p r o t e i n s . J. Mol. Biol. 227:1-8. G o v i e r , D.A., a n d K a s s a n i s , B . ( 1 9 7 4 ) . E v i d e n c e t h a t a c o m p o n e n t o t h e r t h a n t h e v i r u s p a r t i c l e i s n e e d e d f o r a p h i d t r a n s m i s s i o n o f p o t a t o v i r u s Y . Virology 57:285-286. 142 G r a n i e r , F., D u r a n d - T a r d i f f , M., C a s s e - D e l b a r t , F., L e c o q , H., a n d R o b a g l i a , C . ( 1 9 9 3 ) . M u t a t i o n i n t h e z u c c h i n i y e l l o w m o s a i c v i r u s h e l p e r c o m p o n e n t a s s o c i a t e d w i t h l o s s o f a p h i d t r a n s m i s s i b i l i t y . J. Gen. Virol. 7 4 : 2 7 3 7 - 2 7 4 2 . G r a y , S.M., P o w e r , A.G., S m i t h , D.M., S e a m a n , A.J., a n d A l t m a n , N.S. ( 1 9 9 1 ) . A p h i d t r a n s m i s s i o n o f b a r l e y y e l l o w d w a r f v i r u s : a c q u i s i t i o n , a c c e s s p e r i o d s a n d v i r u s c o n c e n t r a t i o n r e q u i r e m e n t s . Phytopathology 8 1 : 5 3 9 - 5 4 5 . G r a y , S. M . ( 1 9 9 6 ) . P l a n t v i r u s p r o t e i n s i n v o l v e d i n n a t u r a l v e c t o r t r a n s m i s s i o n . Trends Microbiol. 4:259-264. G r a y , S.M., a n d R o c h o n , D.M. ( 1 9 9 9 ) . V e c t o r s o f p l a n t v i r u s e s . In: Encyclopedia of Virology. G r e v e , J.M., D a v i s , G., M e y e r , A.M., F o r t e , C.P., Y o s t , S.C., M a r l o r , C.W., K a r m a r c k , M . E . a n d M c C l e l l a n d , A . ( 1 9 8 9 ) . T h e m a j o r h u m a n r h i n o v i r u s r e c e p t o r i s I C A M - 1 . Cell 5 6 : 8 3 9 - 8 4 7 . G r i e c o , F., B u r g y a n , J., a n d R u s s o , M . ( 1 9 8 9 ) . T h e n u c l e o t i d e s e q u e n c e o f c y m b i d i u m r i n g s p o t v i r u s R N A . Nucleic Acids Res. 17:6383. G r o g a n , R.G., Z i n k , F.W., H e w i t t , W.B., a n d K i m b l e , K A . ( 1 9 5 8 ) . T h e a s s o c i a t i o n o f O l p i d i u m w i t h t h e b i g - v e i n d i s e a s e o f l e t t u c e . Phytopathology 4 8 : 2 9 2 - 2 9 7 . G r o g a n , R.G., a n d C a m p b e l l , R.N. ( 1 9 6 6 ) . F u n g i as v e c t o r s a n d h o s t s o f v i r u s e s . Ann. Rev. Phytopath. 4:29-52. G u i l l e y , H., C a r r i n g t o n , J . C , B a l i a z s , E., J o n a r d , G., R i c h a r d s , K., a n d M o r r i s , T . J . ( 1 9 8 5 ) . N u c l e o t i d e s e q u e n c e a n d g e n o m e o r g a n i z a t i o n o f c a r n a t i o n m o t t l e v i r u s R N A . Nucleic Acids Res. 1 3 : 6 6 6 3 - 6 6 7 7 . G u i l l e y , H., W i p f , S . C , R i c h a r d s , K , L e c o q , H., a n d J o n a r d , G . ( 1 9 9 4 ) . N u c l e o t i d e s e q u e n c e o f c u c u r b i t a p h i d - b o r n e y e l l o w s l u t e o v i r u s . Virology 2 0 2 : 1 0 1 2 - 1 0 1 7 . G u i l l o t , J., B r e t o n , A., D a m e z , M., D u s s e r , M., G a i l l a r d - M a r t i n i e , B., a n d M i l l e t , L . ( 1 9 9 0 ) . U s e o f l e c t i n s f o r a c o m p a r a t i v e s t u d y o f c e l l w a l l c o m p o s i t i o n o f d i f f e r e n t a n a e r o b i c r u m e n f u n g a l s t r a i n s . FEMS Microbiol. Lett. 6 7 : 1 5 1 - 1 5 6 . H a r r i s , K. F., a n d B a t h , J. E . ( 1 9 7 3 ) . R e g u r g i t a t i o n b y Myzus persicae d u r i n g m e m b r a n e f e e d i n g : i t s l i k e l y f u n c t i o n i n t r a n s m i s s i o n o f n o n p e r s i s t e n t p l a n t v i r u s e s . Am. Entomol. Soc. Am. 6 6 : 7 9 3 - 7 9 6 . H a r r i s , K .F. ( 1 9 7 7 ) . A n i n g e s t i o n - e g e s t i o n h y p o t h e s i s o f n o n c i r c u l a t i v e v i r u s t r a n s m i s s i o n . I n Aphids as Virus Vectors, 1 s t e d i t i o n , p p . 165-220. E d . B y K . M a r a m o r o s c h . N e w Y o r k : A c a d e m i c P r e s s . 1 4 3 H a r r i s o n , B . D., R o b e r t s o n , W. M., a n d T a y l o r , C . E . ( 1 9 7 4 ) . S p e c i f i c i t y o f r e t e n t i o n a n d t r a n s m i s s i o n o f v i r u s e s b y n e m a t o d e s . J. Nematol. 6 :155-164. H a r r i s o n , S. C , O l s o n , A . J., S c h u t t , C . E., a n d W i n k l e r , F. K. ( 1 9 7 8 ) . T o m a t o b u s h y s t u n t v i r u s at 2.9 A r e s o l u t i o n . Nature 276:368-373. H a r r i s o n , S. C . ( 1 9 8 3 ) . V i r u s s t r u c t u r e : h i g h r e s o l u t i o n p e r s p e c t i v e s . Adv. Virus Res. 28:175-240. H a r r i s o n , B.D., a n d R o b i n s o n , D.J. ( 1 9 8 8 ) . M o l e c u l a r v a r i a t i o n i n v e c t o r - b o r n e p l a n t v i r u s e s : e p i d e m i o l o g i c a l s i g n i f i c a n c e . Philosophical Transactions of the Royal Society of London B321:447-462. H a i t i , F.U. ( 1 9 9 6 ) . M o l e c u l a r c h a p e r o n e s i n c e l l u l a r p r o t e i n f o l d i n g . Nature 381:571-5 8 0 . H e a r n e , P.Q., K n o r r , D.A., H i l l m a n n , B.I., a n d M o r r i s , T . J . ( 1 9 9 0 ) . T h e c o m p l e t e g e n o m e s t r u c t u r e a n d s y n t h e s i s o f i n f e c t i o u s c l o n e s o f t o m a t o b u s h y s t u n t v i r u s . Virology 177:141-151. H e a t o n , L . A . ( 1 9 9 2 ) . U s e o f a g a r o s e g e l e l e c t r o p h o r e s i s t o m o n i t o r c o n f o r m a t i o n a l c h a n g e s o f s o m e s m a l l , s p h e r i c a l p l a n t v i r u s e s . Phytopathology 82:803-807. H e r n a n d e z , C , V i s s e r , P.B., B r o w n , D.J.F., a n d B o l , J . F. ( 1 9 9 7 ) . T r a n s m i s s i o n o f t o b a c c o r a t t l e v i r u s i s o l a t e P p K 2 0 b y i t s n e m a t o d e v e c t o r r e q u i r e s o n e o f t h e t w o n o n -s t r u c t u r a l g e n e s i n t h e v i r a l R N A 2. J. Gen. Virol. 78:465-467. H i l l m a n , B.I., C a r r i n g t o n , J.C., a n d M o r r i s , T . J . ( 1 9 8 7 ) . A d e f e c t i v e i n t e r f e r i n g R N A that c o n t a i n s a m o s a i c o f a p l a n t v i r u s g e n o m e . Cell 51:427-433. H i r u k i , C . ( 1 9 6 5 ) . T r a n s m i s s i o n o f t o b a c c o s t u n t v i r u s b y Olpidium brassicae. Virology 25:541-549. H i r u k i , C . ( 1 9 8 7 ) . R e c o v e r y a n d i d e n t i f i c a t i o n o f t o b a c c o s t u n t v i r u s f r o m a i r - d r i e d r e s t i n g s p o r e s o f Olpidium brassicae. Plant Path. 36:224-228. H o f e r , F., G r u e n b e r g e r , M., K o w a l s k i , H., M a c h a t , H., H u e t t i n g e r , M., K u e c h l e r , E., a n d B l a a s , D . ( 1 9 9 4 ) . M e m b e r s o f t h e l o w d e n s i t y l i p o p r o t e i n r e c e p t o r f a m i l y m e d i a t e c e l l e n t r y o f a m i n o r g r o u p c o m m o n c o l d v i r u s . Proc. Natl. Acad. Sci. USA 9 1 :1839-1842. H o g g a n , L A . ( 1 9 3 3 ) . S o m e f a c t o r s i n v o l v e d i n a p h i d t r a n s m i s s i o n o f t h e c u c u m b e r -m o s a i c v i r u s t o t o b a c c o . J. Agric. Res. 47:689-704. H o l l a n d , J.J. ( 1 9 6 1 ) . R e c e p t o r a f f i n i t i e s as m a j o r d e t e r m i n a n t s o f e n t e r o v i r u s t i s s u e t r o p i s m s i n h u m a n s . Virology 15:312-326. 144 H o p p e r , P., H a r r i s o n , S. C , a n d S a u e r , R. T. ( 1 9 8 4 ) . S t r u c t u r e o f t o m a t o b u s h y s t u n t v i r u s V : c o a t p r o t e i n s e q u e n c e d e t e r m i n a t i o n a n d i t s s t r u c t u r a l i m p l i c a t i o n s . /. Mol. Biol. 177:701-713. H u e t , H., G a l - O n , A., M e i r , E., L e c o q , H., a n d R a c c a h , G . ( 1 9 9 4 ) . M u t a t i o n s i n t h e h e l p e r c o m p o n e n t ( H C ) g e n e o f z u c c h i n i y e l l o w m o s a i c v i r u s ( Z Y M V ) a f f e c t a p h i d t r a n s m i s s i b i l i t y . J. Gen. Virol. 75:1407-1414. J a c o b i , V., P e e r e n b o o m , E., S c h e n k , P.M., A n t o n i w , J.F., S t e i n b i s s , H.H., a n d A d a m s , M. J . ( 1 9 9 5 ) . C l o n i n g a n d s e q u e n c e a n a l y s i s o f R N A - 2 o f a m e c h a n i c a l l y t r a n s m i t t e d U K i s o l a t e o f b a r l e y m i l d m o s a i c b y m o v i r u s ( B a M M V ) . Virus Res. 37:99-111. J e d l i n s k i , H . ( 1 9 8 1 ) . R i c e r o o t a p h i d , Rhopalosiphum rufiabdominalis, a v e c t o r o f B Y D V i n I l l i n o i s , a n d t h e d i s e a s e c o m p l e x . Plant Disease 65:975-978. J e n , C . J . a n d H a u g , A . ( 1 9 7 9 a ) . C h a n g e s i n s u r f a c e p r o p e r t i e s o f d e v e l o p i n g z o o s p o r e s o f Blastocladiella emersonii: b i n d i n g o f c o n c a n a v a l i n A . J. Gen. Microbiol. 115:145-151. J e n , C . J . a n d H a u g , A ( 1 9 7 9 b ) . C o n c a n a v a l i n A - i n d u c e d l y s i s o f z o o s p o r e s o f Blastocladiella emersonii. Exp. Cell Res. 120:425-428. J o h n s t o n , J . C . a n d R o c h o n , D . M . ( 1 9 9 0 ) . T r a n s l a t i o n o f c u c u m b e r n e c r o s i s v i r u s R N A in vitro. J. Gen. Virol. 71:2233:2241. J o h n s t o n , J.C. a n d R o c h o n , D.M. ( 1 9 9 6 ) . B o t h c o d o n c o n t e x t a n d l e a d e r l e n g t h c o n t r i b u t e t o e f f i c i e n t e x p r e s s i o n o f t w o o v e r l a p p i n g o p e n r e a d i n g f r a m e s o f a c u c u m b e r n e c r o s i s v i r u s b i f u n c t i o n a l s u b g e n o m i c m R N A . Virology 221:232-9. J o l l y , C A . a n d M a y o , M . A . ( 1 9 9 4 ) . C h a n g e s i n t h e a m i n o a c i d s e q u e n c e o f t h e c o a t p r o t e i n r e a d t h r o u g h d o m a i n o f p o t a t o l e a f r o l l l u t e o v i r u s a f f e c t t h e f o r m a t i o n o f a n e p i t o p e a n d a p h i d t r a n s m i s s i o n . Virology 201:182-185. J o n e s , R.W., J a c k s o n , A.O., a n d M o r r i s , T . J . ( 1 9 9 0 ) . D e f e c t i v e - i n t e r f e r i n g R N A s a n d e l e v a t e d t e m p e r a t u r e s i n h i b i t r e p l i c a t i o n o f t o m a t o b u s h y s t u n t v i r u s i n i n o c u l a t e d p r o t o p l a s t s . Virology 176:539-545. K a s s a n i s , B . a n d M a c f a r l a n e , I. ( 1 9 6 4 ) . T r a n s m i s s i o n o f t o b a c c o n e c r o s i s v i r u s b y z o o s p o r e s o f Olpidium brassicae. J. Gen. Microbiol. 36: 79-93. K e n n e d y , J.S., D a y , M.F., a n d E a s t o p , V . F . ( 1 9 6 2 ) . A Conspectus of Aphids as Vectors of Plant Viruses, p p . 1-114. L o n d o n : c o m m o n w e a l t h I n s t i t u t e o f E n t o m o l o g y . K i m , J.W., C l o s s , E.I., A l b r i t t o n , L.M., a n d C u n n i n g h a m , J.M. ( 1 9 9 1 ) . T r a n s p o r t o f c a t i o n i c a m i n o a c i d s b y t h e m o u s e e c o t r o p i c r e t r o v i r u s r e c e p t o r . Nature 352:725-728. K l e i n , P.G., K l e i n , R.R., R o d r i g u e z - C e r e z o , E., H u n t , A.G., a n d S h a w , J.G. ( 1 9 9 4 ) . M u t a t i o n a l a n a l y s i s o f t h e t o b a c c o v e i n m o t t l i n g v i r u s g e n o m e . Virology 204:759-769. 145 K o c h , W.J. ( 1 9 6 1 ) . T h e m o t i l e c e l l i n p o s t e r i o r l y u n i f l a g e l l a t e p h y c o m y c e t e s . In: Recent Advances in Botany, T o r o n t o , 3 3 5 - 3 3 9 . K o r m e l i n k , R., d e H a a n , P., M e u r s , C , P e t e r s , D., a n d G o l d b a c h , R. ( 1 9 9 2 ) . T h e n u c l e o t i d e s e q u e n c e o f t h e M R N A s e g m e n t o f t o m a t o s p o t t e d w i l t v i r u s , a b u n y a v i r u s w i t h t w o a m b i s e n s e R N A s e g m e n t s . J. Gen. Virol. 7 3 : 2 7 9 5 - 2 8 0 4 . K u n k e l , L . O. ( 1 9 2 2 ) . I n s e c t t r a n s m i s s i o n o f y e l l o w s t r i p e d i s e a s e . Hawaii Plant. Rec. 26:58-64. K u n k e l , T. A., R o b e r t s , J. D., a n d Z a k o u r , R. A . ( 1 9 8 7 ) . R a p i d a n d e f f i c i e n t s i t e - s p e c i f i c m u t a g e n e s i s w i t h o u t p h e n o t y p e s e l e c t i o n . Methods in Enzymology 1 5 4 : 3 6 7 - 3 8 2 . A c a d e m i c P r e s s , N e w Y o r k . L a e m m l i , U . K. ( 1 9 7 0 ) . C l e a v a g e o f s t r u c t u r a l p r o t e i n s d u r i n g t h e a s s e m b l y o f t h e h e a d o f b a c t e r i o p h a g e T 4 . Nature 2 2 7 : 6 8 0 - 6 8 5 . L e c o q , H., B o u r d i n , D., R a c c a h , B., H i e b e r t , E., a n d P u r c i f u l l , D . E . ( 1 9 9 1 ) . C h a r a c t e r i z a t i o n o f a z u c c h i n i y e l l o w m o s a i c v i r u s i s o l a t e w i t h a d e f i c i e n t h e l p e r c o m p o n e n t . Phytopathology 8 1 : 1 0 8 7 - 1 0 9 1 . L e h n e n , L P . a n d P o w e l l , M . J . ( 1 9 9 3 ) . C h a r a c t e r i z a t i o n o f c e l l s u r f a c e c a r b o h y d r a t e s o n a s e x u a l s p o r e s o f t h e w a t e r m o l d Saprolegnia ferax. Protoplasma 175:161-172. L e n t z , T . L . ( 1 9 9 0 ) . T h e r e c o g n i t i o n e v e n t b e t w e e n v i r u s a n d h o s t c e l l r e c e p t o r : a t a r g e t f o r a n t i v i r a l a g e n t s . J. Gen. Virol. 11:151-166. L i , J., H e a t h , I.B., a n d C h e n g , K.-J. ( 1 9 9 1 ) . T h e d e v e l o p m e n t a n d z o o s p o r e u l t r a s t r u c t u r e o f a p o l y c e n t r i c c h y t r i d i o m y c e t e g u t f u n g u s , Orpinomyces joyonii c o m b . n o v . Can. J. Bot. 6 9 : 5 8 0 - 5 8 9 . L i , X.H., H e a t o n , L.A., M o r r i s , T.J., a n d S i m o n , A . E . ( 1 9 8 9 ) . T u r n i p c r i n k l e v i r u s d e f e c t i v e i n t e r f e r i n g R N A s i n t e n s i f y v i r a l s y m p t o m s a n d a r e g e n e r a t e d de novo. Proc. Natl. Acad. Sci USA 8 6 : 9 1 7 3 - 9 1 7 7 . L i n , M.T., C a m p b e l l , R.N., S m i t h , P.R., T e m m i n k , J.H.M. 1970. L e t t u c e b i g v e i n v i r u s t r a n s m i s s i o n b y s i n g l e - s p o r a n g i u m i s o l a t e s o f Olpidium brassicae. P h y t o p a t h . 6 0 : 1 6 3 0 -1634. L o n b e r g - H o l m , K, a n d P h i l i p s o n , L . 1974. E a r l y i n t e r a c t i o n s b e t w e e n a n i m a l v i r u s e s a n d c e l l s . I n Monographs in Virology, v o l . 9. E d . B y J.L. M e l n i c k . B a s e l : S. K a r g e r . L o n b e r g - H o l m , K. ( 1 9 8 1 ) . A t t a c h m e n t o f a n i m a l v i r u s e s t o c e l l s : a n i n t r o d u c t i o n . Recept. Recog. B 8 : l - 2 0 . 1 4 6 L o t a n , R., S k u t e l s k y , E., D a n o n , D., a n d S h a r o n , N . ( 1 9 7 5 ) . T h e p u r i f i c a t i o n , c o m p o s i t i o n , a n d s p e c i f i c i t y o f t h e a n t i - T l e c t i n f r o m p e a n u t (Arachis hypogaea). J. Biol. Chem. 250:8518-8523. M a c F a r l a n e , S.A., W a l l i s , C.V., a n d B r o w n , D.J.F. ( 1 9 9 6 ) . M u l t i p l e v i r u s g e n e s i n v o l v e d i n t h e n e m a t o d e t r a n s m i s s i o n o f p e a e a r l y b r o w n i n g v i r u s . Virology 219: 4 1 7 - 4 2 2 . M a c F a r l a n e S.A., V a s s i l a k o s N., a n d B r o w n D.J. ( 1 9 9 9 ) . S i m i l a r i t i e s i n t h e g e n o m e o r g a n i z a t i o n o f t o b a c c o r a t t l e v i r u s a n d p e a e a r l y - b r o w n i n g v i r u s i s o l a t e s t h a t a r e t r a n s m i t t e d b y t h e s a m e v e c t o r n e m a t o d e . J. G e n . V i r o l . 80:273-276 M a i a , I.G., a n d B e r n a r d i , F. ( 1 9 9 6 ) . N u c l e i c a c i d - b i n d i n g p r o p e r t i e s o f a b a c t e r i a l l y e x p r e s s e d p o t a t o v i r u s Y h e l p e r c o m p o n e n t - p r o t e i n a s e . J. Gen. Virol. 77:869-877. M a n i e r , J.-F., a n d L o u b e s , C . ( 1 9 7 8 ) . Callimastix cyclopis W e i s s e n b e r g , 1 9 1 2 ( P h y c o m y c e t e , B l a s t o c l a d i a l e ) p a r a s i t e d ' u n Microcyclops claus, 1 8 9 3 ( C o p e p o d e , C y c l o p o i d e ) r e c o l t e a u t c a d : p a r t i c u l a i r e s u l t r a s t r u c t u r a l e s . Protistologica 14:493-501. M a n o h a r , S.K., G u i l l e y , H., D o l l e t , M., R i c h a r d s , K., a n d J o n a r d , G . ( 1 9 9 3 ) . N u c l e o t i d e s e q u e n c e a n d g e n e t i c o r g a n i z a t i o n o f p e a n u t c l u m p v i r u s R N A - 2 a n d p a r t i a l c h a r a c t e r i z a t i o n o f d e l e t e d f o r m s . Virology 195:33-41. M a r s h , M., a n d H e l e n i u s , A . ( 1 9 8 9 ) . V i r u s e n t r y i n t o a n i m a l c e l l s . Adv. Virus Res. 36:107-151. M a r t e l l i , G.P., G a l l i t e l l i , D., a n d R u s s o , M . ( 1 9 8 8 ) . T o m b u s v i r u s e s . I n The Plant Viruses. R. K o e n i g , E d . 3:13-72. P l e n u m P r e s s , N e w Y o r k , N Y . M a r t e l l i , G.P., R u s s o , M., R u b i n o , L., a n d S a b a n a d z o v i c . ( 1 9 9 8 ) . Aureusvirus, a n o v e l g e n u s i n t h e f a m i l y Tombusviridae. Arch. Virol. 143:9-13. M a r t i n , R.R., K e e s e , P.K., Y o u n g , M.J., W a t e r h o u s e , P.M., a n d G e r l a c h , W.L. ( 1 9 9 0 ) . E v o l u t i o n a n d m o l e c u l a r b i o l o g y o f l u t e o v i r u s e s . Annu. Rev. Phytopathol. 28:341-363. M a s o n , P.W., B a x t , B., B r o w n , F., H a r b e r , J., M u r d i n , A., a n d W i m m e r , E . ( 1 9 9 3 ) . A n t i b o d y - c o m p l e x e d f o o t - a n d - m o u t h d i s e a s e v i r u s , b u t n o t p o l i o v i r u s , c a n i n f e c t n o r m a l l y i n s u s c e p t i b l e c e l l s v i a t h e F c r e c e p t o r . Virology 192:568-577. M a t t h e w s , R. E . F. ( 1 9 9 1 ) . Plant Virology, 3 r d ed. A c a d e m i c P r e s s , S a n D i e g o . M a y o , M., R o b e r t s o n , W. M., L e g o r b u r u , F. J., a n d B r i e r l e y , K. M . ( 1 9 9 5 ) . M o l e c u l a r a p p r o a c h e s t o a n u n d e r s t a n d i n g o f t h e t r a n s m i s s i o n o f p l a n t v i r u s e s b y n e m a t o d e s . I n Advances in Molecular Plant Nematology, E d . F. L a m b e r t i , C . D e G i o r g i , D . M c K . B i r d , pp. 2 7 7 - 2 9 3 . N e w Y o r k : P l e n u m . 3 0 9 p p . M c K e e n , C D . ( 1 9 5 9 ) . C u c u m b e r n e c r o s i s v i r u s . Can. J. Bot. 37:913-925. 147 M c L e a n , M . A., H a m i l t o n , R. L , a n d R o c h o n , D . M . ( 1 9 9 3 ) . S y m p t o m a t o l o g y a n d m o v e m e n t o f a c u c u m b e r n e c r o s i s v i r u s m u t a n t l a c k i n g t h e c o a t p r o t e i n p r o t r u d i n g d o m a i n . Virology 193:932-939. M c L e a n , M A., C a m p b e l l , R. N., H a m i l t o n , R. I., a n d R o c h o n , D . M . ( 1 9 9 4 ) . I n v o l v e m e n t o f t h e c u c u m b e r n e c r o s i s v i r u s c o a t p r o t e i n i n t h e s p e c i f i c i t y o f f u n g u s t r a n s m i s s i o n b y Olpidium bornovanus. Virology 204:840-842. M e n d e l s o h n , C.L., W i m m e r , E., a n d R a c a n i e l l o , V.R. ( 1 9 8 9 ) . C e l l u l a r r e c e p t o r s f o r p o l i o v i r u s : m o l e c u l a r c l o n i n g , n u c l e o t i d e s e q u e n c e , a n d e x p r e s s i o n o f a n e w m e m b e r o f t h e i m m u n o g l o b u l i n s u p e r f a m i l y . Cell 56:855-865. M e u l e w a e t e r , F., S e u r i n c k , J., a n d v a n E m m e l o , J . ( 1 9 9 0 ) . G e n o m e s t r u c t u r e o f t o b a c c o n e c r o s i s v i r u s s t r a i n A . Virology 177:699-709. M i l l e r , J. S., D a m u d e , H., R o b b i n s , M . A., R e a d e , R. D., a n d R o c h o n , D . M . ( 1 9 9 7 ) . G e n o m e s t r u c t u r e o f c u c u m b e r l e a f s p o t v i r u s : s e q u e n c e a n a l y s i s s u g g e s t s i t b e l o n g s t o a d i s t i n c t s p e c i e s w i t h i n t h e Tombusviridae. Virus Research 52:51-60. M i m s , C A . ( 1 9 8 6 ) . V i r u s r e c e p t o r s a n d c e l l t r o p i s m s . J. Infect. 12:199-203. M o o r e , M.D., C o o p e r , N.R., T a c k , B.F., a n d N e m e r o w , G.R. ( 1 9 8 7 ) . M o l e c u l a r c l o n i n g o f t h e c D N A e n c o d i n g t h e E p s t e i n - B a r r v i r u s / C 3 d r e c e p t o r ( c o m p l e m e n t r e c e p t o r t y p e 2) o f h u m a n B l y m p h o c y t e s . Proc. Natl. Acad. Sci. USA 84:9194-9198. M o r i n , S., G h a n a m , M., Z e i d a n , M., C z o s n e k , H., V e r b e e k , M., a n d v a n d e n H e u v e l , F.J.M. ( 1 9 9 9 ) . A G r o E L h o m o l o g u e f r o m e n d o s y m b i o t i c b a c t e r i a o f t h e w h i t e f l y Bemisia tabaci i s i m p l i c a t e d i n t h e c i r c u l a t i v e t r a n s m i s s i o n o f t o m a t o l e a f c u r l v i r u s . Virology 256:75-84. M u n n , E.A., O r p i n , C.G., a n d H a l l , F . J . ( 1 9 8 1 ) . U l t r a s t r u c t u r a l s t u d i e s o f t h e f r e e z o o s p o r e o f t h e r u m e n p h y c o m y c e t e Neocallimastix frontalis. J. Gen. Microbiol. 125:311-323. N i c h o l s o n , R.L. ( 1 9 8 4 ) . A d h e s i o n o f f u n g i t o t h e p l a n t c u t i c l e . I n Infection Processes of Fungi, D.W. R o b e r t s a n d J.R. A i s t , E d s . , p p . 74-89. T h e R o c k e f e l l e r F o u n d a t i o n : N e w Y o r k . N g , J., a n d P e r r y , K . L . ( 1 9 9 9 ) . S t a b i l i t y o f t h e a p h i d t r a n s m i s s i o n p h e n o t y p e i n c u c u m b e r m o s a i c v i r u s . Plant Path. 48:388-394. N u t t e r , R . C , S c h e e t s , K , P a n g a n i b a n , L . C , a n d L o m m e l , S.A. ( 1 9 8 9 ) . T h e c o m p l e t e n u c l e o t i d e s e q u e n c e o f t h e m a i z e c h l o r o t i c m o t t l e v i r u s g e n o m e . Nucleic Acids Res. 17:3163-3177. 148 O ' C o n n e l l , R.J. ( 1 9 9 1 ) . C y t o c h e m i c a l a n a l y s i s o f i n f e c t i o n s t r u c t u r e s o f Colletotrichum lindemuthianum u s i n g f l u o r o c h r o m e - l a b e l l e d l e c t i n s . Physiol. Mol. Plant Path. 39:189-2 0 0 . O l s o n , L.W. ( 1 9 8 4 ) . Allomyces - a d i f f e r e n t f u n g u s . Opin. Bot. 73:1-96. P a u l , R.W., C h o i , A.H.C., a n d L e e , P.W.K. 1989. T h e o c - a n o m e r i c f o r m o f s i a l i c a c i d i s t h e m i n i m a l r e c e p t o r d e t e r m i n a n t r e c o g n i z e d b y r e o v i r u s . Virology 172:382-385. P a u l s o n , J.C. ( 1 9 8 5 ) . I n t e r a c t i o n s o f a n i m a l v i r u s e s w i t h c e l l s u r f a c e r e c e p t o r s . I n The Receptors, v o l . 2, p p . 1 3 1 - 2 1 9 . E d . B y P.M. C o n n . O r l a n d o : A c a d e m i c P r e s s . P e e r e n b o o m , E., J a c o b i , V., A n t o n i w , J.F., S c h l i c h t e r , U., C a r t w r i g h t , E.J., S t e i n b i s s , F L -I T , a n d A d a m s , M.J. ( 1 9 9 6 ) . T h e c o m p l e t e n u c l e o t i d e s e q u e n c e o f R N A - 2 o f a f u n g a l l y t r a n s m i t t e d U K i s o l a t e o f b a r l e y m i l d m o s a i c b y m o v i r u s a n d i d e n t i f i c a t i o n o f a m i n o a c i d c o m b i n a t i o n s p o s s i b l y i n v o l v e d i n f u n g u s t r a n s m i s s i o n . Virus Res. 40:149-159. P e i f f e r , M.L., G i l d o w , F.E., a n d G r a y , S.M. ( 1 9 9 7 ) . T w o d i s t i n c t m e c h a n i s m s r e g u l a t e l u t e o v i r u s t r a n s m i s s i o n e f f i c i e n c y a n d s p e c i f i c i t y at t h e a p h i d s a l i v a r y g l a n d . J. Gen. Virol. 78:495-503. P e n g , Y., K a d o u r y , D., G a l - O n , A., H u e t , PL, W a n g , Y., a n d R a c c a h , B . ( 1 9 9 8 ) . M u t a t i o n s i n t h e H C - P r o g e n e o f z u c c h i n i y e l l o w m o s a i c p o t y v i r u s : e f f e c t s o n a p h i d t r a n s m i s s i o n a n d b i n d i n g t o p u r i f i e d v i r i o n s . J. Gen. Virol. 79:897-904. P e r r a u l t , J. ( 1 9 8 1 ) . O r i g i n a n d r e p l i c a t i o n o f d e f e c t i v e i n t e r f e r i n g p a r t i c l e s . Curr. Top. Microbiol. Immunol. 93:151-207. P e r r y K.L., Z h a n g L., S h i n t a k u M.H., a n d P a l u k a i t i s P. ( 1 9 9 4 ) . M a p p i n g d e t e r m i n a n t s i n c u c u m b e r m o s a i c v i r u s f o r t r a n s m i s s i o n b y Aphis gossypii. V i r o l o g y 205:591-595. P e r r y K.L., Z h a n g L., a n d P a l u k a i t i s P. ( 1 9 9 8 ) . A m i n o a c i d c h a n g e s i n t h e c o a t p r o t e i n o f c u c u m b e r m o s a i c v i r u s d i f f e r e n t i a l l y a f f e c t t r a n s m i s s i o n b y t h e a p h i d s Myzus persicae a n d Aphis gossypii. V i r o l o g y 242:204-210. P i r o n e , T. P. ( 1 9 8 1 ) . E f f i c i e n c y a n d s e l e c t i v i t y o f t h e h e l p e r c o m p o n e n t m e d i a t e d a p h i d t r a n s m i s s i o n o f p u r i f i e d p o t y v i r u s e s . Phytopathology 71:922-924. P i r o n e , T.P. ( 1 9 9 1 ) . V i r a l g e n e s a n d g e n e p r o d u c t s t h a t d e t e r m i n e i n s e c t t r a n s m i s s i b i l i t y . Seminars in Virology 2:81-87. P i r o n e , T. P., a n d B l a n c , S. ( 1 9 9 6 ) . H e l p e r d e p e n d e n t v e c t o r t r a n s m i s s i o n o f p l a n t v i r u s e s . Annu. Rev. Phytopathol. 34:227-247. P l o e g , A.T., A s j e s , C.J., a n d B r o w n , D.J.F. ( 1 9 9 1 ) . T o b a c c o r a t t l e v i r u s s e r o t y p e s a n d a s s o c i a t e d n e m a t o d e v e c t o r s p e c i e s o f T r i c h o d o r a e i n t h e b u l b - g r o w i n g a r e a s i n t h e N e t h e r l a n d s . Neth. J. Plant Path. 97:311-319. 14 9 P l o e g , A . T., B r o w n , D . J. F., a n d R o b i n s o n , D . J. ( 1 9 9 2 ) . A c q u i s i t i o n a n d s u b s e q u e n t t r a n s m i s s i o n o f t o b a c c o r a t t l e t o b r a v i r u s i s o l a t e s b y Trichodoms a n d Paratrichodoms n e m a t o d e s p e c i e s . Neth. J. Plant Path. 98:291-300. P o l l a r d , D.G. ( 1 9 7 3 ) . P l a n t p e n e t r a t i o n b y f e e d i n g a p h i d s ( H e m i p t e r a : A p h i d o i d e a ) : a r e v i e w . Bull. Entomol. Res. 62:631-714. P o n s e n , M . B. ( 1 9 7 7 ) . A n a t o m y o f a n a p h i d v e c t o r : Myzus persicae. P g s 6 3 - 8 2 In: Aphids as virus vectors. K . F . H a r r i s a n d K. M a r a m o r o s c h , E d s . A c a d e m i c P r e s s : N e w Y o r k . P o w e l l , G . ( 1 9 9 1 ) . C e l l m e m b r a n e p u n c t u r e s d u r i n g e p i d e r m a l p e n e t r a t i o n b y a p h i d s : c o n s e q u e n c e s f o r t h e t r a n s m i s s i o n o f t w o p o t y v i r u s e s . Ann. Appl. Biol. 119:313-321. P o w e l l , M . J . ( 1 9 8 1 ) . U l t r a s t r u c t u r e o f Polyphagus euglenae z o o s p o r e s . Can. J. Bot. 59:2049-2061. P o w e l l , M . J . ( 1 9 9 3 ) . L o o k i n g at m y c o l o g y w i t h a J a n u s f a c e : a g l i m p s e at c h y t r i d i o m y c e t e s a c t i v e i n t h e e n v i r o n m e n t . Mycologia 85:1-20. P o w e l l , M . J . ( 1 9 9 4 ) . P r o d u c t i o n a n d m o d i f i c a t i o n s o f e x t r a c e l l u l a r s t r u c t u r e s d u r i n g d e v e l o p m e n t o f c h y t r i d i o m y c e t e s . Protoplasma 181:123-141. P o w e r , A.G., S e a m a n , A.J., a n d G r a y , S.M. ( 1 9 9 1 ) . A p h i d t r a n s m i s s i o n o f b a r l e y y e l l o w d w a r f v i r u s : i n o c u l a t i o n a c c e s s p e r i o d s a n d e p i d e m i o l o g i c a l i m p l i c a t i o n s . Phytopathology 81:545-548. P r u s s , G., G e , X., S h i , X.M., C a r r i n g t o n , J.C., a n d V a n c e , V . B . ( 1 9 9 7 ) . P l a n t v i r a l s y n e r g i s m : t h e p o t y v i r a l g e n o m e e n c o d e s a b r o a d - r a n g e p a t h o g e n i c i t y e n h a n c e r t h a t t r a n s a c t i v a t e s r e p l i c a t i o n o f h e t e r o l o g o u s v i r u s e s . Plant Cell 9:859-868. R e s e n d e , R., d e H a a n , P., v a n d e V o s s e n , E., d e A v i l a , A.C., G o l d b a c h , R., a n d P e t e r s , D . ( 1 9 9 2 ) . D e f e c t i v e i n t e r f e r i n g L R N A s e g m e n t s o f t o m a t o s p o t t e d w i l t v i r u s r e t a i n b o t h v i r u s g e n o m e t e r m i n i a n d h a v e e x t e n s i v e i n t e r n a l d e l e t i o n s . J. Gen. Virol. 73:2509-2516. R i v i e r e , C.J. ( 1 9 8 9 ) . M . S c . t h e s i s . D e p a r t m e n t o f P l a n t S c i e n c e , U n i v e r s i t y o f B r i t i s h C o l u m b i a , B.C., C a n a d a . R i v i e r e , C.J., P o t , J., T r e m a i n e , J.H., a n d R o c h o n , D.M. ( 1 9 8 9 ) . C o a t p r o t e i n o f m e l o n n e c r o t i c s p o t c a r m o v i r u s i s m o r e s i m i l a r t o t h o s e o f t o m b u s v i r u s e s t h a n t h o s e o f c a r m o v i r u s e s . J. Gen. Virol. 70:3033-3042. R i v i e r e , C . J . a n d R o c h o n , D.M. ( 1 9 9 0 ) . N u c l e o t i d e s e q u e n c e a n d g e n o m i c o r g a n i z a t i o n o f m e l o n n e c r o t i c s p o t v i r u s . J. Gen. Virol. 71:1887-1896. R o b b i n s , M . A., R e a d e , R. D., a n d R o c h o n , D . M . ( 1 9 9 7 ) . A c u c u m b e r n e c r o s i s v i r u s v a r i a n t d e f i c i e n t i n f u n g a l t r a n s m i s s i b i l i t y c o n t a i n s a n a l t e r e d c o a t p r o t e i n s h e l l d o m a i n . Virology 234:138-146. 1 5 0 R o b e r t s o n , W. M . a n d H e n d r y , C . E . ( 1 9 8 6 ) . A n a s s o c i a t i o n o f c a r b o h y d r a t e w i t h p a r t i c l e s o f a r a b i s m o s a i c v i r u s r e t a i n e d w i t h i n X i p h i n e m a d i v e r s i c a u d a t u m . Ann. Appl. Biol. 109:299-305. R o c h o n , D.M., a n d T r e m a i n e , J.H. ( 1 9 8 8 ) . C u c u m b e r n e c r o s i s v i r u s i s a m e m b e r o f t h e t o m b u s v i r u s g r o u p . J. Gen. Virol. 69:395-400. R o c h o n , D . M., a n d T r e m a i n e , J . H . ( 1 9 8 9 ) . C o m p l e t e n u c l e o t i d e s e q u e n c e o f t h e c u c u m b e r n e c r o s i s v i r u s g e n o m e . Virology 71:251-259. R o c h o n , D . M . ( 1 9 9 1 ) . R a p i d de novo g e n e r a t i o n o f d e f e c t i v e i n t e r f e r i n g R N A b y c u c u m b e r n e c r o s i s v i r u s m u t a n t s t h a t d o n o t e x p r e s s t h e 2 0 - k D a n o n s t r u c t u r a l p r o t e i n . Proc. Natl. Acad. Sci. USA 8 8 :11153-11157. R o c h o n , D . M., a n d J o h n s t o n , J . C . ( 1 9 9 1 ) . I n f e c t i o u s t r a n s c r i p t s f r o m c l o n e d c u c u m b e r n e c r o s i s v i r u s c D N A : e v i d e n c e f o r a b i f u n c t i o n a l s u b g e n o m i c m R N A . Virology 181:656-6 6 5 . R o c h o n , D . M., F i n n e n , R. L., a n d S i t , T. L . ( 1 9 9 4 ) . C o a t p r o t e i n o f c u c u m b e r n e c r o s i s v i r u s i s n o t r e q u i r e d f o r e f f i c i e n t g e n e r a t i o n o r a c c u m u l a t i o n o f d e f e c t i v e i n t e r f e r i n g R N A s . J. Gen. Virol. 75:2505-2508. R o c h o w , W.F. ( 1 9 7 0 ) . B a r l e y y e l l o w d w a r f v i r u s : p h e n o t y p i c m i x i n g a n d v e c t o r s p e c i f i c i t y . Science 167:875-878. R o o s s i n c k , M . J. ( 1 9 9 7 ) . M e c h a n i s m s o f p l a n t v i r u s e v o l u t i o n . Ann. Rev. of Phytopathol. 35:191-209. R o s s m a n , M . G., A r n o l d , E., E r i c k s o n , J. W., F r a n k e n b e r g e r , E . A., G r i f f i t h , J. P., H e c h t , H. J., J o h n s o n , J. E., K a m e r , G., L u o , M., M o s s e r , A . G., R u e c k e r t , R. R., S h e r r y , B., a n d V r i e n d , G . ( 1 9 8 5 ) . S t r u c t u r e s o f a h u m a n c o m m o n c o l d v i r u s a n d f u n c t i o n a l r e l a t i o n s h i p s t o o t h e r p i c o r n a v i r u s e s . Nature 317:145-153. R o s s m a n n , M . G . ( 1 9 9 4 ) . V i r a l c e l l r e c o g n i t i o n a n d e n t r y . Protein Sci. 3 : 1 7 1 2 - 1 7 2 5 . R o u x , L., S i m o n , A.E., a n d H o l l a n d , J.J. ( 1 9 9 1 ) . E f f e c t s o f d e f e c t i v e i n t e r f e r i n g v i r u s e s o n v i r u s r e p l i c a t i o n a n d p a t h o g e n e s i s in vitro a n d in vivo. Adv. Virus. Res. 40:181-211. R u b i n o , L., R u s s o , M., a n d M a r t e l l i , G.P. ( 1 9 9 5 ) . S e q u e n c e a n a l y s i s o f p o t h o s l a t e n t v i r u s g e n o m i c R N A . J. Gen. Virol. 76:2835-2839. R u b i n o , L., a n d R u s s o , M . ( 1 9 9 7 ) . M o l e c u l a r a n a l y s i s o f t h e p o t h o s l a t e n t v i r u s g e n o m e . J. Gen. Virol. 78:1219-1226. R u s s o , M., B u r g y a n , J., a n d M a r t e l l i , G.P. ( 1 9 9 4 ) . M o l e c u l a r b i o l o g y o f Tombusviridae. Adv. Virus Res. 44:381-428. 151 S a h t i y a n c i , S. ( 1 9 6 2 ) . S t u d i e n u b e r e i n i g e w u r z e l p a r a s i t a r e O l p i d i a c e e n . Arch. Mikrobiol. 41:187-228. S a k o , N., a n d O g a t a , K. ( 1 9 8 1 ) . D i f f e r e n t h e l p e r f a c t o r s a s s o c i a t e d w i t h a p h i d t r a n s m i s s i o n o f s o m e p o t y v i r u s e s . Virology 112:762-765. S a k o , N., Y o s h i o k a , K , a n d E g u c h i , K . ( 1 9 8 4 ) . M e d i a t i o n o f h e l p e r c o m p o n e n t i n a p h i d t r a n s m i s s i o n o f s o m e p o t y v i r u s e s . Ann. Phytopath. Soc. Japan 50:515-521. S a l o m o n , R. ( 1 9 8 9 ) . Res. Virol. 140:453-455. S a l o m o n , R., a n d B e r n a r d i , F. ( 1 9 9 5 ) . I n h i b i t i o n o f v i r a l a p h i d t r a n s m i s s i o n b y t h e N -t e r m i n u s o f t h e m a i z e d w a r f m o s a i c v i r u s c o a t p r o t e i n . Virology 213:676-679. S a m b r o o k , J., F r i t s c h , E . F., a n d M a n i a t i s , T. ( 1 9 8 9 ) . Molecular Cloning: A Laboratory Manual, 2 n d ed. C o l d S p r i n g H a r b o r L a b o r a t o r y , C o l d S p r i n g H a r b o r , N Y . S a n g e r , F., N i c k l e n , S., a n d C o u l s o n , A . R. ( 1 9 7 7 ) . D N A s e q u e n c i n g w i t h c h a i n -t e r m i n a t i n g i n h i b i t o r s . Proc. Natl. Acad. Sci. USA 74:5463-5467. S c h m i d t I., B l a n c S., E s p e r a n d i e u P., K u h l G., D e v a u c h e l l e G., L o u i s C , a n d C e r u t t i M . ( 1 9 9 4 ) . I n t e r a c t i o n b e t w e e n t h e a p h i d t r a n s m i s s i o n f a c t o r a n d v i r u s p a r t i c l e s i s a p a r t o f t h e m o l e c u l a r m e c h a n i s m o f c a u l i f l o w e r m o s a i c v i r u s a p h i d t r a n s m i s s i o n . Proc. Natl. Acad. Sci. U S A 91:8885-8889. S c h o l t o f , H.B., M o r r i s , T.J., a n d J a c k s o n , A . O . ( 1 9 9 3 ) . T h e c a p s i d p r o t e i n g e n e o f t o m a t o b u s h y s t u n t v i r u s i s d i s p e n s i b l e f o r s y s t e m i c m o v e m e n t a n d c a n b e r e p l a c e d f o r l o c a l i z e d e x p r e s s i o n o f f o r e i g n g e n e s . Mol. Plant. Microbe Interact. 6:309-322. S e l i t r e n n i k o f f , C P . , D a l l e y , N.E., a n d S o n n e b o r n , D.R. ( 1 9 8 0 ) . R e g u l a t i o n o f t h e h e x o s a m i n e b i o s y n t h e t i c p a t h w a y i n t h e w a t e r m o l d Blastocladiella emersonii: s e n s i t i v i t y t o e n d p r o d u c t i n h i b i t i o n i s d e p e n d e n t u p o n t h e l i f e c y c l e p h a s e . Proc. Natl. Acad. Sci. USA 77:5998-6002. S h a r o n , N., a n d L i s , H . ( 1 9 9 3 ) . C a r b o h y d r a t e s i n c e l l r e c o g n i t i o n . Scientific American. 268:82-89. S h i r a k o , Y., a n d B r a k k e , M . K. ( 1 9 8 4 ) . S p o n t a n e o u s d e l e t i o n m u t a t i o n o f s o i l - b o r n e w h e a t m o s a i c v i u s R N A n. /. Gen. Virol. 65:855-858. S h i r a k o , Y., a n d W i l s o n , T.M.A. ( 1 9 9 3 ) . C o m p l e t e n u c l e o t i d e s e q u e n c e a n d o r g a n i z a t i o n o f t h e b i p a r t i t e R N A g e n o m e o f s o i l - b o r n e w h e a t m o s a i c v i r u s . Virology 195:16-32. S h o p e , R.E. ( 1 9 8 5 ) . B u n y a v i r u s e s . P g s 1 0 5 5 - 1 0 8 2 In: Virology. B.N. F i e l d s , E d . R a v e n P r e s s : N e w Y o r k . 152 S h u k l a , D.D., S t r i k e , P.M., T r a c y , S.L., G o u g h , K.H., a n d W a r d , C.W. ( 1 9 8 8 ) . J. Gen. Virol. 69:1497-1508. S i t , T-L., J o h n s t o n , J.C., T e r B o r g , M.G., F r i s o n , E., M c L e a n , M.A., a n d R o c h o n , D.M. ( 1 9 9 5 ) . M u t a t i o n a l a n a l y s i s o f t h e c u c u m b e r n e c r o s i s v i r u s c o a t p r o t e i n g e n e . Virology 206:38-48. S t a u n t o n , D.E., M e r l u z z i , V.J., R o t h l e i n , R., B a r t o n , R., M a r l i n g , S.D., a n d S p r i n g e r , T . A . ( 1 9 8 9 ) . A c e l l a d h e s i o n m o l e c u l e , I C A M - 1 , i s t h e m a j o r s u r f a c e r e c e p t o r f o r r h i n o v i r u s e s . Cell 56:849-853. S t e i n h a u e r , D . A., a n d H o l l a n d , J . J . ( 1 9 8 7 ) . R a p i d e v o l u t i o n o f R N A v i r u s e s . Ann. Rev. Microbiol. 4 1 : 4 0 9 - 4 3 3 . S t o b b s , L . W., C r o s s , G . W., a n d M a n o c h a , M . S. ( 1 9 8 2 ) . S p e c i f i c i t y a n d m e t h o d s o f t r a n s m i s s i o n o f c u c u m b e r n e c r o s i s v i r u s b y Olpidium radicale z o o s p o r e s . Can. J. Plant Pathol. 4:134-142. S y l v e s t e r , E.S. ( 1 9 8 0 ) . C i r c u l a t i v e a n d p r o p a g a t i v e v i r u s t r a n s m i s s i o n b y a p h i d s . Ann. Rev. Entomol. 25:257-286. T a m a d a , T., S h i r a k o , Y., A b e , H., S a i t o , M., K i g u c h i , T., a n d H a r a d a , T. ( 1 9 8 9 ) . P r o d u c t i o n a n d p a t h o g e n i c i t y o f i s o l a t e s o f b e e t n e c r o t i c y e l l o w v e i n v i r u s w i t h d i f f e r e n t n u m b e r s o f R N A c o m p o n e n t s . 7. Gen. Virol. 70:3399-3409. T a m a d a , T., a n d K u s u m e , T. ( 1 9 9 1 ) . E v i d e n c e t h a t t h e 7 5 K r e a d t h r o u g h p r o t e i n o f b e e t n e c r o t i c y e l l o w v e i n v i r u s R N A - 2 i s e s s e n t i a l f o r t r a n s m i s s i o n b y t h e f u n g u s Polymyxa betae. J. Gen. Virol. 72:1497-1504. T a m a d a , T., S c h m i t t , C , S a i t o , M., G u i l l e y , H., R i c h a r d s , K , a n d J o n a r d , G . ( 1 9 9 6 ) . H i g h r e s o l u t i o n a n a l y s i s o f t h e r e a d t h r o u g h d o m a i n o f b e e t n e c r o t i c y e l l o w v e i n v i r u s r e a d t h r o u g h p r o t e i n : a K T E R m o t i f i s i m p o r t a n t f o r e f f i c i e n t t r a n s m i s s i o n o f t h e v i r u s b y Polymyxa betae. J. Gen. Virol. 77:1359-1367. T a n n e r , J., W e i s , J., F e a r o n , D., W h a n g , Y., a n d K i e f f , E . ( 1 9 8 7 ) . E p s t e i n - B a r r v i r u s g p 3 5 0 / 2 2 0 b i n d i n g t o t h e B l y m p h o c y t e C 3 d r e c e p t o r m e d i a t e s a d s o r p t i o n , c a p p i n g , a n d e n d o c y t o s i s . Cell 50:203-213. T a r d i e u , M., E p s t e i n , R.L., a n d W e i n e r , H.L. ( 1 9 8 2 ) . I n t e r a c t i o n o f v i r u s e s w i t h c e l l s u r f a c e r e c e p t o r s . International Review of Cytology 80:27-61. T a y l o r , C.E., a n d R o b e r t s o n , W.M. ( 1 9 7 0 ) . L o c a t i o n o f t o b a c c o r a t t l e v i r u s i n t h e n e m a t o d e v e c t o r , Trichodorus pachydermus S e i n h o r s t . J. Gen. Virol. 6:179-182. T a y l o r , J.W., a n d F u l l e r , M.S. ( 1 9 8 1 ) . T h e G o l g i a p p a r a t u s , z o o s p o r o g e n e s i s a n d d e v e l o p m e n t o f t h e z o o s p o r e d i s c h a r g e a p p a r a t u s o f Chytridium confervae. Exp. Mycol. 5:35-59. 153 T e a k l e , D.S. ( 1 9 6 0 ) . A s s o c i a t i o n o f Olpidium brassicae a n d t o b a c c o n e c r o s i s v i r u s . Nature 188:431-432. T e a k l e , D . S. ( 1 9 8 3 ) . Z o o s p o r i c f u n g i a n d v i r u s e s : d o u b l e t r o u b l e . In: Zoosporic plant pathogens: a modern perspective, p p . 2 3 3 - 2 4 8 . E d . S. T. B u c z a c k i . L o n d o n : A c a d e m i c P r e s s . T e m m i n k , J. H . M . ( 1 9 7 1 ) . A n u l t r a s t r u c t u r a l s t u d y o f Olpidium brassicae a n d i t s t r a n s m i s s i o n o f t o b a c c o n e c r o s i s v i r u s . P h D T h e s i s . M e d e d e l i n g e n L a n d b o u w h o g e s c h o o l , W a g e n i n g e n , N e d e r l a n d , H . V e e n m a n a n d Z o n e n N . V . 71-6. T e m m i n k , J.H.M., a n d C a m p b e l l , R..N. ( 1 9 6 8 ) . T h e u l t r a s t r u c t u r e o f Olpidium brassicae I F o r m a t i o n o f s p o r a n g i a . Can. J. Bot. 46:951-956. T e m m i n k , J.H.M., a n d C a m p b e l l , R.N. ( 1 9 6 9 a ) . T h e u l t r a s t r u c t u r e o f Olpidium brassicae. II Z o o s p o r e s . Can. J. Bot. 47:227-231. T e m m i n k , J.H.M., a n d C a m p b e l l , R.N. ( 1 9 6 9 b ) . T h e u l t r a s t r u c t u r e o f Olpidium brassicae. D X I n f e c t i o n o f h o s t r o o t s . Can. J. Bot. 47:421-424. T e m m i n k , J.H.M., C a m p b e l l , R.N., a n d S m i t h , P.R. ( 1 9 7 0 ) . S p e c i f i c i t y a n d s i t e o f in vitro a c q u i s i t i o n o f t o b a c c o n e c r o s i s v i r u s b y z o o s p o r e s o f Olpidium brassicae. J. Gen. Virol. 9:201-213. T h o r n b u r y , D.W., H e l l m a n , G.M., R h o a d s , R.E., a n d P i r o n e , T.P. ( 1 9 8 5 ) . P u r i f i c a t i o n a n d c h a r a c t e r i z a t i o n o f p o t y v i r u s h e l p e r c o m p o n e n t . Virology 144:260-267. T h o r n b u r y , D.W., P a t t e r s o n , C.A., D e s s e n s , J.T., a n d P i r o n e , T.P. ( 1 9 9 0 ) . C o m p a r a t i v e s e q u e n c e o f t h e h e l p e r c o m p o n e n t ( H C ) r e g i o n o f p o t a t o v i r u s Y a n d a H C - d e f e c t i v e s t r a i n , p o t a t o v i r u s C . Virology 178:573-578. T j a l l i n g i i , W.F. ( 1 9 8 5 ) . M e m b r a n e p o t e n t i a l s as a n i n d i c a t i o n f o r p l a n t c e l l p e n e t r a t i o n b y a p h i d s t y l e t s . Entomol. Exp. Appl. 38:187-195. T o m a s s i n i , J.E., M a x s o n , T.R., a n d C o l o n n o , R.J. ( 1 9 8 9 ) . B i o c h e m i c a l c h a r a c t e r i z a t i o n o f a g l y c o p r o t e i n r e q u i r e d f o r r h i n o v i r u s a t t a c h m e n t . J. Biol. Chem. 264:1656-1662. U l l m a n , D.E., C h o , J.J., M a u , R.F.L, W e s t c o t , D.M., a n d C u s t e r , D.M. ( 1 9 9 2 ) . M i d g u t e p i t h e l i a l c e l l s a c t as a b a r r i e r t o t o m a t o s p o t t e d w i l t v i r u s a c q u i s i t i o n b y a d u l t w e s t e r n f l o w e r t h r i p s . Phytopathology 8 2 :1333-1342. U l l m a n , D.E., W e s t c o t , D.M., C h e n a u l t , K.D., S h e r w o o d , J.L., G e r m a n , T.L., B a n d l a , M.D., C a n t o n e , F.A., a n d D u e r , H.L. ( 1 9 9 5 ) . C o m p a r t m e n t a l i z a t i o n , i n t r a c e l l u l a r t r a n s p o r t , a n d a u t o p h a g y o f t o m a t o s p o t t e d w i l t t o s p o v i r u s p r o t e i n s i n i n f e c t e d t h r i p s c e l l s . Phytopathology 85:644-654. 154 v a n d e n H e u v e l , J.F.J.M., V e r b e e k , M., a n d v a n d e r W i l k , F . ( 1 9 9 4 ) . E n d o s y m b i o t i c b a c t e r i a a s s o c i a t e d w i t h c i r c u l a t i v e t r a n s m i s s i o n o f p o t a t o l e a f r o l l v i r u s b y Myzus persicae. J. Gen. Virol. 75:2559-2565. v a n d e n H e u v e l , J.F., B r u y e r e , A., H o g e n h o u t , S.A., Z i e g l e r - G r a f f , V., B r a u l t , V., V e r b e e k , M., v a n d e r W i l k , F., a n d R i c h a r d s , K. ( 1 9 9 7 ) . T h e N - t e r m i n a l r e g i o n o f t h e l u t e o v i r u s r e a d t h r o u g h d o m a i n d e t e r m i n e s v i r u s b i n d i n g t o B u c h n e r a G r o E L a n d i s e s s e n t i a l f o r v i r u s p e r s i s t e n c e i n t h e a p h i d . J. Virol. 71:7258-7265. v a n d e n H e u v e l J.F., H o g e n h o u t S.A., a n d v a n d e r W i l k F. ( 1 9 9 9 ) . R e c o g n i t i o n a n d r e c e p t o r s i n v i r u s t r a n s m i s s i o n b y a r t h r o p o d s . T r e n d s M i c r o b i o l 7:71-76. V a n H o o f , H . A . ( 1 9 7 0 ) . S o m e o b s e r v a t i o n s o n r e t e n t i o n o f t o b a c c o r a t t l e v i r u s i n n e m a t o d e s . Neth. J. Plant Pathol. 76:329-330. V i l e , R.G., a n d W e i s s , R.A. ( 1 9 9 1 ) . V i r u s r e c e p t o r s as p e r m e a s e s . Nature 352:666-667. V i n c e n t , J.R., U e n g , P.P., L i s t e r , R.M., a n d L a r k i n s , B . A . ( 1 9 9 0 ) . N u c l e o t i d e s e q u e n c e o f c o a t p r o t e i n g e n e s f o r t h r e e i s o l a t e s o f b a r l e y y e l l o w d w a r f v i r u s a n d t h e i r r e l a t i o n s h i p s t o o t h e r l u t e o v i r u s c o a t p r o t e i n s e q u e n c e s . /. Gen. Virol. 71:2791-2800. V i s s e r , P.B., B r o w n , D.J.F., B r e d e r o d e , F.T., a n d B o l , J. F. ( 1 9 9 9 ) . N e m a t o d e t r a n s m i s s i o n o f t o b a c c o r a t t l e v i r u s s e r v e s as a b o t t l e n e c k t o c l e a r t h e v i r u s p o p u l a t i o n f r o m d e f e c t i v e i n t e r f e r i n g R N A s . Virology 263:155-165. V l a s a k , R., L u y t j e s , W., S p a a n , W., a n d P a l e s e , P. ( 1 9 8 8 ) . H u m a n a n d b o v i n e c o r o n a v i r u s e s r e c o g n i z e s i a l i c a c i d - c o n t a i n i n g r e c e p t o r s s i m i l a r t o t h o s e o f i n f l u e n z a C v i r u s e s . P r o c . N a t l . A c a d . S c i . U S A 85:4526-4529. W a n g , J.Y., C h a y , C , G i l d o w , F.E., a n d G r a y , S.M. ( 1 9 9 5 ) . R e a d t h r o u g h p r o t e i n a s s o c i a t e d w i t h v i r i o n s o f b a r l e y y e l l o w d w a r f l u t e o v i r u s a n d it s p o t e n t i a l r o l e i n r e g u l a t i n g t h e e f f i c i e n c y o f a p h i d t r a n s m i s s i o n . Virology 206:954-962. W a n g , H., K a v a n a u g h , M.P., N o r t h , R.A., a n d K a b a t , D . ( 1 9 9 1 ) . C e l l - s u r f a c e r e c e p t o r f o r e c o t r o p i c m u r i n e r e t r o v i r u s e s i s a b a s i c a m i n o a c i d t r a n s p o r t e r . Nature 352:729-731. W a n g , R.Y., A m m a r , E.D., T h o r n b u r y , D.W., L o p e z - M o y a , J.J., a n d P i r o n e , T.P. ( 1 9 9 6 ) . L o s s o f p o t y v i r u s t r a n s m i s s i b i l i t y a n d h e l p e r - c o m p o n e n t a c t i v i t y c o r r e l a t e w i t h n o n -r e t e n t i o n o f v i r i o n s i n a p h i d s t y l e t s . J. Gen. Virol. 77:861-867. W a n g , R.Y., P o w e l l , G., H a r d i e , J., a n d P i r o n e , T.P. ( 1 9 9 8 ) . R o l e o f t h e h e l p e r c o m p o n e n t i n v e c t o r - s p e c i f i c t r a n s m i s s i o n o f p o t y v i r u s e s . J. Gen. Virol. 79:1519-1524. W a t s o n , M . A., a n d P l u m b , R. T. ( 1 9 7 2 ) . T r a n s m i s s i o n o f p l a n t - p a t h o g e n i c v i r u s e s b y a p h i d s . Annu. Rev. Entomol. 17:425-452. 155 W e b e r , I. ( 1 9 8 6 ) . C u c u m b e r l e a f s p o t v i r u s . CMI/AAB Description of Plant Viruses, N o . 319 . W e i s , W., B r o w n , J.H., C u s a k , S., P a u l s o n , J . C , S k e h e l , J.J., a n d W i l e y , D.C. ( 1 9 8 8 ) . S t r u c t u r e o f t h e i n f l u e n z a v i r u s h a e m a g g l u t i n i n c o m p l e x e d w i t h i t s r e c e p t o r , s i a l i c a c i d . Nature 333:426-431. W h i t e , J.M., a n d L i t t m a n , D.R. ( 1 9 8 9 ) . V i r a l r e c e p t o r s o f t h e i m m u n o g l o b u l i n s u p e r f a m i l y . Cell 56:725-728. W h i t e , K.A., B a n c r o f t , J.B., a n d M a c k i e , G.A. ( 1 9 9 1 ) . D e f e c t i v e R N A s o f c l o v e r y e l l o w m o s a i c v i r u s e n c o d e n o n s t r u c t u r a l / c o a t p r o t e i n f u s i o n p r o d u c t s . Virology 183:479-486. W i l e y , D . C , a n d S k e h e l , J.J. ( 1 9 8 7 ) . T h e s t r u c t u r e a n d f u n c t i o n o f t h e h e m a g g l u t i n i n m e m b r a n e g l y c o p r o t e i n o f i n f l u e n z a v i r u s . Annu. Rev. Biochem. 56:365-394. W i l l i a m s , R.K., J i a n g , G.S., a n d H o l m e s , K . V . ( 1 9 9 1 ) . R e c e p t o r f o r m o u s e h e p a t i t i s v i r u s i s a m e m b e r o f t h e c a r c i n o e m b r y o n i c a n t i g e n f a m i l y o f g l y c o p r o t e i n s . Proc. Natl. Acad. Sci. USA 88:5533-5536. X i o n g , Z., a n d L o m m e l , S.A. ( 1 9 8 9 ) . T h e C o m p l e t e n u c l e o t i d e s e q u e n c e a n d g e n o m e o r g a n i z a t i o n o f r e d c l o v e r n e c r o t i c m o s a i c v i r u s R N A - 1 . Virology 171:543-554. Y e a g e r , C.L., A s h m u n , R.A., W i l l i a m s , R.K., C a r d e l l i c h i o , C.B., S h a p i r o , L.H., L o o k , A.T., a n d H o l m e s , K . V . ( 1 9 9 2 ) . H u m a n a m i n o p e p t i d a s e N i s a r e c e p t o r f o r h u m a n c o r o n a v i r u s 2 2 9 E . Nature 357:420-422. 156 


Citation Scheme:


Citations by CSL (citeproc-js)

Usage Statistics



Customize your widget with the following options, then copy and paste the code below into the HTML of your page to embed this item in your website.
                            <div id="ubcOpenCollectionsWidgetDisplay">
                            <script id="ubcOpenCollectionsWidget"
                            async >
IIIF logo Our image viewer uses the IIIF 2.0 standard. To load this item in other compatible viewers, use this url:


Related Items