UBC Theses and Dissertations

UBC Theses Logo

UBC Theses and Dissertations

Evaluation of the roles of protein serine/threonine kinases in the metabolic actions of insulin Zhande, Rachel 1998

Your browser doesn't seem to have a PDF viewer, please download the PDF to view this item.

Item Metadata

Download

Media
831-ubc_1998-272737.pdf [ 14.11MB ]
Metadata
JSON: 831-1.0088775.json
JSON-LD: 831-1.0088775-ld.json
RDF/XML (Pretty): 831-1.0088775-rdf.xml
RDF/JSON: 831-1.0088775-rdf.json
Turtle: 831-1.0088775-turtle.txt
N-Triples: 831-1.0088775-rdf-ntriples.txt
Original Record: 831-1.0088775-source.json
Full Text
831-1.0088775-fulltext.txt
Citation
831-1.0088775.ris

Full Text

EVALUATION OF THE ROLES OF PROTEIN SERINE/THREONINE KINASES IN THE METABOLIC ACTIONS OF INSULIN. by RACHEL ZHANDE B.Sc, Technische Fachhochschule, Berlin, 1985 M.Sc., The University of British Columbia, 1992 A THESIS SUBMITTED IN PARTIAL FULFILLMENT OF T H E REQUIREMENTS FOR THE DEGREE OF DOCTOR OF PHILOSOPHY in T H E F A C U L T Y OF GRADUATE STUDIES DEPARTMENT OF BIOCHEMISTRY AND M O L E C U L A R BIOLOGY We accept this thesis as conforming to the required standard THE UNIVERSITY OF BRITISH COLUMBIA December, 1997 © Rachel Zhande, 1997 In presenting this thesis in partial fulfilment of the requirements for an advanced degree at the University of British Columbia, I agree that the Library shall make it freely available for reference and study. I further agree that permission for extensive copying of this thesis for scholarly purposes may be granted by the head of my department or by his or her representatives. It is understood that copying or publication of this thesis for financial gain shall not be allowed without my written permission. Department of fciocH£M/grg>/ g- molecular & The University of British Columbia Vancouver, Canada Date teCQ-Mhtf IS , DE-6 (2/88) A B S T R A C T Protein phosphorylation plays a central role in the biological effects of insulin. A number of proteins display increases in serine/threonine (Ser/Thr) phosphorylation in response to the hormone and include acetyl-CoA carboxylase (ACC) and the ribosomal protein S6. These phosphorylations are mediated by a discrete number of Ser/Thr protein kinases which are stimulated by the hormone. While the S6 kinases have been purified and are well characterized, very little is known about the insulin stimulated ACC-kinase. This study evaluated the roles of three different classes of the mitogen-activated protein (MAP) kinase family (ERKs, JNKs and p38) and that of protein kinase B in the metabolic responses of insulin in rat white adipose tissue. Initial evidence led to the hypothesis that an insulin-stimulated myelin basic protein (MBP) kinase may be an important ACC-kinase. A MBP kinase was highly purified from rat adipose tissue and displayed a number of properties indicating it was a member of the family of MAP kinases. However, the adipose tissue MBP kinase did not phosphorylate the insulin-directed site on A C C and did not induce insulin-like activation of ACC, indicating that it was not an ACC-kinase. This result therefore, argues strongly against the initial hypothesis that MBP/MAP kinases were significant insulin-stimulated ACC-kinases. Further characterization of the fat cell MBP kinase revealed its close association with the actin cytoskeleton. It is proposed that the cytoskeleton may act as an interface to nucleate signaling elements. This would provide efficiency and fidelity in signaling. Because extracellular osmolarity (and consequent regulation of cell volume) affects ! the three classes of MAP kinases and also influences liver carbohydrate metabolism, the effects of insulin and osmolarity on fatty acid biosynthesis and the activation state of the three classes of MAP kinases were therefore, investigated in adipose tissue. Changes in extracellular osmolarity alone, over the range from hypo-osmotic (228 mOsM) to hyper-osmotic (404 mOsM) did not stimulate fatty acid biosynthesis in adipose tissue. Insulin ii stimulated the pathway to an equivalent extent under iso-osmotic (316 mOsM), hypo- and hyper-osmotic conditions. The activation of the ERKs differed from that of fatty acid synthesis, since hypo-osmotic medium alone activated the ERKs and because the activation of the ERKs was blocked in hyper-osmotic medium. Unlike fatty acid synthesis, JNKs were activated by both hypo-osmotic and hyper-osmotic medium in the absence of insulin. The activation state of p38 judged by tyrosine phosphorylation of p38, by associated MBP kinase activity or by the activity of a downstream heat-shock protein kinase was not affected by changes in osmolarity (200-400 mOsM) or by insulin. In conclusion, within a moderate physiological range, extracellular osmolarity did not lead to changes in the rates of de novo fatty acid synthesis in rat white adipose tissue (in contrast to previous studies with isolated rat hepatocytes). Therefore, activations of ERK1 and ERK2 are neither necessary nor sufficient for the activation of fatty acid biosynthesis. The p38 pathway was insensitive to insulin and activation of JNKs did not correlate with the stimulation of fatty acid biosynthesis. A newly-discovered protein kinase B (PKB), is insulin-activated and appears to play a significant role in regulating glycogen synthase. I therefore, examined the role of PKB in A C C regulation. Insulin provoked a rapid and sustained activation of PKB in rat white adipose. The activation of PKB was associated with a retardation of the mobility of the PKB protein on SDS-PAGE gels and was especially prominent in membrane fractions of rat adipose tissue. PKB immunoprecipitates strongly phosphorylated A C C and showed a striking preference for the 265-kDa A C C isoform. The major tryptic phosphopeptide from A C C phosphorylated by PKB immunoprecipitates co-migrated on 2-dimensional thin layer and high pressure chromatography with that obtained from A C C following phosphorylation with AMP-activated protein kinase (AMP-PK). Unlike AMP-PK, however, PKB immunoprecipitates did not phosphorylate the optimum (SAMS) peptide substrate. Furthermore, unlike AMP-PK, phosphorylation of A C C with PKB immunoprecipitates did not affect the enzymatic activity of ACC. iii Because specific PKB inhibitors are not yet available, we examined the effects of vanadium to shed light on the potential significance of PKB activation. Vanadium activated PKB, glycogen synthase and fatty acid biosynthesis with very similar dose dependencies. The maximal effects of vanadium were similar to the maximal effects of insulin and were not additive. PKB may therefore be required in the activation of glycogen synthase and fatty acid biosynthesis but further studies will be required to confirm that (ideally with PKB antagonists). In contrast, the anti-lipolytic effects of vanadium were evident at concentrations substantially below that required for PKB activation. Therefore, not all metabolic responses of vanadium are dependent on PKB activation. iv T A B L E O F C O N T E N T S Abstract ii Table of contents v List of tables ix List of figures x List of abbreviations xii Acknowledgements xiii CHAPTER 1 1 INTRODUCTION 1 1.1 OVERVIEW OF INSULIN SIGNALING 1 1.2 INSULIN RECEPTOR 1 1.2.1 Structure of the insulin receptor 2 1.2.2 Insulin binding and activation of tyrosine kinase 3 1.2.3 Protein which interact with the insulin receptor 7 1.3 POST RECEPTOR SIGNALING EVENTS 14 1.3.1 Glucose transport 16 1.3.2 Glycogen synthesis 19 1.3.3 Fatty acid synthesis 21 1.3.4 Protein synthesis 22 1.3.4.1 Gene transcription 23 1.3.4.2 Translation of mRNA 24 1.4 POSSIBLE MECHANISMS INVOLVED IN INSULIN ACTION 28 1.4.1 Second messengers (in insulin action) 29 1.4.2 Protein phosphorylation/dephosphorylation 30 1.4.2.1 Insulin-stimulated protein serine/threonine kinases 34 1.4.2.1.1 MAP kinase isoforms 36 1.4.2.1.2 S6 kinases 48 1.4.2.1.3 Protein kinase B 50 1.5 THESIS INVESTIGATION 53 CHAPTER 2 EXPERIMENTAL PROCEDURES 56 2.1 MATERIALS 56 2.2 METHODS 57 2.2.1 Tissue isolation, incubation and processing 57 Preparation of isolated fat cells 58 2.2.2 Purification of MBP kinase 58 v Polylysine chromatography 58 Size exclusion chromatography of MBP kinase 58 Heparin-agarose chromatography 58 Mono Q anion-exchange chromatography 58 2.2.3 Source Q chromatography of insulin osmo-sensitive MAPKs .60 2.2.4 Protein kinase assays 60 S6 kinases 60 MBP kinases 60 c-Jun kinases 61 Hsp27 kinases 61 PKB 64 2.2.5 Fatty acid biosynthesis 62 2.2.6 Glycogen synthase assay 62 2.2.7 Lipolysis 62 Glycerol assay 63 2.2.8 Acetyl-CoA carboxylase activity 63 2.2.9 Immunoprecipitations 64 Protein kinase B 64 MBP kinase 64 Actin 65 p38 Hog MAP kinase 65 2.2.10 SDS-PAGE and autoradiography 66 2.2.11 Western blotting 66 2.2.12 Protein determination and statistical analysis 67 2.2.13 Immunofluorescence 68 CHAPTER 3 STABILIZATION, PURIFICATION AND CHARACTERIZATION OF A N INSULIN STIMULATED MBP KINASE F R O M RAT ADIPOSE TISSUE 69 3.0 RATIONALE 69 3.1 RESULTS AND DISCUSSION 70 3.1.1 Stabilization of rat fat cell MBP kinase 70 3.1.2 Purification of fat cell MBP kinase 72 3.1.3 Immunological identification of the MBP kinase as a M A P kinase 80 3.1.4 Phosphorylation of ACC by the purified fat cell MBP kinase... 83 3.1.5 Characterization of the MBP kinase 85 Other substrates of the MBP kinase 85 Effects of pH, salts, activators and inhibitors 93 Detection of phosphotyrosine and autophosphorylation of the MBP kinase 98 Deactivation by phosphatases 101 Reactivation of MBP kinase 103 vi 3.2 S U M M A R Y 106 CHAPTER 4 CO-PURIFICATION OF ACTIN AND THE MBP KINASE: IS IT COINCIDENTAL OR DOES IT INDICATE A SPECIFIC INTERACTION? 107 4.0 RATIONALE 107 4.1 RESULTS AND DISCUSSION 109 4.1.1 Identification of actin as a major contaminant of the MBP kinase 109 4.1.2 Does the copurification of actin and the MBP kinase imply a meaningful association between the proteins I l l 4.1.3 Copurification of actin and the MBP kinase on size exclusion columns I l l 4.1.4 Immunofluorescence staining of actin and the MBP kinase 119 4.2 S U M M A R Y : 121 CHAPTER 5 DIFFERENTIAL REGULATION OF MAP KINASE ISOFORMS B Y INSULIN AND E X T R A C E L L U L A R OSMOLARITY IN RAT WHITE ADIPOSE TISSUE 123 5.0 RATIONALE 123 5.1 RESULTS AND DISCUSSION 124 5.1.1 Effects of insulin and extracellular osmolarity on fatty acid biosynthesis 124 5.1.2 Effects of insulin and extracellular osmolarity on ERK isoforms 127 5.1.3 Effects of insulin and extracellular osmolarity on JNK/SAPK isoforms 138 5.1.4 Effects of insulin and extracellular osmolarity on Hog MAP kinase 142 5.2 SUMMARY 147 CHAPTER 6 ACTIVATION OF PKB B Y INSULIN AND VANADIUM. T H E R O L E OF PKB IN THE METABOLIC FUNCTIONS OF INSULIN 148 6.0 RATIONALE 148 6.1 RESULTS AND DISCUSSION 149 6.1.1 Distribution of PKB in rat tissues 149 6.1.2 Activation of PKB by insulin 151 vii 6.1.3 Phosphorylation of ACC with PKB immunoprecipitates 158 6.1.4 Activation of PKB with vanadium mimics insulin action 166 6.1.5 Activation of glycogen synthase and PKB with vanadium... 168 6.1.6 Antilipolytic effects of vanadium and the activity of PKB 170 6.2 S U M M A R Y 173 CHAPTER 7 CONCLUSIONS ! 175 REFERENCES 179 viii LIST O F T A B L E S Table 1. Major insulin responses occuring in liver, fat and muscle 15 Table 2. Mammalian glucose transporters 17 Table 3. Proteins exhibiting changes in phosphorylation in fat cells exposed to insulin 33 Table 4. Insulin-sensitive serine/threonine protein kinases 35 Table 5. Characteristics of ERK isoforms 45 Table 6. Characteristics of MAPK isoforms 48 Table 7. Purification of MBP kinase 79 Table 8. Effects of GTP and M n 2 + on the activity of the MBP kinase 86 Table 9. Substrate specificity of the purified MBP kinase 92 Table 10. Effect of phalloidin on the elution of actin and MBP kinase on Superdex 200 column 117 Table 11. Effect of phosphorylation on the enzymatic activity of A C C 165 ix LIST O F FIGURES Figure 1 Pathways emerging from the insulin receptor 8 Figure 2. Signaling pathway (s) leading to the activation of the guanine-nucleotide exchange factor eEF-2B 26 Figure 3 Cellular responses that depend on MAP kinases in yeast 37 Figure 4. Polylysine-agarose chromatography of rat fat cell MBP kinases 75 Figure 5. Size exclusion chromatography of fat cell MBP kinases 76 Figure 6. Mono Q anion exchange chromatography of fat cell MBP kinases.. 77 Figure 7. Immunological identification of the MBP kinase 82 Figure 8. Phosphorylation of A C C with the purified MBP kinase 84 Figure 9. Evidence that the purified MBP kinase is pro-directed 88 Figure 10. Phosphoamino acid and phosphopeptide analysis of MBP phosphorylated with purified MBP kinase 90 Figure 11. Effect of pH on the activity of the MBP kinase 96 Figure 12. Effects of KF and P-glycerolphosphate on the activity of the MBP kinase 97 Figure 13. Autophosphorylation and detection of phosphotyrosine 99 Figure 14. Lack of autoactivation upon autophosphorylation of MBP kinase.... 100 Figure 15. Deactivation of MBP kinase by phosphotyrosine phosphatase-IB... 102 Figure 16. Reactivation of MBP kinase by MEKl(AN3) 105 Figure 17. Characterization of MBP kinase activities by Sephacryl S-200 HR size exclusion chromatography 115 Figure 18. Identification of actin and MAPK in Superdex 200 fractions of fat cell extracts 116 Figure 19. Co-immunoprecipitation of actin and the MBP kinase 118 Figure 20. Co-localization of actin and MAPK in NIH 3 T3 fibroblasts 120 Figure 21. Effects of insulin and osmolarity on fatty acid biosynthesis 126 Figure 22. Activation of ERK1 and ERK2 by insulin 130 Figure 23. Activation of ERK1 and ERK2 by insulin and osmolarity 135 Figure 24. Activation of JNK/SAPK by insulin and osmolarity 139 Figure 25. Time course of JNK activation and deactivation 140 Figure 26. Activation of p38 by hyperosmolarity 144 Figure 27. Distribution of PKB in rat tissues.....' 150 Figure 28. Insulin increases the apparent molecular weight of PKB protein on SDS-PAGE gels 155 Figure 29. Insulin promotes rapid activation of PKB in rat adipose tissue 156 Figure 30. Insulin induces sustained and prominent activation of membrane-associated PKB in rat white adipose tissue 157 Figure 31. Phosphorylation of ACC with PKB immunoprecipitates 162 Figure 32. Schematic tryptic phosphopeptide map of A C C 163 Figure 33. Two-D mapping of ACC tryptic phosphopeptides following phosphorylation with PKB immunoprecipitates 164 Figure 34. Vanadium stimulates PKB in rat white adipose tissue 167 Figure 35. Activation of glycogen synthesis by vanadium 169 x Figure 36. Antilipolytic effects of vanadium \ 172 xi LIST O F ABBREVIATIONS. Abl Cytoplasmic tyrosine kinase, first identified as an oncoprotein in the Abelson murine leukemia virus A C C Acetyl-Coenzyme A carboxylase A C L ATP-citrate lyase AKAP79 A-kinase anchoring protein 79 AMP Adenosine 5-monophosphate AMP-PK AMP-activated protein kinase ATP Adenosine 5'-triphosphate BSA Bovine serum albumin Btk Bruton's tyrosine kinase C-16 Anti-MAPK antibody cAMP Cyclic adenosine monophosphate CHO cells Chinese hamster ovary cells CKII Casein kinase II cpm Counts per minute CREB Cyclic adenosine monophosphate response element-binding protein CSAID Cytokine suppressive anti-inflammatory drug CSBP CSAID binding protein D M E Dubelcco's modified Eagle medium dpm Disintegrations per minute D T T Dithiothreitol E D T A Ethylenediaminetetraacetic acid eEF Eukaryotic elongation factor EGF Epidermal growth factor E G T A Ethyleneglycol-bis(P-amino ethyl ether)N,N,N',N'-tetra acetic acid elF Eukaryotic initiation factor ERK Extracellular-regulated protein kinase FGF Fibroblast growth factor FITC Fluorescein isothiocyanate FKBP12 FK506-binding protein 12 FPLC Fast protein liquid chromatography FRAP FKBP-rapamycin associated protein GAPDH Glyceraldehyde-3 -phosphate dehydrogenase G C K Germinal centre kinase GDP Guanosine 5'-diphosphate Grb2 Growth factor receptor binding protein 2 GSK3 Glycogen synthase kinase 3 GST Glutathion-S-transferase GTP Guanosine 5'-triphosphate Hepes N - [2-hydroxyethyl] piperazine-N'- [2-ethanesulfonic acid] HOG1 High osmolarity glycerol response 1 HRP Horseradish peroxidase HSP27 Heat shock protein 27 xii HSS High speed supernatant H V E High voltage electrophoresis 50 % inhibitory concentration IGF-1 Insulin-like growth factor 1 IL-1/2 Interleukin 1 or 2 IRE Insulin responsive element IRS Insulin receptor substrate ISPK Insulin stimulated protein kinase JNK c-Jun N-terminal protein kinase JNKK JNK kinase K a Dissociation constant LPS Lipopolysaccharide M A P K Microtubule-associated or mitogen-activated kinase (also called ERK) M A P K A P K MAP kinase-activated protein kinase MBP Myelin basic protein M E K MAP kinase/ERK kinase M E K K M E K kinase M K K Mitogen-activated protein kinase kinase (MEK) Mops 3-[N-morpholino]propanesulfonic acid mSos Mammalian homologue of Son-of-sevenless mTOR Mammalian target of rapamycin NADP Nicotinamide adenine dinucleotide phosphate Nek A 47-kDa "adaptor" protein with 3 SH3 and 1 SH2 domains NF-AT Nuclear factor for activated T-cells NGF Nerve growth factor NP 40 Nonidet P 40 ODC Ornithine decarboxylase p 7 0 s 6 k p70 S6 kinase p 9 0 r s k p90 ribosomal S6 kinase PAGE Polyacrylamide gel electrophoresis PAK p21-activated protein kinase PBS Phosphate buffered saline P B S + + PBS supplemented with calcium and magnesium PDGF Platelet-derived growth factor PEPCK Phosphoenolpyruvate kinase PFK-2 6-Phosphofructo-2-kinase PH Pleckstrin homology PHAS-1 Phosphorylated heat- and acid-stable protein 1 PI-3K Phosphatidylinositol -3 kinase PKA Protein kinase A PKB Protein kinase B (between kinase A and C), also called R A C or A K T PKC Protein kinase C PKI Protein kinase A inhibitor peptide PLC Phospholipase C PP1 Protein phosphatase! xiii PP 1G Glycogen-associated form of PP 1 PP2A Protein phosphatase 2A PTB Phosphotyrosine binding domain Ptdlns-3P Phosphatidylinositol 3-phosphate PtdIns(3,4)P2 Phosphatidylinositol 3, 4-diphosphate PtdIns(3,4,5)P3 Phosphatidylinositol 3,4,5-trisphosphate PTP1D Phosphotyrosine phosphatase ID (also known as SHPTP2, PTP2C or Syp) PVDF Polyvinylidene difluoride R2 Anti-MAPK antibody R A C Related to PKA and PKC (also called PKB or Akt) RAFT Rapamycin-FKBP target RK MAPKAP kinase-2 reactivating kinase R N A Pol I R N A polymerase I R P M Revolutions per minute SAPK Stress activated protein kinase (also called JNK) SDS Sodium dodecyl sulphate SEK SAPK kinase. Also known as JNKK SH2/3 Src homology 2 or 3 She Src-homology/collagen protein SHPTP2 SH2 domain containing phosphotyrosine phosphatase 2 (also called PTP1D, PTP2C or Syp) Sos Son-of-sevenless Src A 54-kDa cytoplasmic tyrosine kinase oncogene, originally named as a product of the Rous sarcoma virus. Syp Protein tyrosine phosphatase (also known as PTP1D, PTP2C or SHPTP2) T L C Thin layer chromatography TNF Tumor necrosis factor TOR Target of rapamycin UBF Upstream binding factor U T R 5'untranslated regions U V Ultraviolet light xiv A C K N O W L E D G E M E N T I would like to thank Dr. Frank Jirik for the PTP-1B phosphatase, Dr Pauline Johnson for providing the CD45 phosphatase, Dr. Steven Pelech for various kinase antibodies and substrates and Adrienne Boone for purified acetyl-CoA carboxylase. I am grateful to Dr. Michel Roberge, Dr Brett Finlay, Df Olivia Steele-Mortimer, Dr. Murry Stein, Sharon Ruschkowski and Dr. Elaine Humphfrey for reagents and assistance with the immunocytochemical work. I would also like to thank Dr. Chris Mcintosh for assistance with the FfPLC work, Dr. Richard Roth for assays with recombinant PKB, Dr. Sanjay Bhanot for the collaboration with the PKB work and Dr. Jasbinder Sanghera and Aleksander Cuk for their contributions in the osmolarity study. I gratefully acknowledge the input of my research committee, Drs. Philip Bragg and Steven Pelech. Finally, but not least, I would like to express my sincere gratitude to my research supervisor, Dr. Roger Brownsey for his excellent guidance as well as for the financial support. xv CHAPTER ONE INTRODUCTION 1.1 OVERVIEW OF INSULIN SIGNALING. Insulin exerts a broad range of effects on cell metabolism and plays a critical role in regulation of blood glucose concentration. The 5.8-kDa protein hormone is released from the B-cells of the pancreas in response to elevated blood glucose and amino acids. Upon delivery to target tissues, insulin activates transport systems and enzymes involved in intracellular utilization and storage of glucose, amino acids and fatty acids, while inhibiting hepatic glucose production and catabolic processes such as breakdown of glycogen, fat and protein. Most insulin-sensitive enzymes exhibit changes in protein serine/threonine (Ser/Thr) phosphorylation which is mediated by protein kinases and phosphatases. In addition to its metabolic effects, insulin promotes normal cellular growth and differentiation by regulation of gene transcription, mRNA turnover, protein and D N A synthesis. Insulin signaling is therefore important in the storage and utilization of ingested fuels, as well as promoting normal cellular growth and differentiation. The biological importance of these effects of insulin are most apparent in cases where the body fails to produce or respond to insulin, leading respectively, to Types I and II diabetes. Understanding the molecular mechanisms underlying normal insulin action is a major scientific goal and may provide new avenues of research into the treatment of diabetes. The work described in this thesis has examined the role of insulin-stimulated protein Ser/Thr kinases (mitogen-activated protein (MAP) kinases and protein kinase B), and the impact they have on some of the metabolic effects of the hormone. 1.2 THE INSULIN RECEPTOR. The pleiotropic effects of insulin are initiated by binding of the hormone to its specific cell surface receptor (Kahn, 1985; Freychet etal, 1971; Cuatrecasas, 1972), thus 1 activating the insulin receptor tyrosine kinase, with consequent phosphorylation of •'35 endogenous substrates (Kasuga et al., 1982a, White et al., 1987). Essentially, all mammalian tissues express the insulin receptor. However, the number of receptors varies, with the highest concentration (>300,000 receptors per cell) being found on two of insulin's major target tissues, adipose and liver (Kahn etal., 1981). Interestingly, skeletal muscle, the other major insulin target tissue, tends to have a relatively lower concentration of insulin receptors and higher concentration of insulin-like growth factor-I receptors (Caro et al., 1987). Normal plasma insulin levels range from 10~10-10~9 M which is lower than the average insulin binding affinity therefore, the larger number of insulin receptors located on target ensures rapid binding kinetics (Kahn et al., 1981, Gammeltoft, 1984). 12,I STRUCTURE OF THE INSULIN RECEPTOR In its native conformation, the insulin receptor is composed of two a- and two p-subunits which are disulphide-linked to form a heterotetrameric integral membrane glycoprotein of structure P-a-a-P. The mature heterotetramer has a relative molecular mass (Mr) of approximately 350,000 as estimated by non-reducing sodium dodecyl sulphate-polyacrylamide gel electrophoresis (SDS-PAGE). The a-subunit consists of 723 or 712 amino acids and has a Mr of 135,000 on reducing SDS-PAGE. A single site of alternative splicing exists on exon 11, leading to the two receptor isoforms which differ by twelve amino acids near the C-terminus of the a- subunit. The P-subunit contains 620 amino acids and has an approximate Mr of 95,000 on reducing SDS-PAGE gels (Massague et al., 1981; Kasuga et al., 1982b). The two a-subunits are are considered to be linked by "weak" Type I disulfide bonds whereas, relatively "strong" Type II disulfide bonds covalently link each P-subunit to an a-subunit (Massague and Czech, 1982). This distinction between "weak" and "strong" is made on the basis of different sensitivity to reducing treatment. Type I linkages can be reduced under mild conditions (0.5 mM dithiothreitol) yielding ocP-heterodimers that bind ligand with lower affinity than the 2 holoreceptors (Boni-Schnetzler et al, 1987; Sweet et al, 1987). In contrast, strong reducing conditions are required to separate a and subunits. Each a and P dimer is derived from a single proreceptor precursor by proteolytic processing. Both receptor subunits are glycosylated which accounts for the discrepancy between the predicted and observed molecular mass. The a-subunit is completely extracellular and contains the insulin binding site. The P-subunit traverses the membrane (with a single transmembrane span) and contains an intracellular tyrosine-specific protein kinase domain which includes the A T P binding site and all other classical protein kinase domains (I-XII) defined by Hanks et al., (1988). It is the P-subunit which is autophosphorylated on tyrosine residues upon the binding of insulin to the a-subunit. The insulin receptor and the highly homologous IGF-I receptor are members of the type II class of tyrosine receptors which contain cysteine-rich motifs in their extracellular a-subunits and are disulfide-linked heterotetramers (Ullrich and Schlessinger, 1990). 1.2.2 INSULIN BINDING AND ACTIVA TION OF TYROSINE KINASE. Insulin signaling begins when the hormone binds with high affinity to the a-subunit o f the receptor. The exact identity of domain structures involved in high affinity ligand binding is not quite known. A compilation o f studies o f the insulin receptor has been reported by Tavare and Siddle, (1993) and by Cheatham and Kahn, (1995). Briefly, affinity and chemical cross-linking of insulin indicated that the binding site was contained predominantly within the amino-terminal half of the a-subunit (Yip et al, 1988; Wedekind et al, 1989). Attempts to identify residues on the receptor which interact with insulin by mutagenesis analysis proved somewhat difficult and controversial. For example, in one study, deletion of the cysteine-rich domain (residues 124-329) abolished insulin binding (Yip et al, 1988). In a separate study, a substantial amino-terminal deletion (amino acids 7-90) abrogated insulin binding, although a smaller deletion (residues 1-66) did not affect insulin binding (De Meyts etal, 1991). Analysis by site-directed mutagenesis failed to 3 point to the exact residues important in ligand binding (Tavare and Siddle, 1993). Failure of mutagenesis analysis to yield unequivocal results may probably arise from the inherent limitation of the procedure. For example, receptor mutations outside the binding site may alter the oc-subunit conformation and therefore influence ligand-binding indirectly. In addition, some mutations may lead to receptor mis-folding or instability which may affect parameters such as the number and affinity of the expressed constructs. A rigorous analysis of the effects of altering receptor primary sequence should therefore include measurement of efficiency of receptor expression and of I C 5 0 values from competition binding studies or determination of K d values from Scatchard plots. These limitations have contributed to the fact that precise details of ligand receptor interaction sites have still not been fully revealed. An alternative approach to mapping the binding site which proved fruitful was the use of chimeric molecules formed between the insulin and the insulin-like growth factor 1 (IGF-1) receptors. These studies produced the consensus that the amino-terminal region (residues 1-68) conferred high affinity insulin-binding (Kjeldsen et al, 1991). In addition, the cysteine-rich region (Gustafson and Rutter, 1990) and the residues from 325-524 (Schumacher et al, 1993) were also implicated in the recognition of insulin. In particular, a significant role was assigned to Lys-460. A naturally occurring mutation of this residue (K460E) is associated with extreme insulin resistance (Kadowaki et al, 1988). Furthermore the C-terminal region of the a-subunit! which contains the alternatively spliced exon 11 was found to affect insulin binding. Exon 11 codes for 12 additional amino acids in the C-terminal tail of the a-subunit. The Exl 1- form of the insulin receptor (which lacks exon 11 and is the predominant form in muscle, fat and brain) binds insulin with a 2-fold higher affinity than the Exl 1+ form (the predominant form of liver) (McClain, 1991; Yamaguchi etal, 1991). The significance of these naturally occurring receptor isoforms is not clear. Presumably, they provide a mechanism whereby the insulin sensitivity of the different tissues can be regulated. Altogether, although a number of 4 amino acid residues in the a-subunit have been implicated in insulin-binding, a detailed structural model depicting the exact binding sites awaits x-ray crystallographic analyses. In addition to insulin-binding, the unoccupied a-subunit has been postulated to be a regulatory subunit which imposes a structural constraint on the P-subunit, inhibiting its tyrosine kinase. This model is based on the observation that limited proteolytic digestion or in vitro mutagenesis which leads to truncation of the a-subunit, leads to a constitutively active tyrosine kinase (Shoelson et al, 1988; Ellis et al, 1987). However, this hypothesis has been questioned, because the receptor constructs generated by trypsin as well as the expressed intracellular portion of the P-subunit have autophosphorylation and kinase i kinetics that resemble those of the unstimulated insulin receptor. If the a-subunit only exerted tonic inhibition then the above mentioned constructs should behave as activated kinases. Because of the presence of two a-subunits, the receptor has potentially two binding sites. However, significant negative cooperativity reduces the affinity of the receptor for the second molecule (De Meyts, 1994). Consequently, the stoichiometry of insulin binding over the range of insulin concentration normally found in the circulation is unlikely to be greater than one molecule per receptor (Pang and Shafer, 1984). Upon insulin-binding, the intrinsic P-subunit' receptor protein tyrosine kinase becomes activated. This activity is further augmented by insulin-receptor autophosphorylation (White et al, 1988; Wilden et al, 1992; Rosen et al, 1983; Flores-Riveros et al, 1989). The tyrosine kinase activity is required for insulin action as mutant receptors in the critical lysine residue (Lys-1030), located in the ATP binding region are biologically inactive (Chou etal, 1987; Ebina etal, 1987). Multiple autophosphorylation sites have been identified. These sites include Tyr-1146, Tyr-1150 and Tyr-1151 (numbering according to Ullrich et al, 1985, which omits 12 amino acids encoded by exon 11) which are flanked by highly conserved amino acid sequence motifs, found in all protein kinases: at the N-terminal side (Asp-Phe-Gly) and at the C-terminal side (Ala-Pro-Glu). Full activation of the tyrosine kinase occurs after tris-autophosphorylation in this 5 kinase region (White et al, 1988). Interestingly, Tyr-1146 has been reported to bind the protein-tyrosine phosphatase ID (PTP1D), which then promotes the binding of the insulin receptor substrate 1 (IRS-1) to the insulin receptor (Kharitonenkov et al, 1995). The x-ray crystal structure of the insulin receptor tyrosine kinase domain revealed a unique autoinhibition mechanism whereby Tyr-1150 is bound in the active site (Hubbard et al, 1994). This has led to the hypothesis that intramolecular trans-autophosphorylation of Tyr-1150 is the key step in insulin receptor kinase activation. Interestingly, a two-step autophosphorylation mechanism has been postulated in the activation of the TrkB tyrosine kinase (Iwasaki et al, 1997). According to these authors, Tyr-674 of the TrkB receptor (which corresponds to Tyr-1150 of the insulin receptor) is disengaged from the active site by cis phosphorylation. The active site becomes free so that it can trans phosphorylate other molecules. Structural studies of TrkB receptor kinases are necessary in order to confirm this hypothesis. Additional autophosphorylation sites on the insulin receptor 3-subunit reside in the C-terminal region (Tyr-1316 and Tyr-1322) (White and Kahn, 1994; Quon et al, 1994) and in the juxtamembrane region which is also essential for signal transmission. The latter region contains Tyr-960 which resides in an NPXY motif which undergoes autophosphorylation and is critical for subsequent IRS1 phosphorylation (Feener et al, 1993; Kaburagi etal, 1993). In addition to insulin binding and tyrosyl-autophosphorylation, the insulin receptor seems to be regulated by Ser/Thr phosphorylation. In the basal state the receptor is phosphorylated on serine and threonine residues (Kasuga et al, 1982a). After stimulation with insulin, the receptor exhibits not only increases in the phosphotyrosine content, but serine- and threonine-phosphate as well. Treatment of cells with phorbol esters and with agents which increase concentrations of cAMP can induce Ser/Thr phosphorylation of the receptor, which is associated with a decrease in the receptor tyrosine kinase activity and a loss of insulin sensitivity (Takayama et al, 1988; Stadtmauer and Rosen, 1986). A tightly 6 r associated/intrinsic, protein serine kinase has been found in purified insulin receptor preparations (Lewis et al, 1990; Tauer et al, 1996; Carter et al, 1996). Whatever the identity of the protein serine kinase, the Ser/Thr phosphorylations seem to act as a switch to turn off the insulin signal. Increased levels of protein kinase C (PKC) activity for example, can result in insulin-resistant states (Chin et al, 1993), though the diversity of PKC isoforms now recognized means that details probably should be re-evaluated. In essence, the insulin receptor is a tightly regulated tyrosine kinase which is controlled by a complex tyrosyl-autophosphorylation mechanism (positive regulation) and serine/threonine phosphorylations (potential negative regulation). According to many studies, the receptor kinase is essential for mediating insulin effects, since kinase-dead mutants fail to undergo autophosphorylations, lack tyrosine activity and are biologically inactive (Chou etal, 1987; McClain etal, 1987; Ebina etal.,1987). Surprisingly, other studies showed retention of metabolic signaling in the absence of receptor autophosphorylation and activated kinase activity. Some of these studies used anti-receptor antibodies which reportedly mimicked insulin action, on glucose transport, with apparently no detectable receptor autophosphorylation (Forsayeth et al, 1987; Hawley et al, 1989; Ponzio et al, 1988). Gottschalk (1991) reported that a kinase-inactive receptor mediated normal activation of mitochondrial pyruvate dehydrogenase in Chinese hamster ovary and Rat-1 cells. In spite of these reports, most of the evidence indicates that tyrosine i kinase activity is essential for biological effects. 1.2.3 PROTEINS WHICH I N T E R A C T WITH THE INSULIN R E C E P T O R . Following insulin receptor activation, three major adaptor proteins, IRS1, IRS2 and She have so far been recognized which become tyrosine phosphorylated and subsequently couple the receptor to downstream signaling pathways (Fig. 1). In contrast to other activated receptors (such as the EGF and PDGF receptors), these three tyrosine phosphorylated proteins, rather than the autophosphorylated insulin receptor itself, 7 interact with signaling proteins such as Grb2, SH-PTP2/Syp/PTP1D, PI 3-kinase and Nek. These interactions can occur via several protein domains resulting in an assembly of signal transduction complexes (or activation of pre-existing complexes). Figure 1 illustrates some of the proteins which interact with the insulin receptor and the pathways which emerge as a result of the protein-protein interactions. FIGURE 1. PATHWAYS EMERGING FROM THE INSULIN RECEPTOR IRS and She proteins are phosphorylated by the activated insulin receptor thus providing binding sites (phosphorylated tyrosines) for SH2-domain containing proteins. Both tyrosine phosphorylated IRS and She independently interact with the Grb2-Sos complex to stimulate Ras which eventually leads to the activation of the M A P K cascade. Tyrosine phosphorylated IRS proteins also interact with at least four other SH2-containing proteins: the tyrosine phosphatase, Syp (SH-PTP2), the adaptor proteins Nek and Crk and the p85 subunit of PI-3 kinase. The latter event stimulates the enzymatic activity of PI-3 kinase and leads to downstream activation of protein kinase B and p70 S6 kinase. Recent evidence indicates that the pathways leading to S6 phosphorylation (by p70 S6 kinase) and phosphorylation of PHAS bifurcates at a rapamycin-sensitive point (von Manteuffel et al., 1997). PKB is phosphorylated and activated by at least two kinases, one of which is PDK1. Activated PKB phosphorylates and inactivates GSK3 which can no longer phosphorylate glycogen synthase (GS). The activation of glycogen synthesis is at least in part, accounted for by the inhibition of GSK3. Solid and dashed arrows indicate established and speculative protein-protein interactions, respectively. The letter X indicates an unidentified component, the question mark indicates unknown mechanisms. IR = insulin receptor, TF = transcription factors. 8 Src homology 2 (SH2) domains are amino acid sequences that are similar to a 100-residue noncatalytic region of the Src tyrosine kinase. A wide variety of proteins involved in diverse pathways, which include phospholipid metabolism, tyrosine phosphorylation and dephosphorylation, contain SH2 domains (Pawson, 1995). These SH2-containing proteins directly bind phosphotyrosine sites on activated receptors and cytoplasmic proteins. The specificity of the phosphopeptide binding is mostly dictated by the amino acids C-terminal to the phosphotyrosine. Because protein kinases have an inherent specificity for their substrates, the strong and selective SH2 interactions arguably impart a second layer of specificity. This double selection helps to maintain the fidelity of intracellular signaling events (Songyang and Cantley, 1995). Binding of SH2 domains of proteins to phospho-tyrosine can lead to alterations and control of protein function as a result of direct stimulation in enzymatic activity, relocation within the cell and enhanced tyrosine phosphorylation (Sugimoto et al, 1994; Sabe et al, 1994; Rotin et al, 1992). The phosphotyrosine binding domain (PTB) represents an alternative means of recognizing phosphotyrosine. This domain which was originally identified in the amino terminus of She, is found in the docking proteins IRS1, IRS2 and IRS3 (formerly pp60, Lavan et al, 1997). PTB domains are defined by sequences of approximately 200 amino acids. In contrast to SH2 domains which recognize phosphotyrosine in the context of carboxy-terminal residues, PTB domains recognize phosphotyrosine in the context of amino-terminal residues and preferentially interact with sequences containing OXNPXpY where the fifth residue N-terminal to the phosphorylated tyrosine (pY-5) residue, (O) is hydrophobic. Many receptors (including those for EGF, NGF and insulin) contain N P X Y motifs which become recognized by PTB domains, once they are tyrosine phosphorylated. The She and IRS PTB domains bind to phosphorylated Tyr-960 within the juxtamembrane domain of the insulin receptor (Gustafson et al, 1995). Tyr-960 exists in the sequence motif NPEY. Asn, Pro and Tyr residues in the motif are critical to both She and IRS1 binding. Interestingly, the PTB domain is structurally similar to pleckstrin homology (PH) 10 domains (Zhou et al, 1995). The similarity between the PTB and the PH domains is further supported by the finding that both domains bind to acidic phospholipids indicating a possible role in membrane localization. Binding to phospholipids may also facilitate the interaction of the docking proteins with the insulin receptor, so that they can become tyrosine phosphorylated by the receptor kinase. Protein-protein interactions may also occur through pleckstrin homology domains. PH domains which comprise approximately 100 amino acids were originally identified as two repeats in pleckstrin, the protein kinase C substrate in platelets (Haslam et al, 1993; Mayer et al, 1993). Subsequently PH domains were identified in a wide variety of proteins, including protein Ser/Thr kinases (e.g. P-adrenergic receptor kinase and protein kinase B), protein tyrosine kinases (e.g. Abl and Btk) phospholipase C-y (PLCy), Sos, Ras-GAP, dynamin and IRS-1 (Musacchio et al, 1993; Gibson et al, 1994; Lemmon et al, 1996). The exact role of the PH domain is not quite clear. The P-adrenergic receptor PH domain was reported to bind Py-subunits of heterotrimeric G-proteins and phosphorylated phosphatidylinositol lipids were reported to bind to PH domains. More recent studies have indicated that different PH domains have specificity for distinct phosphoinositides (for a recent review, see Toker and Cantley, 1997). In light of the above, PH domains may be important in the recruitment of a distinct group of proteins to the membranes and/or the cytoskeleton. The SH3 domain is yet another domain found in a number of proteins involved in tyrosine kinase signaling and cytoskeletal architecture. Examples of proteins with SH3 domains are the Src family tyrosine kinases, PLCy, Ras-GAP, PI 3-kinase and Grb2. SH3 domains mediate protein-protein interactions through binding to proline-rich sequences in their binding partners (Koch et al, 1991; Ruibao et al, 1993). Various combinations of SH-, PH and PTB domains are found in the same proteins. For example, the IRS and She s protein contain PH and PTB domains. The PH domains probably function to recruit these docking proteins to the membrane, providing a kinetic advantage for their recognition by 11 the insulin receptor probably by the PTB domain. Once phosphorylated by the insulin receptor tyrosine kinase, the IRS and She proteins mediate downstream signals by engaging a cohort of SH2-containing proteins. The PTB and PH domains are both required for efficient tyrosine phosphorylation of IRS 1 by the insulin receptor tyrosine kinase (Yenushi et al, 1996). Interestingly, proteins such as Grb2 and Crk are composed almost entirely of SH domains and as such function solely as signaling adaptor molecules. IRS-1 contains at least 20 potential sites of tyrosine phosphorylation (Myers etal, 1994). The tyrosyl sites perform a dual role, first as substrates for the upstream kinases such as the insulin receptor kinase and second, as specific docking sites for downstream SH2-containing proteins. There is evidence that at least 8 tyrosines are phosphorylated within intact cells exposed to insulin (Myers etal., 1994). These include residues 460, 608, 628, 939 and 987 which are in Y X X M / Y M X M motifs and bind to the SH2 domain of the 85-kDa regulatory subunit (p85) of PI 3-kinase (Sun etal, 1993). The association of p85 with tyrosine phosphorylated IRS-1 stimulates the activity of the 110-kDa catalytic subunit of PI 3-kinase (Ruderman et al, 1990; Myers et al, 1992; Backer et al, 1992). PI 3-kinase has been linked to a number of biological actions during insulin stimulation, including glucose uptake, glycogen and fat biosynthesis as well as inhibition of lipolysis. A second protein which binds to tyrosine-phosphorylated IRS-1 is Grb2, a 25 kDa cytoplasmic protein that contains an SH2 domain flanked by two SH3 domains. The phosphotyrosine of IRS-1 to which Grb2 binds is in the sequence YVNI (Sun et al, 1993). Grb2 in turn associates via its SH3 domains with a guanine nucleotide exchange factor for Ras, mSos (the mammalian homolog of the Drosophila son of sevenless protein). The Grb2-mSos complex is activated following binding to tyrosine-phosphorylated IRS-1, leading to the stimulation of Ras. Activation of Ras leads to the recruitment of Raf-1 Ser/Thr kinase to the plasma membrane where it is stimulated thus initiating the cascade leading to the activation of the MAP kinases ERK1 and ERK2. In addition to IRS-1, insulin induces tyrosine phosphorylation of IRS-2, IRS-3 and She, a 52-12 kDa SH2-containing protein which associates with Grb2 and therefore, provides an IRS-1-independent way of activating MAP kinase - indeed She may well be the major route by which Ras is activated by insulin (see below). A third protein that binds to tyrosine-phosphorylated IRS-1 is Syp, a protein tyrosine phosphatase (also known as PTP1D, PTP2C or SH-PTP2) which contains two SH2 domains. Syp is likely activated during the association with tyrosine-phosphorylated IRS-1. The Syp signaling pathway is still undefined, presumably Syp dephosphorylates signaling proteins located within and/or close to the IRS-1 complex. Evidently it is required for positive signaling, not just as a "switch off' mechanism. Finally, Nek a cytoplasmic protein containing three SH3 domains and one SH2 domain was found to associate with tyrosine-phosphorylated IRS-1. While the effects of this association are unknown, Nek presumably interacts through its SH3 domains with proteins important in signaling. So far, therefore four proteins are known to interact with tyrosine-phosphorylated IRS-1, and more may yet be discovered. Transgenic mice with an IRS 1 gene-knockout are runted and mildly insulin-resistant (Tamemoto et al, 1994; Araki et al, 1994). This relatively modest change in the phenotype of the transgenic mice is most probably due to the compensatory function of other IRS proteins and/or She. Muscle and adipose tissue of these animals were found to express IRS2 which like IRS1, associated with and activated PI 3-kinase in an insulin-sensitive manner. Interestingly, transgenic mice unable to express a functional G protein subunit G j a 2 have a phenotype very similar to those with a disrupted IRS1 gene (Moxham and Malbon, 1996). In the Gja2-deficient mice, the total cellular phosphotyrosine phosphatase activity was elevated. In particular, the expression of the tyrosine phosphatase IB (PTP1B) but not of Syp was increased (1- to 2-fold), with significant amounts of PTP1B in the cytoplasm. It appears that the G protein subunit G i a 2 (perhaps through a tyrosine phosphatase link) is a positive regulator of insulin action, or that insulin signaling leads to responses which might also be mediated by Gj-like protein. 13 IRS1 and IRS2 are not only substrates for the insulin and IGF1 receptors, but are phosphorylated through activation of other receptors as well. For example, growth hormone, interleukins 2, 4, 7 and 15, inteferons-a and y and leukemia inhibitory factor can all stimulate the tyrosine phosphorylation of IRS 1 and IRS2 (Johnston et al, 1995). Therefore, the IRS proteins have a broader role in a variety of cells and respond to different stimuli. The specificity of the metabolic actions of insulin probably stems from the cellular context in which IRS proteins engage signals. 1.3 POST RECEPTOR SIGNALING EVENTS. As alluded to earlier, the first detectable event following insulin receptor occupancy is the activation of the intrinsic tyrosine kinase activity of the P-subunit resulting in the rapid phosphorylation of tyrosines within the receptor and other intracellular proteins. In the short term, the principal effects of insulin include modulation of carbohydrate, protein and fat metabolism. These effects are achieved through a combination of a number of processes which include increases in ion and nutrient transport and activation of key enzymes of glycogen, protein and fatty acid biosynthesis (Table 1). In general, parallel and compensatory inhibition of catabolic pathways is also evident and equally important as are the long term effects which involve changes in gene expression and transcription rates. For example, insulin promotes increased expression of the NADP-linked dehydrogenases of the pentose cycle, acetyl-CoA carboxylase, fatty acid synthase, liver L-type pyruvate kinase and glucokinase expression, whereas the expression of liver phosphoenolpyruvate carboxykinase is repressed. Indeed, the expression of at least 50 genes is already recognized to be regulated by insulin (O'Brien and Granner, 1991; 1996). 14 Table 1. Major insulin responses ocurring in liver (L), fat (F) and muscle (M). * Effects only apparent when cAMP levels have been increased by the presence of another hormone. Adapted from Denton and Tavare, 1995. PROCESS EFFECT TISSUE SITE OF REGULATION Glucose transport increase F,M GLUT4 glucose transporters Amino acid transport increase F.M.L system A Glycogen synthesis increase L.F.M glycogen synthase Glycogen breakdown decrease* L,F,M phosphorylase kinase phosphorylase Glycolysis increase* L 6-phosphofructo-2-kinase (PFK-2) and pyruvate kinase Gluconeogenesis decrease* L PFK-2/fructose-2-6-bis phosphatase and pyruvate kinase Fatty acid synthesis increase L.F pyruvate dehydrogenase and acetyl-CoA carboxylase Lipolysis decrease* F tri-acylglycerol lipase Protein synthesis increase L.F.M initiation, elongation Protein degradation decrease M,L proteosome 15 1.3.1 GLUCOSE TRANSPORT. The entry of glucose into most mammalian cells is regulated by a family of highly related integral membrane facilitative glucose transporter proteins (Gluts). An exception to the above is the intestinal glucose transporter (SGLT1), which is sodium dependent. The Glut transporters are the products of distinct genes and are expressed in a highly controlled tissue-specific manner (Table 2). So far, six different mammalian glucose transporter isoforms (Glut 1-5, and Glut-7) have been identified. GLUT 6 is a pseudogene that is not expressed at the protein level (Kayano et al., 1990). Glut 1 is the most widely expressed, while Glut 4 is restricted to the insulin-sensitive tissues, muscle and adipose (Gould & Holman, 1993; Mueckler, 1994). Insulin stimulates glucose transport by inducing the translocation of both Glut 1 and Glut 4 from intracellular membrane compartments to the plasma membrane (Suzuki and Kono, 1980; Cushman and Wardzala, 1980; and for reviews see, Simpson and Cushman, 1986; Holman and Cushman, 1994). The majority of the insulin mediated increase in glucose transport is largely accounted for by the Glut 4 isoform, which accounts for 80-90 % of total Glut in adipose tissue. 16 Table 2. Mammalian glucose transporters. Adapted from Bell et al, 1993; Mueckler, 1994. NAME TISSUE FUNCTION SGLT1 kidney, intestine Na-dependent active transport across apical & epithelial membrane GLUT1 many fetal & adult tissues primary transporter for growing/dividing cells erythrocytes, immortalized cells transport across blood/brain barrier GLUT2 liver, pancreatic B-cells, high capacity low-affinity transport across kidney, intestine basolateral membrane GLUT3 brain, placenta, testes primary transport across neurons GLUT4 skeletal muscle, heart, fat mediates insulin-stimulated glucose transport GLUT5 intestine, lesser amounts in fructose transporter fat, muscle, brain, kidney GLUT6 pseudogene non-functional, sequence most related to that of GLUT3 GLUT7 liver mediates transport across endoplasmic reticulum membrane The underlying mechanism by which insulin causes the redistribution of the Gluts is not clearly known. Ras has been implicated in the regulation of glucose transport by insulin (Kozma et al, 1993), but it is apparently not sufficient to account for the activation (Manchester et al, 1994; van den Berghe et al, 1994). Phosphatidylinositol 3- kinase (PI3-K) may play a central role as indicated by the ability of wortmanin (an inhibitor of PI3-K) to inhibit the effects of insulin on 2-deoxyglucose transport (Okada et al, 1994). The observation that Glut 1 and Glut 4 translocation is sensitive to wortmanin in a manner that correlates with the inhibition of PI3-K, (Clarke et al, 1994; Kanai et al, 1993), further lends support for the involvement of PI3-K. LY294002 is another inhibitor of PI3-K which blocks Glut 4 recruitment to the plasma membrane of 3T3-L1 adipocytes (Cheatham et al, 1994). Finally, insulin activation of Gluts is inhibited in cells that express 17 dominant negative PI3-K. Apparently, the activity of PI3-K alone is insufficient to cause the redistribution of the transport proteins. For example, both the platelet-derived growth factor (PDGF) and insulin are potent activators of PI3-K in 3T3-L1 adipocyctes but only insulin causes the translocation of Glut 4 to the plasma membrane (Gould et al, 1994; Isokoff et al, 1995) and subsequently a substantial increase in overall glucose transport (Wiese et al, 1995). Other biochemical events unique to insulin are presumably also necessary to stimulate glucose transport. In support of the latter are studies by Kelly and Ruderman (1993), who have reported a subcellular redistribution PI3-K activity following insulin stimulation. The subject of intracellular vesicle trafficking is currently of great interest. Transport of proteins is mediated by vesicles that bud from one compartment and specifically recognize and fuse with another compartment (Sudhof, 1995). The new information has revealed that vesicle proteins called v-SNAREs interact with proteins in the target membrane called t-SNAREs (Rothman, 1994). The small guanosine triphosphatases called Rabs have also been implicated in this process (Lupashin and Waters, 1997). Conceivably, other insulin-mediated Glut4 translocation may involve the interplay of these and other proteins (Cain et al, 1992). M A P K can be indirectly inhibited by wortmanin in certain cell types (Welsh et al, 1994; Cross et al., 1994). Consequently, a role of MAPK in the acute effects of insulin on glucose metabolism has been suggested. Several studies have demonstrated that although both insulin and EGF can stimulate MAPKs, only insulin promotes increased glucose transport (Robinson et al, 1993; Finger & Birnbaum, 1994; Lin & Lawrence, 1994). Furthermore, insulin fails to activate MAPK in PC-12 cells, at low concentrations which are adequate for the stimulation of glycogen, lipid and protein synthesis in these cells (Ohmichi et al, 1993). Finally, prevention of MAPK activation through inhibition of the activation of its upstream activator MEK, does not affect the activation of glucose transport by insulin (Lazar et al, 1995). These observations strongly indicate that M A P K is not required for the activation of glucose transport by insulin. 18 1.3.2 GLYCOGEN SYNTHESIS. Insulin stimulates the rate of glycogen synthesis in muscle, liver and adipose tissue, by changing the relative activities of glycogen synthase and phosphorylase (Cohen, 1987, 1993; Larner, 1988; Lawrence, 1992). In the absence of a prior cAMP stimulus, effects of insulin on glycogen synthase are predominant. The activation of glycogen synthase occurs primarily through dephosphorylation of three serine residues on a carboxy terminal cyanogen bromide fragment of the enzyme, designated as C30, C34 and C38 (Cohen, 1987). These three C-terminal residues are phosphorylated by glycogen synthase kinase-3 (GSK3), (Parker et al, 1983; Rylatt et al., 1980) and dephosphorylated by the glycogen-associated form of protein phosphatase-1 (PP1G) (Stralfors et al, 1985; Hubbard et al, 1989). Thus the stimulation of glycogen synthase by insulin could proceed via the activation of PP1G and/or the inhibition of GSK3 and evidence in support of both mechanisms exist. GSK3 is acutely inhibited by serine phosphorylation in response to insulin or growth factors (Hughes et al, 1992; Welsh & Proud, 1993; Cross et al, 1994). Although both p90 r s k and p70 s 6 k phosphorylate and inactivate GSK3 in vitro (Sutherland et al, 1993a; Sutherland & Cohen, 1994) more recent data has shown that neither kinase is essential for the process. Inhibition of p70 s 6 k by rapamycin in intact L6 and CHO cells did not abolish the effect of insulin on GSK3 (Cross et al, 1994; Welsh et al, 1994), indicating that p70 s 6 k may not be involved in the insulin-mediated inhibition of GSK3. Likewise, agents that prevent the activation of p90 r s k (8-bromo-cyclic AMP or PD 98059), could not block the insulin-mediated deactivation of GSK3 (Cross etal, 1995). Protein kinase B (PKB), which is another insulin-stimulated protein kinase, can phosphorylate and inhibit GSK3 in vivo (Cross et al, 1995). Like the inhibition of GSK3 (Cross et al, 1994; Welsh et al, 1994; Moule et al, 1995), the activation of PKB is blocked by wortmannin (Cross et al, 1995). This latter observation is consistent with an upstream role of PI3-K in the activation of PKB. 19 The dephosphorylation of glycogen synthase occurs through the activation of type I protein phosphatase, which is complexed with a regulatory glycogen-binding subunit (G-subunit), (Dent et al, 1990). This subunit not only directs the phosphatase to the glycogen particles (where glycogen synthase is also bound), but also regulates the activity of the phosphatase. Phosphorylation of site 1 of the G-subunit occurs in response to insulin and enhances the ability of the phosphatase to dephosphorylate the carboxy-terminal serines and therefore activate glycogen synthase (Dent etal., 1990). Phosphorylation of site 1 in vitro has been shown to be catalysed by an insulin-stimulated protein kinase (ISPK), which has been identified as the Rsk-2 isoform of p90 r s k (Lavoinne et al., 1991; Sutherland et al, 1993b), which lies downstream of the MAPK's ERK1 and ERK2. Site 2 on the G-subunit can be phosphorylated by cyclic AMP-dependent protein kinase and this results in dissociation of the phosphatase and reduced activity. The effects of both P K A and ISPK represents the rare situation whereby, phosphorylation of the same protein by two different kinases leads to opposing changes in activity (a phenomenon also found with A C C , Src family of tyrosine kinases and cyclin-dependent protein kinase 1). Furthermore, the activation of PP1G by ISPK explains one of the paradoxical effects of insulin, i.e. its ability to increase the phosphorylation of some proteins and decrease the phosphorylation of others (Denton, 1986). Despite the potential effects of MAPK and hence p90 r s k 2 on PP1-G, the role of M A P K in the stimulation of glycogen synthesis by insulin has been questioned. For example stumulation of adipocytes with epidermal growth factor (or platelet-derived growth factor) activates MAPK and p90 r s k without any apparent changes in glycogen synthase activity (Lin and Lawrence, 1994) or glycogen synthesis (Wiese et al, 1995). Furthermore, inhibition of M E K (with subsequent MAPK inhibition) failed to block insulin stimulation of glycogen synthase in 3T3-L1 or L6 myotubes (Lazar et al, 1995). Moreover, the MAPK-p90 r s k pathway was uncoupled from the stimulation of glycogen synthesis in the skeletal muscles of transgenic mice with an insulin receptor defect (Chang 20 et al, 1995). These findings indicate that the ERK isoforms of the M A P K may not be required for the stimulation of glycogen synthesis by insulin. The discovery of other MAPK isoforms (c-Jun N-terminal kinases (JNKs) and p38/Hog), prompted researchers to reevaluate the role of MAPKs in insulin action. A temporal linkage map of the activation of the MAPKs by insulin in the skeletal muscle of BDF1 mice was reported (Moxham et al., 1996). The map indicated that the JNK isoforms rather than the ERKs may yet mediate insulin stimulation of glycogen synthesis in vivo. In Chapter 5,1 present evidence relating to the role of the major MAP kinases in adipose tissue by an alternative approach involving exposure of tissue to different extracellular osmolalities. 1.3.3 FA TTYACJD SYNTHESIS. In mammals, fatty acid biosynthesis occurs predominantly in white and brown adipose tissue, liver, and lactating mammary gland. Insulin increases the rate of fatty acid synthesis in all four tissues, within a few minutes. The rapid activation of acetyl-CoA carboxylase (ACC) in response to insulin plays an important role in the stimulation of fatty acid synthesis. In addition, alterations in the rates of glucose transport and the activity of pyruvate dehydrogenase are also important, since they determine the rate of supply of acetyl-CoA. Changes in the activity of A C C are associated with increased phosphorylation on a distinct tryptic peptide designated the I-peptide (Brownsey & Denton, 1982). The identity of this peptide together with that of the phosphorylating kinase has remained elusive. An insulin-stimulated kinase from rat adipose was shown to phosphorylate A C C with a concomitant increase in activity (Bdrthwick etal., 1990). This phosphorylation-dependent activation of A C C was most apparent on CoA-inhibited A C C (Moule et ai, 1992). A C C is also dephosphorylated in response to insulin and this is likely to be most important in reversing the inhibitory effects of AMP- and cAMP-dependent protein 21 kinases, which are activated in response to adrenaline and glucagon. For example, insulin decreased the amount of 3 2 P in A C C in freeze-clamped livers and Fao Reuber hepatoma cells by 20 and 40 % respectively, with parallel increases in activity (Mabrouk et al, 1990; Witters et al., 1988). The sites dephosphorylated in response to insulin, however, have not been determined. Consequently, the role of dephosphorylation in activating A C C remains undefined and insulin still induces ACC activation and phosphorylation in isolated hepatocytes and adipocytes when cAMP concentrations remain low. 1.3.4 PROTEIN SYNTHESIS. Insulin changes the net rate of protein synthesis in three general ways. Firstly, it alters the rate of protein translation in responsive tissues (liver, adipose tissue, skeletal and cardiac muscle), at the level of initiation (and perhaps elongation). Secondly, the hormone exerts positive and negative effects on the expression of specific genes. Finally, insulin suppresses net proteolysis in muscle and liver through effects at the proteosome but by mechanisms which are poorly understood. Longer term effects of insulin are probably due to changes in the rate of transcription of the corresponding genes. In some cases, the effect of insulin on gene expression is augmented by the presence of other factors. For example, glucose is required for insulin's effect on fatty acid synthase, acetyl-CoA carboxylase and L-pyruvate kinase (Girard et al, 1994; Moustaid et al, 1994; Foufelle et al, 1992; Vaulont and Kahn, 1994). In other cases, such as glucokinase and phosphoenolpyruvate carboxykinase (PEPCK), the effect of insulin is glucose-independent (Iynedjian, 1993; O'Brien and Granner, 1991; 1996). Tissue-specific variations in the response of a given gene to insulin have been reported. For example, insulin stimulates glucokinase transcription in the liver, whereas in the pancreatic P-cell glucokinase activity is regulated by glucose (Magnuson et al, 1989; Iynedjian et al, 1988; Bedoya et al, 1986). Insulin also has a selective effect on the expression of the GLUT2 glucose 22 transporter in the pancreatic P-cell compared to the liver (Thorens et ai, 1990). Tissue-specific effects might be due to the use of alternative promoters (Magnuson, 1990). 1.3.4.1 GENE TRANSCRIPTION. Insulin has profound positive and negative effects on the rate of gene transcription directed by R N A polymerase II. For example in liver, the expression of the genes encoding the six key enzymes of glycolysis and gluconeogenesis are tightly and coordinately regulated (Granner and Pilkis, 1990). Many insulin-regulated genes such as those for PEPCK, c-fos, amylase, liver pyruvate kinase, glyceraldehyde-3-phosphate dehydrogenase (GAPDH) and glucagon have insulin-responsive elements (IREs) in the 5' flanking region (see Kimball et al., 1994 for a review). The mechanism by which insulin alters the amount or activity of transcription factors able to change the transcription of any gene is still not well defined beyond the general role for MAPKs in the phosphorylation of Elkl/p60 t c f and CREB, for example. However, in the case for growth hormone and GAPDH, insulin apparently through a phosphorylation event, increases the affinity of the transcription factors for their respective IREs. Insulin also modifies RNA polymerase I (RNA pol I) directed rates of gene expression. RNA pol I transcribes mammalian ribosomal genes. The exact mechanism by which the insulin regulates rRNA synthesis is unknown. For efficient transcription from rDNA promoters, RNA pol I requires at least two transcription factors, SL-1 and upstream binding factor (UBF) (Sollner-Webb and Mougey, 1991). Insulin may therefore exert its effects by modulating the amount or activity of either RNA pol I or the transcription factors that interact with the cis-elements of the rDNA promoter. Alterations in the amount as well as differential phosphorylation of UBF have been reported (Xie et al., 1993). Casein kinase II (CK II, Somercorn et ai, 1987) has been shown to phosphorylate UBF in vitro (O'Mahony et ai, 1992). Since insulin activates C K II, it is 23 conceivable that insulin may enhance rDNA transcription through phosphorylation of UBF by C K II. Insulin also modulates other nuclear events related to the pathway of protein synthesis. For example, the hormone modulates theirelease of mRNA from the nucleus f (Csermely et al., 1993). In addition, it enhances the phosphorylation of a number of double stranded DNA-binding proteins including lamins A and C (Friedman and Ken, 1988). 1.3.4.2 TRANSLATION OF mRNA. The action of insulin in stimulating translation involves in the short-term, activation of a number of translation factors and other components of the translational machinery. In the longer term, insulin stimulates the synthesis of ribo somes and other translational components too. Both the initiation and elongation phases of translation are activated by the hormone and the phosphorylation and dephosphorylation of a number of translation factors appears to be involved (for reviews see Kimball et al., 1994; Redpath and Proud, 1994). Two distinct types of translational control are known to occur. Firstly, there is a general control of overall translation affecting the bulk of mRNAs in the cell. Secondly, there are increases in the translation of particular mRNAs which before stimulation of the cells are poorly translated and are often associated with very few ribosomes. Expression of two groups of proteins may be described by the selective phenomenon, including proteins whose mRNAs contain polypyrimidine tracts immediately following the 7-methylguanosine cap. The expression of these proteins increases disproportionately during rapid growth and the group of proteins includes those required for S phase events, components of the translational machinery and transcription factors (Baserga, 1990). The 5'untranslated regions (UTRs) of mRNAs in the second group are highly structured and i therefore are under translational regulation. 24 Peptide-chain initiation is a complex process which may be regulated at multiple points. Two principal sites have so far been recognized as potential control points: 1. the attachment of the initiator methionyl-tRNA to the small ribosomal subunit, a process mediated by eukaryotic initiation factor-2 (eIF-2) in a GTP-dependent manner. The exchange of GDP for GTP on eIF-2 is catalyzed by eJT-2B. 2. binding of mRNA which involves the cap-binding protein eIF4a (formerly known as eIF-4E). The effects of insulin and growth factors appear to be exerted directly on the exchange activity of eIF-2B (Welsh and Proud, 1992). The effect of insulin on e!F-2B appears to occur through the inhibition of GSK3, which is therefore unable to phosphorylate and inhibit eIF-2B. In vitro studies showed that GSK3 is phosphorylated either by MAPKAPK1 (also known as p90 r s k), which lies downstream of MAPK, or by p70 s 6 k , which participates in a different signaling pathway (Sutherland et al, 1993a; Sutherland and Cohen 1994). However, various evidence indicate that the; MAPK pathway is not involved or required in the regulation of GSK-3 (Moule et al, 1995; Cross et al, 1995). Furthermore, phosphorylation of GSK3 by p70 s 6 k in vivo seems unlikely, because rapamycin which inhibits the activation of p70 s 6 k , did not affect the inhibition of GSK-3 by insulin (Cross et al, 1995). PKB, believed to lie downstream of PI3-K can phosphorylate GSK3 in vitro and may provide an alternative pathway of controlling GSK3 through PI3-K (Cross et al, 1995). A role of PI3-K is supported by the ability of the inhibitors of PI3-K, wortmannin (Welsh et al.,1994; Cross et al, 1994; Saito et al, 1994; Moule et al, 1995; Borthwick et al, 1995; Stambolic and Woodgett, 1994) or LY294002 (Cross et al, 1995), to block the regulation of GSK3. Care must be exercised in interpreting these inhibitor effects, because of possible effects on other signaling pathways. For example, wortmannin can also inhibit the M A P K cascade in certain cell types (Welsh et al, 1994; Cross et al, 1994). Interestingly, since GSK3 also inactivates glycogen synthase, inactivation of GSK3 could 25 provide a common mechanism for the activation of glycogen and protein synthesis. Figure 2 shows a schematic representation of the signaling pathways leading to the activation of the exchange factor eIF-2B. FIGURE 2. SIGNALING PATHWAY(S) LEADING TO ACTIVATION OF THE EXCHANGE FACTOR eIF-2B. Insulin activation leads to the phosphorylation and activation of p90rsk, p70s6k and PKB all of which can potentially phosphorylate and inactivate GSK3 in vitro. However, the use of inhibitors to block the activation of these kinases has indicated that PKB is likely to phosphorylate and inhibit GSK3 in vivo. Decreases in the phosphorylation of eIF-2B leads to the activation of its guanine-exchange activity which maintains the initiator transfer RNA-binding factor, eIF-2 in its active GTP-bound state. Question marks indicate undefined signaling elements. The abbreviations mTOR and PDK denote the mammalian target of rapamycin and EtdIns(3,4)P2/(3,4,5)P3-dependent kinase, respectively. Insulin receptor She IRS PI 3-K eIF-2B 26 Cytoplasmic eukaryotic mRNAs are modified at the extreme 5'-end by 7-methylguanosine, which is linked to the next nucleotide by a 5-5' triphosphate group. This modification, also known as the 5'-cap, is bound by eIF-4E, which in turn is part of a complex (eIF-4F). This latter complex also contains eIF-4A, an ATP-dependent RNA helicase. The binding of the eIF-4F complex to mRNA is believed to promote mRNA scanning process, which aligns the 40S ribosomal subunit with the initiation codon (Sonenberg, 1993). The cap-binding and scanning processes are potential control points for general translation of all mRNAs as well as for specific mRNAs. The latter occurs if the UTR of specific mRNAs contain significant secondary structures which impede the scanning mechanism. The secondary structure must therefore be unwound in order to permit scanning. This occurs by eEF-4A, which possesses the ATP-dependent R N A helicase activity. An example for mRNA with a stable secondary structure in the U T R is ornithine decarboxylase (ODC). Under basal conditions, translation of ODC mRNA is inhibited and insulin reverses this inhibition through changes in the eIF-4F complex (Manzella a/., 1991). Recently, two other proteins that bind to eIF-4E have been reported (Pause, 1994). These proteins, termed eIF-4E BP-1 and eEF-4E BP-2 are similar to each other. BP-1 is the human homologue of PHAS-1 (Ffu et at., 1994), a protein which becomes phosphorylated in rat fat cells upon insulin treatment (Belsham et al., 1980; 1982; Denton et al, 1981). Binding of BP-l/PHAS-1 to eIF-4E inhibits translation of capped mRNA and phosphorylation of BP-l/PFfAS-1 in insulin-stimulated cells leads to decreased binding to eIF-4E (Pause et al, 1994; Lin et al, 1994). Insulin can therefore, stimulate translation by the release of eIF-4E from inhibition by BP-l/PHAS-1. In vitro studies showed that BP-l/PHAS-1 is phosphorylated by MAPK (Lin et al, 1994) and casein kinase II (Haystead et al, 1994; Diggle etal, 1991). However, in vivo studies showed that PD098059 inhibited MAPK but not BP-l/PHAS-1 phosphorylation indicating that 27 M A P K is not required for this phosphorylation (Lin^ et al, 1995). In contrast, the phosphorylation of BP-l/PHAS-1 in intact cells appears to be brought about by a rapamycin sensitive mechanism, indicating the involvement of p70 s 6 k (Lin et al., 1995; Graves et al, 1995; Diggle et al, 1996; von Manteuffel et al, 1996). The S6 protein is a component of the 40S ribosomal subunit and may be involved in the binding of mRNA. Insulin or growth factors increase the phosphorylation of the S6 protein up to five serine residues near the C terminus. Although a strong correlation exists between increases in S6 phosphorylation and protein synthesis, the exact mechanisms have remained enigmatic. According to one hypothesis, S6 phosphorylation may play a role in the translation of specific mRNAs with a polypyrimidine tract at their 5' cap site, such as those that encode for ribosomal proteins (Jefferies et al, 1994). Another hypothesis implicates the phosphorylation of S6 in the inhibition of autophagy (Luiken et al, 1994). The elongation phase of protein synthesis is apparently also under hormonal control. Recently, Redpath et al. (1996) reported a decrease in the phosphorylation state of eEF2 and eEF2-kinase activity in response to insulin. eEF2 catalyzes the translocation of peptidyl-tRNA from the A-site of the ribosome to the P-site. Phosphorylation of eEF2 (mediated by eEF2-kinase) inactivates eEF2. Thus insulin promotes peptide-chain elongation through decreases in the phosphorylation state of eEF2. Interestingly, these effects of insulin are blocked by both rapamycin and wortmannin, indicating that PI3-K and p70 s 6 k may lie on a common signaling pathway with eEF2-kinase. 1.4 POSSIBLE MECHANISMS INVOLVED IN INSULIN ACTION Signaling pathways from the activated insulin receptor may proceed through one of at least two generalized mechanisms. Signaling may involve a sequence of direct protein-protein contacts perhaps, including a protein phosphorylation mechanism. Alternatively, signaling may involve a mechanism dependent on the generation of low molecular weight and diffusable second messengers that allosterically regulate the activity 28 of target enzymes such as protein kinases and phosphatases. Metabolic insulin effects ultimately result from the changes in the phosphorylation state of key regulatory enzymes. Other actions of insulin involve translocation of membrane proteins or control of gene transcription. Many of these trafficking and transcription steps also involve control by protein phosphorylation and or dephosphorylation mechanisms. Thus a general basis for the mechanism of insulin action must take into account protein phosphorylation and dephosphorylation (Denton and Tavare, 1992; Kahn, 1994; Lee and Pilch, 1994). According to this mechanism, the insulin receptor tyrosine kinase initiates a phosphorylation cascade that begins with receptor autophosphorylation on tyrosyl residues and leads ultimately to ser/thr phosphorylation of effector enzymes and proteins (Czech et i al, 1988; Kahn and White, 1988). A substantial number of insulin-sensitive protein Ser/Thr kinases have so far been well characterized, but we are still far from a complete understanding of the relevant physiological substrates in all cases. Notably, our understanding of metabolic signaling pathways are still obscure. Some of the insulin-sensitive protein Ser/Thr kinases are shown in Table 4. 1.4.1 SECOND MESSENGERS. According to the latest version of the second messenger hypothesis, phospho-oligosaccharides (inositol phosphate glycans), released from membrane glycolipids by the action of a specific phospholipase C, may initiate signaling from the activated insulin receptor (Low and Saltiel, 1988; Saltiel, 1990). In addition, diacylglycerol has also been implicated as a second messenger in insulin action (Stralfors, 1988; 1997). So far no evidence exists for the regulation of phospholipases by insulin. PLC- y which is activated by EGF, is apparently neither a substrate for the insulin receptor tyrosine kinase nor does it bind to IRS-1 (Nishibe et al, 1990). The role of phospho-oligosaccharides and diacylglycerol in the second messenger mechanism has remained controversial (Houslay and Siddle, 1989; Zick, 1989) and there has been little apparent progress in this area since 29 the late 1980's. As a result the significance of these compounds in insulin signaling remains unclear although one wonders if the newly emerging phosphoinositol lipids and phosphatidylinositol polyphosphates might account for some "mediator" function. /. 4.2 PROTEIN PHOSPHORYIA TIONIDEPHOSPHORYEA TION. As already mentioned above, the insulin receptor is a tyrosine kinase that undergoes hormone-dependent autophosphorylation. Although the tyrosine phosphorylation is essential for the biological effects of insulin, many downstream effects of the hormone result from changes in serine and threonine phosphorylation. In the sections above (1.2.2 and 1.2.3), I have discussed proteins that are tyrosine-phosphorylated in response to insulin. I now focus on those post-receptor events in which protein Ser/Thr phosphorylations are regulated. A number of insulin-sensitive enzymes undergo changes in activity associated with net dephosphorylations (Table 3). For example dephosphorylation of glycogen synthase increases the activity of the enzyme leading to increased glycogen deposition (Parker et al., 1983), whereas, dephosphorylation of hormone-sensitive lipase (Stralfors etal., 1984) and phosphorylase kinase (Sheorain et al., 1984) inhibits their activities and the respective breakdown of triglyceride and glycogen stores. Similarly, pyruvate dehydrogenase is dephosphorylated and activated in response to insulin (Martin et al., 1972) leading to increased synthesis of acetyl-CoA and fatty acids. Insulin decreases the phosphorylation of eIF-2B (through inhibition of GSK-3) and that of the elongation factor, eEF-2 (through inhibition of eEF-2 kinase). Both of these events lead to the activation of initiation and elongation and ultimately protein synthesis. Taken together, these and other observations demonstrate that a central role of insulin action is mediated by dephosphorylation of key regulatory enzymes in intermediary metabolism. Paradoxically, insulin action also leads to rapid increases in phosphorylation of Ser/Thr residues of a family of proteins (mostly distinct from those noted above) in target 30 cells within minutes of exposure to the hormone. Quantitatively, the family of proteins that exhibit insulin-stimulated protein phosphorylation is more extensive than the group which undergoes net dephosphorylation described above. In addition to the signaling proteins described above, other proteins exhibit insulin-induced phosphorylation, notably protein kinases (Raf-1, MEK, ERKs, p90 r s k, p70 s 6 k, protein kinase B) and phosphatases (PP1-G). Some Ser/Thr phosphorylations are used in feedback mechanisms such as those observed in the insulin receptor, IRS and Sos proteins. Several major "metabolic" proteins within fat cells are targets for insulin-mediated phosphorylation (Table 3) and include ATP-citrate lyase (Alexander etal, 1979; Witters, 1981), the ribosomal protein S6 (Smith et al, 1980), acetyl-CoA carboxylase (Brownsey and Denton, 1982), and PHAS-1 (Belsham et al, 1980; Belsham and Denton, 1980; Hu et al, 1994). In addition to these enzymes insulin stimulates enzymes that phosphorylate a number of transcription factors which include the ternary complex factor (Elk-1), Jun, Fos (Treisman, 1994; Hill and Treisman, 1995; O'Brien and Granner, 1996) and the cyclic adenosine monophosphate response element-binding protein (CREB, Xing et al, 1996). Both the activation and inhibition of acetyl-CoA carboxylase (ACC) mediated by insulin and adrenaline, respectively, are accompanied by modest overall increases in phosphorylation of the enzyme (Brownsey and Denton, 1982; Brownsey et al, 1977; Witters, 1981). This apparent paradox can be resolved by the demonstration that both insulin and adrenaline phosphorylate different sites on the enzyme, which can be resolved by 2-dimensional mapping of tryptic phosphopeptides. On the one hand, the insulin-mediated activation of A C C is accompanied by phosphorylation at a serine residue located on a tryptic peptide (designated as the I-peptide, (Brownsey and Denton, 1982)). Adrenaline on the other hand, induces phosphorylation of the "A-sites" which are serine residues located on the tryptic peptides designated A-peptides. The sequence of the latter peptides is known. Serine residues 79, 1200, and 1215 are the principal sites phosphorylated in response to rising cell cAMP (Haystead et al, 1990; Davies et al, 31 1990). Like PPI-G, effects of insulin on ACC may therefore be complex and full activation likely require increased phosphorylation of a distinct I-site coupled with dephosphorylation of PKA/AMP-PK-inhibiting phosphorylation sites. The effect of insulin on ATP-citrate lyase (ACL) is also complex, involving phosphorylation at one site (in tryptic peptide A) and dephosphorylation of another (tryptic peptide B) (Ramakrishna et al., 1989). The alpha-isoform of GSK3 (initially identified as multifunctional protein kinase) specifically phosphorylates Ser-450 and Thr-446 on peptide B. GSK3a activity is inhibited in response to insulin and therefore (together with an unidentified phosphatase) account for the insulin-stimulated dephosphorylation of the peptide B site. Ser-454 on peptide A is phosphorylated in response to insulin, glucagon or beta-adrenergic agonists. An insulin-stimulated cytosolic kemptide kinase also phosphorylates this site in vitro and is a potential in vivo A C L kinase (Yu et al., 1990). However, no change in A C L activity has been detected after exposing cells to insulin. 32 Table 3. Proteins exhibiting changes in phosphorylation in fat cells exposed to insulin. •Effects apparent after cAMP levels are elevated by another hormone. Adapted from Denton and Tavare, 1995. DECREASES IN PHOSPHORYLATION INCREASES IN PHOSPHORYLATION pyruvate dehydrogenase triacylglycerol lipase* glycogen phosphorylase glycogen synthase phosphorylase kinase* pyruvate kinase* eukaryotic initiation factor-2B eukaryotic elongation factor-2 insulin receptor IRS and She proteins Raf-1, MEK, MAPKs, PKB, S6 kinases GSK3, ATP citrate lyase, ACC, PHAS-1 G-subunit of protein phosphatase 1 ribosomal protein S6 cAMP phosphodiesterase 33 7.4.2.1 INSUIJN-STIMIJLA TED PROTEIN SERINE/THREONINE KINASES. Insulin stimulates a number of Ser/Thr kinases (Table 4). At the beginning of this study (in 1992), the MAPK had been discovered but not fully characterized. It was of interest to investigate the effects of MAPK activation in a physiological insulin target tissue, especially as the sea-star MAPK (p44mPk) was found to phosphorylate A C C in vitro (Pelech et al., 1991). The recent emergence of a signaling pathway involving protein kinase B (PKB) has also provided an important possible mechanism to explain the metabolic effects of insulin. The work in this thesis is therefore concerned with the role of the MAPKs and PKB in the metabolic signaling, in rat white adipose tissue. 34 TABLE 4. mSULIN-SENSnrVE SERINE/THREONINE KINASES. ENZYME EFFECT SUBSTRATES REFERENCES p70, S6K activated 40S ribosomes Cobb, 1986 Gregory et al.. 1989 Price et al., 1990 p90, rsk activated PP1-G, GS amin C Lavoinne et al., 1991 Sweet et al., 1990 Erikson, 1991 Erikson etal., 1987 p30 S6 kinase Casein kinase II activated activated S6, phosvitin ACC, PHAS-1 Hei etal., 1994 Sommercorn et al., 1987 Haystead etal., 1988 Diggle et al., 1991 GSK-3 nhibited GS. ACL inhibitor-2 c-jun, elF-2B R-subunit of PKA Welsh etal., 1996 Plyte etal., 1992 ERK1/2 activated caldesmon PHAS-1. Elk-1 p90 rsk Boulton et al., 1991 Ray and Sturgill, 1988 PKB activated GSK-3 Cross etal.,1995 ACC-kinase activated ACC Borthwick et al., 1990 Heesom et al., 1995 Raf-1 activated MEK Kovacina et al., 1990 Blackshearetal., 1990 Kyriakis et al., 1992 JNK activated c-jun, p90 rsk3 ATF-2 Moxhametal., 1996 P38MAPK (skeletal muscle) activated MAPKAPK-2 Moxham et al, 1996 P38MAPK (fetal neurons) inhibited MAPKAPK-2 ATF2 Hedenreich and Kummer, 1996 Insulin receptor ser/thr kinase activated insulin receptor Carter etal., 1996 Tauer et al., 1996 p52 kemptide kinase activated ACL, kemptide Klarlund et al., 1990 eEF-2 kinase inhibited eEF Redpath etal., 1996 35 /. 4.2.1.1 MAP KINASE ISOFORMS. Mitogen-activated protein kinases (MAPKs), also known as extracellular signal-regulated kinases (ERKs), are important intermediates in the signal transduction pathways initiated by a wide variety of stimuli. Some of these stimuli engage receptor tyrosine kinases (such as insulin, EGF, PDGF), G protein-coupled receptors (such as thrombin, bombesin and bradykinin) as well as cytokine receptors. The M A P K pathway appears to mediate cellular responses that include differentiation, proliferation, stress responses and apoptosis in different cell types. Thus although various cell types have developed different receptors during evolution, signals from these receptors appear ultimately to converge on common pathways. In the budding yeast Saccharomyces cerevisiae, five independent M A P K cascades were identified and characterized before the completion of sequencing of the genome, which has revealed further potential MAPK candidates (Hunter and Plowman, 1997). These putative MAPKs are not yet characterized and will not be discussed further. The various yeast MAPK pathways control distinct physiological processes which include control of the mating pheromone response, cell wall biosynthesis, control of sporulation, sensing of hyperosmotic enviroments as well as the invasive growth response (Ammerer, 1994; Errede and Levin, 1993;Neiman, 1993; Herskowitz, 1995). Homologous MAPKs in these pathways include: KSS1 and FUS3, MPK1, SMK1, and HOG1 (Fig. 3). 36 FIGURE 3. CELLULAR RESPONSES THAT DEPEND ON MITOGEN-ACTIVATED PROTEIN KINASES IN YEAST. The figure compares pathways by placing structural related elements at the same level. The sequence of interaction is shown with arrows indicating activation or bars denoting inhibition. The sporulation MAP kinase (SMK1) is not shown. Mating response Pseudo-hyphal response Cell shape Osmolarity Mating response Receptor: G protein: MAPKKK: MAPKK: MAPK: STE2/3 I Gpy I STE20 I STE11 I STE7 I FUS3 KSS1 I ? i STE20 i STE11 i STE7 I ? ? . Sholp i ? PKC1 i Slnlp 1 Ssklp I BCK1 STE11 Ssk2 Ssk22 i MKK1/2 I MPK1 i ->PBS2 H O G l ? I Ga i byr2 I byrl I spkl 37 The pheromone-response pathway is well defined and represents a paradigm for the molecular mechanisms that mediate signaling (Neiman, 1993; Herskowitz, 1995). Exposure of yeast cells to mating pheromone activates the partially redundant M A P K homologues KSS1 and FUS3. Defects in this signaling system lead to a sterile phenotype. A second MAPK pathway controls cell wall biosynthesis through the homologue MPK1 (Neiman, 1993; Errede and Levin, 1993; Herskowitz, 1995). Cells lacking components of this pathway are fragile, and lyse unless grown in osmotically buffered medium. Recent studies have shown that this pathway is in fact, activated following exposure of yeast cells to hypotonic conditions (Davenport et al., 1995). A second osmosensing system in yeast involves the high osmolarity glycerol signal pathway (Brewster et al, 1993). In this pathway, HOG1 is activated when yeast cells are exposed to hyperosmotic conditions. This leads to increased glycerol biosynthesis which restores the osmotic gradient across the cell membrane and enables the cells to proliferate when exposed to hyperosmotic environment. HOG1 activating input is integrated from the yeast osmosensors via two independent routes. One activating pathway uses a two component histidine kinase response regulator; the other depends on protein-protein interactions between SH3 domains of the Shop protein with proline-rich motifs of its target, Pbs2 (Brewster et al, 1993; Maeda et al, 1995). The activation of Pbs2 by Shop is thought to be mediated by Stel 1 MAPKKK, which is also an element of the pheromone response pathway (Posas and Saito, 1997). Diploid yeast cells deprived of both nitrogen and a fermentable carbon source exit the mitotic cell cycle and enter meiosis and spore development. The sporulation response is also mediated by a MAPK pathway. SMK1 is the MAPK that is required for the completion of sporulation (Krisak et al, 1994). Mutants defective in this pathway produce non-viable spores with abnormal spore walls. Under conditions of limiting nitrogen, diploid strains of yeast exhibit an invasive growth response (Gimeno et al, 1992). Cells undergo asymetric cell divisions producing long filaments (pseudohyphae) which radiate 38 from the colonies and penetrate the agar substrate on which they are grown. This pathway which provides the dimorphic switch to pseudohyphal growth requires the upstream kinases (STE7, STE11, and STE20) and the STE12 transcription factor of the mating-pheromone response pathway (Roberts and Fink, 1994). However, the pheromone receptors, including the guanosine triphosphate-binding proteins and the MAPKs (KSS1 and FUS3) are not required implying that the pathway employs a distinctive starvation-sensitive M A P K (Liu et al, 1993). A notable conclusion from this finding is that signal pathways may not only converge, but also diverge upon MAPK activation. Taken together, the multiple yeast cascades indicate that signaling specificity may result from parallel, non-overlapping MAPK pathways. Fission yeast (Schizosaccharomyces pombe) and budding yeast (S. cerevisiae) are highly divergent but show remarkable similarities regarding their sexual differentiation pathways (Herskowitz, 1995). Notable differences between the budding and fission yeast pathways include the function of the heterotrimeric G proteins as well as the requirement of a nutritional input. In S. cerevisiae a trimeric G protein is coupled to the pheromone receptor and the Py-subunits mediate activation of the MAPK pathway; conversely in S. pombe, the a-subunit of the G protein regulates the MAPK pathway (Nieman et al, 1993). Whereas, starvation is a prerequisite for mating in fission yeast, sexual differentiation in budding yeast ocurrs under all nutritional conditions. In spite of these differences, the similarities between the MAPK cascades of the two yeast species are striking. The sequential components MEKK, M E K and MAPK are structurally and functionally homologous in each case. For example, the fission yeast M E K (byrl) can partially complement a budding strain lacking the corresponding activity STE7 (Neimann et al, 1993). Thus despite significant differences in the initial events, the M A P K cascade has been conserved in the sexual response pathway of these two distantly related yeasts. The conservation of MAPK cascades has in fact been maintained through many stages in evolution because highly related proteins have also been observed in Caenorhabditis 39 elegans, Drosophila melanogaster and mammalian cells. In each case, input signals are integrated and transmitted to activate MEK kinase (MEKK). Upon activation, MEKK phosphorylates and activates MEK a dual protein kinase which activates MAPK by phosphorylation on Thr and Tyr. These phosphorylation sites are located in the tripeptide motif Thr-Glu-Tyr (MPK1, KSS1 and FUS3), Thr-Gly-Tyr (HOG1) or Thr-Asn-Tyr (SMK1) which is found in the subdomain VIII of the protein kinases (Hanks et al, 1988). THE MAMMALIAN ERK/MAPK ISOFORMS The activation of MAP kinase by insulin, was first described in 3T3-L1 cultured cells (Ray and Sturgill, 1987). Subsequent cloning and sequence analysis led to the I identification of ERK1 (p44), ERK2 (p42) and ERK3 (p62) (Boulton et al., 1991). Other related isoforms include ERK4 and ERK5 (Boulton et al., 1991; Zhou et al., 1995a; Lee et al., 1995). A recently reported ERK6 (Lechner et al., 1996), shares the activating sequence TGY with the p38 isoform of MAP kinases. ERK1 and ERK2 are the best characterized of the ERK isoforms and share 90 % amino acid identity, indicating probable functional redundancy. ERKs are phosphorylated and activated by highly specific kinases MEK1 and MEK2 (Zheng and Guan, 1993). The activating phosphorylation sites reside within the tripeptide motif TEY (single letter amino acid designation) at Thr-183 and Tyr-185 of ERK2. The phosphorylation of the TEY seems to be ordered in that tyrosine phosphorylation precedes threonine (Haystead et al, 1992). MEK appears to be unusually specific in that so far, no other MEK substrates have been identified, although MBP can be weakly phosphorylated by MEK1 in vitro. Moreover, MEKs fail to recognize either the denatured ERKs or peptides containing ERK phosphorylation sites, indicating the requirement for the native form of this substrate. MEKs are, in turn, activated by MEKKs including Raf isoforms, c-Mos and MEKK1 (Johnson and Vaillancourt, 1994) and MEKK3 (Blank et al, 1996). The activation of MEKKs can be initiated through receptor tyrosine kinases or heterotrimeric G proteins. In 40 addition, protein kinase C (PKC) may regulate the MAPK pathway alone or with other mechanisms (Cobb and Goldsmith, 1995). Characterization of the ERKs other than ERK-1 and -2 has so far been rather limited. Very little is known about ERK4. ERK3 which is 50% identical to ERKs 1 and 2 is strictly a nuclear protein kinase (Cheng et al, 1996). Furthermore, ERK3 does not phosphorylate any of the typical ERK substrates. Moreover, ERK3 lacks the tyrosine phosphorylation site that is absolutely conserved among other kinases of this family (Cheng etal, 1996). Consequently, ERK3 kinase activates ERK3 through serine phosphorylation (Cheng et al, 1996a). ERK5 with a molecular mass of 98 kD, has a substantially larger subunit size than the other ERKs (Zhou et al, 1995a) and appears to have a specific activator, MEK5, implying the existence of yet another M A P K pathway. At least three major classes of receptors can induce MAPK activation - receptors with intrinsic or associated protein tyrosine kinase and those which couple through i heterotrimeric G proteins. As noted earlier, (Section 1.2.2) ligand binding to tyrosine kinase receptors (such as receptors for insulin, EGF, PDGF and FGF) leads to receptor dimerization (EGF, PDGF, FGF) and autophosphorylation. Following insulin receptor activation, phosphorylated receptor substrates including (IRS and She proteins) provide docking sites for SH2-containing proteins such as the adaptor protein Grb2, which binds Sos and thus recruits it to plasma membrane. Sos is a catalyst that stimulates GDP dissociation from Ras allowing GTP to bind. Ras-GTP binds to and targets the kinase Raf-1 to the plasma membrane thereby permitting its activation by signals yet to be fully identified (Leevers et al, 1994; Stokoe etal, 1994). The involvement of 14-3-3 proteins in the activation of Raf has been suggested (Fantl et al, 1994; Freed et al, 1994; Fu et al, 1994; Irie et al, 1994) but questioned (Michaud et al, 1995). It is believed that 14-3-3 induce dimerization of Raf-1 kinase leading to its activation (Farrar et al, 1996; Luo et al, 1996). Other studies have indicated a tyrosine phosphorylation mechanism in the activation ofRaf-1 (Marais etal, 1995; Jelinek etal, 1996). Interestingly, other Raf 41 ; isoforms (e.g. B-Raf) lack the sites for tyrosine phosphorylation, therefore this activation mechanism cannot apply to all Raf family members (Daum et al, 1994; Marshall, 1996). The direct upstream regulators of both MEKK1 and Mos are still not defined. i G protein coupled receptors also activate the Raf/MAPK pathway and intriguingly both a- and Py-subunits can mediate this activation. Agonists for Gi-coupled receptors (m2 muscarinic, D2 dopamine, a2A adrenergic and Al adenosine) activate the MAPK pathway by GPy-subunits (Faure et al, 1994, Hawes et al, 1995, Koch et al, 1994, Crespo et al, 1994). This activation appears to occur through tyrosine phosphorylation of She with subsequent stimulation of Ras through Grb2/Sos (van Biesen et al, 1995). The tyrosine kinase which phosphorylates She is unknown. The protein tyrosine kinase 60c"src protein kinase or Src-family kinases are possible candidates for GPy-induced She tyrosine phosphorylation (Hawes et al, 1995; van Corven et al, 1993; Chen et al, 1994). Recent studies, however, indicate that Syk tyrosine kinase may be essential for the Gi-coupled pathway (Wan et al, 1996). In neuronal cells, the protein tyrosine kinases, Pyk2 and Src were shown to link G-protein coupled receptors with the activation of MAPKs (Lev et al, 1995;Dikic^a/., 1996). Gq-coupled receptors (bombesin, a-IB adrenergic and ml muscarinic) activate the MAPK pathway by Gaq and some studies have shown this may involve PKC. For i example, it is believed that Gaq activates phospholipase C, which in turn activates PKC (Faure et al, 1994). Indeed in some cells, PKC is known to activate the MAPK pathway, presumably by phosphorylation of Raf-1 (Kolch etal, 1993). Other studies indicate that both Syk and Lyn tyrosine kinases are necessary for the Gq-mediated activation of MAPKs (Wan et al, 1996) and this might require IJ^ -mediated increases in intracellular calcium. Gs-coupled receptors (lutropin, P-adrenergic) also induce an as-mediated activation of the MAPK pathway (Faure et al, 1994). In COS-7 cells, the mechanism of this activation proceeds through adenylyl cylase which becomes active resulting in 42 increases in intracellular cAMP (Faure et al, 1994); This contrasts sharply with observations in several other cell types, where cAMP inhibits the MAPK pathway (Wu et al, 1993; Graves etal, 1993; Burgering etal, 1993; Sevetson etal, 1993) and underlines the great care needed in interpreting relationships of results from different cell lines. Presumably, a major confounding problem is that studies in which proteins are artificially over-expressed may reveal responses which only occur with an inappropriate balance of protein expression. Once activated, ERKs phosphorylate a wide range of substrates including the downstream kinases p90rsk and MAPK-activated protein kinase-2, (Sturgill and Wu, 1991). Other enzyme-substrates include phospholipase A2 (Lin et al, 1993), tyrosine hydroxylase (Sutherland et al, 1993c) and tyrosine phosphatase SH-PTP2 (Peraldi et al, 1994). Analogous to the yeast system whereby the transcription factor STE12 is phosphorylated by FUS3 and KSS1, some of the ERKs' substrates are nuclear transcription factors that are thought to be phosphorylated after ERKs' translocation to the nucleus. These transcription factors include c-Jun, c-Myc, Elk-1, c-Fos and NF-JX6 (Pulverer et al, 1991; Seth et al, 1992; Gille et al - 1992; Janknecht et al, 1993; Chen et al, 1993; Nakajima etal, 1993). In addition to enzymes and transcription factors, another set of ERK substrates are the cytoskeletal proteins MAP-2, MAP-4, tau and caldesmon (Ray and Sturgill, 1987; Hoshi etal, 1992; Drewes etal, 1992; Childs and Mak, 1993a). Furthermore, proteins including the eIF-4E binding protein (PHAS-1) and myelin basic protein (Haystead et al, 1994; Erickson et al, 1990) are phosphorylated. Finally, some of the upstream components of the MAPK cascade itself are potential MAPK substrates. Thus the EGF receptor, NGF receptor, IRS-1, Sos, c-Raf and MEK-1 are potential ERK substrates (Northwood et al, 1991; Myers et al, 1994; Cherniack et al, 1994; Ueki et al, 1994; Rossomando et al, 1994). Phosphorylation of these upstream elements may form part of a complex feed-back inhibition system which might explain the transient nature of MAP 43 kinase activation in many cases. Assuming that all the ERK phosphorylations are physiologically relevant, it is clear that the pathway serves a myriad of purposes, which will depend on the cellular context. Analysis of the substrates phosphorylated by" ERKs has demonstrated that the kinases are "proline directed", meaning that they phosphorylate serine or threonine residues that are adjacent to prolines. Isolation and sequencing of the bovine MBP phosphopeptide phosphorylated by the sea star MAPK identified the major site as Thr-97 (Sanghera etal., 1990). The optimal consensus sequence for substrate recognition by ERKs was subsequently found to be Pro-Xaa-Ser-/Thr-Pro (Clark-Lewis et al., 1991; Alvarez etal., 1991; Gonzalez etal., 1991). However, many phosphorylated substrates do not contain the first (-2) proline and the minimal consensus sequence is therefore, Ser/Thr-Pro. This consensus emerged from a comparison of the phosphorylation kinetics of synthetic peptides and knowledge of the sequences within intact protein substrates phosphorylated by the kinase. A new approach for determining the primary sequence specificities of protein kinases has employed oriented degenerate peptide libraries. In one method, a pool of soluble distinct peptides (approximately 2.5 billion) are phosphorylated, separated from the bulk of non-phosphorylated and then sequenced (Songyang et al, 1994). In a related but distinct approach, phosphorylated peptides from the library are identified using liquid chromatography-electrospray mass spectrophotometry (Till et al., 1994). Using this approach, Songyang and co-workers predicted the optimal peptide substrate for ERK1 to be Thr-Gly-Pro-Leu-Ser-Pro-Gly-Pro-Phe (Songyang et al, 1996). Critical determinants for recognition by ERK1 and other kinases are residues at the -3 and +1 positions of the substrate and the basis of this selectivity was rationalized on the crystal structure of the kinases. Some characteristics of ERK isoforms are shown in Table 5. 44 Table 5. Characteristics of ERK isoforms. ISOFORM MW ACTIVATING MEK DISTINCT TISSUE SEQUENCE FEATURES ERK1 44 TEY MEK1 All MEK2 ERK2 42 TEY MEK1 All MEK2 ERK3 62 SEG ? skeletal muscle ERK4 45 ? ? brain ERK5 98 TEY MEK5 heart, skeletal muscle ERK6 45 TGY Activated by skeletal orthovanadate muscle only 45 THE JNK/SAPK ISOFORMS The Jun-N-terminal/stress-activated protein kinases (JNK/SAPK) are another family of MAPKs distinct from ERKs that are also regulated by extracellular signals. JNK was initially identified by virtue of its ability to phosphorylate the amino-terminal domain of the transcription factor c-Jun at Ser-63 and Ser-73 (Hibi et al, 1993). Molecular cloning of a cycloheximide-activated MAP kinase led to an independent identification of a family of stress-activated protein kinases which also phosphorylated the amino-terminal region of c-jun (Kyriakis et al, 1994). JNKs are distantly related to ERKs with 40-45% sequence identity. The activation of JNKs is associated with and dependent upon phosphorylation in a tripeptide motif TP Y which is comparable to the TEY of the ERKs. JNKs are potently activated by agents such as protein synthesis inhibitors (cycloheximide and anisomysin), inflammatory cytokines such as tumor necrosis factor and interleukin-1 and by environmental stresses such as ultraviolet irradiation, heat shock and changes in osmolarity (Derijard et al, 1994; Kyriakis et al, 1994). Evidence exists to support the contention that JNKs phosphorylate the transactivation domain of c-Jun in vivo (Derijard et al, 1994; Kyriakis et al, 1994). The functional significance of this phosphorylation is to increase transcriptional activity. c-Jun homodimers and c-Jun/ATF-2 or c-Jun/c-Fos heterodimers have potent AP-1 activity which can control the expression of a number of genes including c-Jun itself (Angel et al, 1988; Deng and Karin, 1993; van Dam et al, 1993). In line with the above, JNKs have also been shown to phosphorylate ATF-2 (Guptasal, 1995). Similarly to ERKs, JNKs are phosphorylated and activated through a kinase cascade in which MEKK1 or MEKK2 phosphorylates and activates a dual specificity kinase, MKK4 (also known as SEK1 or JNKK), which in turn, phosphorylates and activates JNK isoforms (Derijard et al, 1995; Sanchez et al, 1994; Lin et al, 1995; Blank etal, 1996). MKK4 also phosphorylates and activates another MAPK isoform, p38 and therefore, provides means of crosstalk between the two stress-activated pathways 46 (Raingeaud et al, 1995; Derijard et al, 1995). Recent evidence has implicated the small GTP-binding proteins Rac and Cdc42Hs in the activation of JNKs (Minden et al, 1995; Coso et al, 1995). PAK65, a protein kinase with a Cdc42- and Rac-binding domain, is a potential mediator of this signaling pathway (Manser et al, 1994; Martin et al, 1995; Zhang et al, 1995). Intriguingly, PAK65 is a mammalian homologue of the yeast STE20 protein kinase, which is an upstream activator of the yeast KSS1 and FUS3 MAPKs. More recent data has indicated the existence of a germinal centre kinase (GCK), another putative STE20 homologue which can activate JNKs (Pombo et al, 1995; reviewed by Sells and Chernoff, 1997). The p38/HOGl ISOFORMS The p38 subgroup of MAPKs consists of p38 (also known as RK, CSBP), p38-2, p38{3, Mxi2 and ERK6 (also known as SAPK3). This MAPK subgroup represents the mammalian homologues of the yeast HOG1 kinase. Like HOG1, p38 can be activated by hyperosmolarity (Han et al, 1994; Galcheva-Gargova et al, 1994). In addition, lipopolysaccharide, pro-inflammatory cytokines and environmental stresses stimulate the p38 pathway and indicates that the p38 and JNK pathways may be functionally related (Freshney et al, 1994; Rouse et al, 1994; Lee et al, 1994). Indeed, both JNK and p38 complement yeast mutants defective in HOG1, although only p38 shares the dual phosphorylation motif TGY with the yeast HOG1 (Han et al, 1994; Galcheva-Gargova et al, 1994). The MAP kinase kinases which phosphorylate and activate p38 include MKK3, MKK4 and MKK6/MEK6 (Derijard et al, 1995; Raingeaud et al, 1996; Han et al, 1996; Stein et al, 1996). MKK3 and MKK6/MEK6 are specific for p38 whereas, MKK4 activates both JNK and p38 (Raingeaud et al, 1995). Among the substrates of p38 are the transcription factors, ATF-2, Elkl and Sap-la and the protein kinase MAPKAPK-2 (Stein etal, 1997; Raingeaud al, 1995; Rouse et al, 1994; Freshney et al, 1994). A summary of some relevant characteristics of the MAPK pathways is given in Table 5. 47 Table 6. Characteristics of M A P K pathways. PATHWAY ERK JNK/SAPK P38/Mpk2/RK STIMULUS serum, LPA, UV, mitogens LPS, Ca. TPA redox, cytokines UV, IL-1, heat anisomycin TNF alpha osmotic stress UV, LPS A anisomycin arsenite G PROTEIN Ras Rac, Cdc42 ? MAPKKKK ? GCK, Pak ? ? MAPKKK Raf, MEKK3 MEKK1, MEKK2 ? MAKK MAPK MEK1, MEK2 ERK1, ERK2 JNKK/SEK/MKK4 JNK/SAPK MKK3, MKK6 /MEK6 p38/Mpk2/RK 1.4.2.1.2 S6 KINASES. The S6 protein is a component of the 40S subunit of eukaryotic ribosomes. Agents that promote protein synthesis, such as hormones (insulin) and growth factors lead to S6 phosphorylation. Up to five of six Ser residues in the carboxy terminus of S6 become phosphorylated (reviewed by Proud, 1996). Two distinct families of kinases that phosphorylate S6 in vitro have been identified. One family consists of the ribosomal S6 kinase (rsk)-encoded kinases of relative molecular mass 85-92-kDa. The rsk-kinases (p90rsk) lie in the MAPK signaling pathway and do not seem to phosphorylate S6 in intact cells. The other family consists of the S6 kinase alternative splice products, cytosolic plO^ and nuclear p85s6k. This family, (henceforth called p70s6k) is likely to phosphorylate S6 in vivo based on several lines of evidence. For example, p70s6k phosphorylates 40S ribosomal units more efficiently in vitro than p90rsk. Additionally, rapamycin (an inhibitor of the activation of p70s6k but not that of p90rsk) blocks S6 phosphorylation in response to various stimuli in intact cells. 48 FK506 and rapamycin are bacterially derived lipid-soluble macrocyclic lactones which are potent immunosuppressants (Kunz and Hall, 1993). Both FK506 and rapamycin bind to a soluble intracellular receptor called FKBP12 (FK506-binding protein). Although they both bind to the same cellular target with high affinity (Kd = 0.2-0.4 nM, Choi et al, 1996), FK506 and rapamycin suppress immune responses by interfering with distinct steps (Abraham and Wiederrecht, 1996). FKBP12-FK506 binds to calcineurin a Ca2+/calmodulin-dependent Ser/Thr phosphatase (also known as phosphatase 2B) and inhibits its phosphatase activity (Liu et al, 1991; Griffith et al, 1995). Calcineurin dephosphorylates the transcriptional factor NF-AT (nuclear factor for activated T-cells), which is then translocated from the cytoplasm to the nucleus (Schreiber and Crabtree, 1992; Abraham and Wiederrecht, 1996). Once in the nucleus, NF-AT activates immune response genes such as interleukin-2 (EL-2). Inhibition of calcineurin by FKBP12-FK506 correlates with the inability of T-cells to produce IL-2, which is critical in T-cell proliferation. Interestingly, GSK-3 and another unknown priming kinase phosphorylate and therefore promote nuclear export of NF-AT (Beals et al, 1997). In contrast to FKBP12-FK506 which interrupts the signaling pathway leading to the production of IL-2, FKBP12-rapamycin inhibits the proliferative response of activated T-cells to EL-2 and other lymphokines. The target of FKBP12-rapamycin was initially identified in yeast as TOR (target of tapamycin) and in mammalian cells as mTOR (also called RAFT, for rapamycin-FKBP target or FRAP, for FKBP-rapamycin associated protein). Interestingly, a homology between TOR and PI 3- kinases has been reported. mTOR undergoes autophosphorylation which is blocked by rapamycin-FKBP 12 complex as well as wortmannin and LY294002, two commonly used PI 3-kinase inhibitors (Brown et al, 1995; Brunn et al, 1996). This finding raises a cautionary note concerning the specificity of these PI 3- kinase inhibitors. However, mTOR does not phosphorylate p7Qs6k directiy An additional component therefore exists between mTOR and p70s6k. Similarly, the link of the rapamycin-sensitive step to cell surface receptors is also 49 undefined. Neither Ras nor Raf appear to be required in the activation of p70s6k (for reviews, see Proud, 1996; Chou and Blenis, 1995). In contrast, strong evidence exists for the role of PI 3-kinase. For example a constistutively active PI 3-kinase was shown to activate p70s6k. Additionally, wortmannin was shown to inhibit p70s6k activation. Another link to PI 3-kinase came from the demonstration that constitutively active PKB (which lies downstream of PI 3-kinase) leads to the induction of p70s6k. 1.4.2.1.3 PROTEIN KINASE B Protein kinase B (PKB) is a recently discovered protein Ser/Thr kinase. Due to its homology with protein kinase C (PKC, 75 % similarity) and cyclic AMP dependent i protein kinase (PKA, 65 % similarity), one group named the kinase PKB (i.e. between PKA and PKC, Coffer and Woodgett, 1991), while the other group named it RAC (for related to PKA and PKC, Jones et al, 1991). The third group identified the kinase as the product of the oncogene v-akt, from the acutely transforming rodent retrovirus AKT8 (Bellacosa et al., 1991). Thus Akt/PKB (hereafter referred to as PKB) is not only a protein Ser/Thr kinase but also encoded by a proto-oncogene. PKB is rapidly activated by a variety of agents including hormones (insulin), growth factors (platelet-derived growth factor, epidermal growth factor, and basic fibroblast growth factor), pervanadate, okadaic acid, isoproterenol, heat shock and hyperosmolarity. Compelling evidence now indicates that PKB is a new candidate PI3-K effector. This is based on the use of a combination of strategies aimed at preventing the activation of PI3-K. Thus the expression of PDGF receptor mutants unable to bind PI3-K, dominant negative PI3-K mutants or the use of the inhibitor wortmannin were all found to block the activation of PKB (Burgering and Coffer, 1995; Franke et al, 1995; Kohn et al, 1995). These data place PI3-K upstream of PKB, and consistent with this notion, expression of constitutively activated forms of PI 3 kinase as reported by Klippel et al. (1996), increased PKB activity independent of growth factor stimulation. 50 Unlike PKA and PKC, PKB contains an amino-terminal pleckstrin homology (PH) domain. Discrepancy, however, exists regarding the role of the PKB PH-domain. One group believes that the PH domain mediates a stimulatory homodimerization of the kinase (Datta et al, 1995). This hypothesis is further supported by work from Franke and coworkers (1995) who reported an apparent activation of the kinase following incubation with phosphatidylinositol 3-phosphate (Ptdlns-3P). The significance of this activation is not clear since the concentration of Ptdlns-3P is not altered following growth factor treatment (Auger et al, 1989). Furthermore, point mutations in the PH domains have been shown to block the activation of PKB by growth factors (Franke et al, 1995) or constitutively active PI 3-kinase (Klippel et al, 1996). In apparent conflict with the above data, another group found that the PKB PH domain was not essential for PKB activation by insulin (Kohn et al, 1995) or okadaic acid (Andjelkovic et al, 1996). Cell type and/or stimuli differences may reconcile these apparently conflicting data on the relative importance of the PH domain. Recent studies have indicated that phosphatidylinositol diphosphate (PtdIns(3,4)P2) stimulates PKB (Franke et al, 1997; Klippel et al, 1997). Unlike PtdIns(3)P, PtdIns(3,4)P2 levels increase in response to growth stimuli, therefore this stimulation may be physiologically relevant (Auger et al, 1989). Furthermore, the activation of PKB by PtdIns(3,4)P2 correlates with the ability of the purified protein and isolated PH domains of PKB to bind PtdIns(3,4)P2 with higher affinity than it binds to PtdIns(4,5)P2 or PtdIns(3,4,5)P3. However, the in vitro activation of PKB by Ptdlns (3,4)P2 is modest compared to that achieved following growth factor stimulation, indicating that additional mechanisms exist for full activation of PKB in vivo. The activation of PKB by insulin and growth factors is accompanied by an appearance of a slow migrating PKB protein on SDS-PAGE gels, a phenomenon attributed to phosphorylation of the enzyme (Burgering and Koffer, 1995; Kohn et al, 1995). This phosphorylation was shown to be essential for activation as treatment with 51 phosphatases completely abolished PKB activity. The major phosphorylation sites have been identified as Thr-308 and Ser-473 (Alessi etal., 1996). A new kinase called PtdIns(3,4,5)P3-dependent kinase (PDK-1) phosphorylates (Thr-308 ) and activates PKB (Alessi et al, 1997). PDK-1 in turn is activated by both PtdIns(3,4)P2 and PtdIns(3,4,5)P3. Ser-473 is phosphorylated in vitro by MAPKAP kinase 2, a downstream target of p38/HOG kinase (Alessi et al, 1996). Curiously, other agents can activate PKB by a phosphorylation-independent mechanism. Among these, are the 0-adrenergic agonist, isoproterenol, heat shock and hyperosmolarity. Stimulation by these agents seems to involve a different mechanism, because of lack of mobility shift of the PKB protein on SDS-PAGE gels. The first protein target of PKB action was identified as GSK-3, which is inhibited in a PKB-dependent manner by treatment of cultured skeletal muscle (L6 myotubes) with insulin (Cross et al, 1995). PKB was shown to phosphorylate GSK-3 on the same, single serine residue that is phosphorylated and subsquently associated with inhibition of GSK-3 in vivo. Although this same serine residue in GSK-3 can be phosphorylated in vitro by both p90rsk and p70s6k, the use of inhibitors of these pathways have shown that at least in L6 myotubes treated with insulin, PKB appears to be fully responsible for phosphorylating and inhibiting GSK-3. In other experiments, expression of constitutively active forms of PKB have also provided evidence that the p70s6k lies downstream of PKB (Burgering and Koffer, 1995). The second protein substrate phosphorylated by PKB is heart 6-phosphoffucto-2-kinase (PFK-2, Deprez et al, 1997). Both p70s6k and p90rsk phosphorylate PFK-2 in vitro and phosphorylation by all three kinases is associated with increases in the activity of PFK-2. However, activation of PFK-2 by insulin is insensitive to inhibition of p70s6k and p90rsk by rapamycin and PD 098059, respectively (Deprez et al, 1997). This indicates that PKB may mediate the insulin-dependent activation of PFK-2 in vivo. 52 More recently, a number of studies have ascribed a new cellular function to PKB namely, the promotion of cell survival or prevention of apoptosis by IGF-1 (Dudek et al, 1997). Overexpression of PKB prevented apoptosis in cultures of cerebellar neurons following withdrawal of survival factors or inhibition of PI3-K. In addition, expression of dominant negative PKB alleles interfered with growth factor mediated survival of these cells, indicating the importance of PKB activity for neuronal survival. Other studies showed that constitutively activated PKB prevented UV- or c-myc-induced apoptosis in Rat-1 fibroblasts (Kulike*al, 1997; Kauffmann-Zeh etal, 1997). Taken together, the emerging picture is an additional signal-transduction pathway that currently comprises a lipid kinase followed by a lipid-activated kinase that targets PKB with widespread roles in cell regulation. Additional direct downstream targets of PKB may still exist. GSK-3 is involved in some of the metabolic effects of insulin (glycogen and protein synthesis) and PFK-2 functions in glycolysis. An important question which arises is whether PKB participates in other branches of metabolism including fatty acid biosynthesis, lipolysis and protein metabolism. 1.5 THESIS INVESTIGATION. The work in this thesis was originally initiated to identify and characterize the insulin-sensitive acetyl-CoA carboxylase (ACC) kinase in rat white adipose tissue. The focus was on MBP kinases because previous studies in this laboratory had indicated the coincident elution of MBP and ACC kinases on anion exchange chromatography. In addition, a sea star MBP/MAP kinase had been shown to phosphorylate ACC apparently on the insulin-directed site. MBP is a promiscuous substrate, because it is phosphorylated by many different kinases. The fat cell MBP kinase therefore had to be purified in order to test it as a bona fide "ACC-kinase". Purification of the fat cell MBP kinase was achieved, but this enzyme was not responsible for the insulin-mediated increases in ACC phosphorylation. Chapter 3 describes the stabilization, purification and characterization of 53 rat fat cell MBP kinase. The persistence of actin co-purification led us to investigate! -whether a specific interaction exists between the kinase and the cytoskeletal protein. The results are described in Chapter 4. With the discovery of c-Jun N-terminal and p38 Hog MAP kinases, the emphasis of the study shifted to determining whether any of these new MAP kinase isoforms was involved in the overall regulation of fatty acid biosythesis by insulin. The MAP kinases are osmo-sensitive, i.e. they can be activated under hypo- and/or hyper-osmotic conditions. Changes in osmolarity have also been shown to influence metabolism. For example hypo-osmolarity can mimic the anabolic effects of insulin on metabolism. I therefore, investigate the potential roles of the osmo-sensitive MAP kinases in one of the cardinal responses of insulin to metabolism - the stimulation of fatty acid biosynthesis. Chapter 5 describes the effects of hypo- and hyper-osmolarity on the activities of MAP kinases, and on fatty acid biosynthesis. Activation of the ERKs differed from that of fatty acid biosynthesis in two ways. Firstly, hypo-osmotic conditions alone stimulated the ERKs. Secondly, the activation of ERKs by insulin was inhibited under hyper-osmotic conditions. Unlike fatty acid biosynthesis JNKs were activated by both hypo- and hyper-osmotic conditions in the absence of insulin. Both insulin and changes in osmolarity within the range 228-404 mOsM led to modest activation of p38 Hog MAP kinase. The findings in Chapters 3 and 5 therefore, indicated that MAP kinases are not required for either the insulin-directed phosphorylation of ACC or for the overall regulation of fatty acid biosynthesis by insulin. The lack of a significant role of the MAP kinases in the stimulation of fatty acid biosynthesis by insulin, together with the discovery of a new insulin-sensitive Ser/Thr kinase (PKB), prompted us to investigate whether PKB was the relevant kinase in the metabolic effects of the hormone. Chapter 6 addresses the possibility that the newly discovered insulin-sensitive PKB may be involved in some of the metabolic effects of insulin. Insulin induced a rapid and 54 sustained activation of PKB in rat adipose tissue. A prominent activation was observed with a membrane-associated enzyme. PKB immunocomplexes phosphorylated ACC in sites which were distinct from those associated with the insulin-stimulated protein kinase or AMP- and cAMP-dependent protein kinases. Phosphorylation of ACC with the PKB immunocomplexes, however, did not lead to changes in the enzymatic activity of ACC. In contrast to PKB immunoprecipitates, recombinant PKB was unable to phosphorylate ACC. This finding indicates that an ACC-kinase might have been associated with the PKB immunoprecipitates. Alternatively, the ACC-kinase contained a PH domain, thus enabling co-precipitation with the PKB antibody. Vanadium, an insulin mimetic, also activated PKB. The activation of PKB by vanadium occurred at concentrations below the threshold required to inhibit isoproterenol-stimulated lipolysis. The stimulation of glycogen synthase by vanadium, correlated with that of PKB. It is concluded that PKB is not the insulin-sensitive ACC I-site kinase. Furthermore, PKB is not required for the antilipolytic effects of vanadium. 55 CHAPTER TWO EXPERIMENTAL PROCEDURES. 2.1 MATERIALS Male Wistar rats (160-180 g) supplied by the Animal Care Unit of the University i of British Columbia were maintained on a 12 h-light/12 h-dark cycle and were allowed free access to water and Purina rat chow up to the time of killing (8:30-9:30 a.m.). The protease inhibitors leupeptin and pepstatin A were from Peptides International (Louisville, KY). Pefabloc SC was from Boehringer Mannheim (Laval, Quebec, Canada). Bovine myelin basic protein, microcystin-LR, dithiothreitol and BSA were bought from Sigma Chemical Co. (St. Louis, Mo.). Radioisotopes, ECL reagents and rainbow molecular markers were purchased from Amersham International (Oakville, Ontario, Canada). Reagents for PAGE were from Bio-Rad Laboratories Canada Ltd. (Mississauga, Ontario, Canada). Immobilon-P membrane was purchased from Millipore Canada Ltd. (Mississauga, Ontario, Canada). Reflection Autoradiography film was from NEN Research Products (Mississauga, Ontario, Canada). Materials for chromatography, including FPLC, were from Pharmacia Biotech Canada Inc. (Baie D'Urfe, Canada). The phospho-specific and control MAPK antibodies were bought from New England Biolabs Ltd. (Mississauga, Ontario, Canada). The anti-phosphotyrosine antibody (4G10) as well as protein-A agarose were from Upstate Biotechnology Inc., (Lake Placid, NY). Reagents for glycerol analysis were bought from Boehringer Mannheim. Antibodies against SAPK isoforms, Hog MAP kinase, PKB as well as Hsp-27, MEK(AN3) and GST-c-Jun (1-169) were kindly provided by Dr. S. L. Pelech (The Biomedical Centre, Kinetek site, University of B.C.). The phosphotyrosine phosphatase PTP-1B was a generous gift from Dr. F. Jirik (The Biomedical Centre, University of B.C.). All other chemicals and solvents were i purchased from BDH Chemicals or Fisher Scientific Ltd. (both of Vancouver, B.C., Canada). 56 2.2 M E T H O D S 2.2.1 Tissue isolation, incubation and processing. Male Wistar rats (typically 6-8 @ 160-180 § for each experiment) were stunned and killed by cervical dislocation. Epididymal and perirenal fat pads were immediately removed and incubated with shaking at 37 °C in Krebs-Henseleit buffer (120 mM NaCl, 24.9 mM NaHC03, 1.2 mM MgS04, 1.2 mM KH2P,04, 1.25 mM CaCl2, 4.7 mM KC1 and 8.6 mM glucose), gassed with 02:C02 (19:1). This was followed by an additional 10 min incubation (if not otherwise stated), in iso-, hypo- or hyper-tonic medium with or without insulin (0.5 ug/ml). In isotonic incubations the osmolarity was 316 mosM. Hypo- and hypertonic media were achieved by removing or adding 44 mM NaCl resulting in osmolarities of 228 and 404 mosM, respectively. At the end of the incubation period, pads were removed from the media, lightly and rapidly blotted. The tissue was then disrupted with a Polytron PT 15-35 (Kinematica) tissue homogenizer (setting 6, for 3 s), into buffer containing 50 mM Mops pH 7.2, 250 mM sucrose, 40 mM p-nitrophenyl phosphate, 5 mM EDTA, 2 mM EGTA, 1 mM sodium orthovanadate, 1 mM DTT, 1 uM 0-methylaspartic acid, 100 nM microcystin-LR, 4 mM pefabloc SC, 2.5 mM benzamidine and 2 p:g/ml each of pepstatin A and leupeptin. The extraction used 3 ml buffer per gram fresh weight of tissue. The homogenate was centrifuged at 12,000 x g for 20 min resulting in a fat-free infranatant, which was further centrifuged at 360,000 x g (100,000 RPM) for 10 min using a Beckman TL-100 benchtop ultracentrifuge or at 215,000 x g (55,000 RPM, Beckman 60 Ti or 70 Ti rotors) for 1 h. The supernatant fraction designated high speed supernatant (HSS) was collected. Saturated ammonium sulphate solution (pH 7.0) was added to HSS to give 50 % saturation. After incubation with stirring at 4 °C for 1 h, the precipitated protein was pelleted by centrifugation (27,000 x g, 30 min). The ammonium sulphate pellets were stored at -70 °C until further use. 57 Preparation of isolated fat cells from rat adipose tissue. i, This was based on the original method of Rodbell (1964). Isolated fat pads were preincubated in Krebs Henseleit buffer at 37 °C for 20 min. The tissue was then dissected to give 5 pieces per pad and transferred into fresh Krebs-Henseleit buffer containing 0.5 mg/ml collagenase and 0.7 % BSA that had been dialyzed against 120 mM NaCl and 1.25 mM CaCl2. The mixture was regassed and incubated for 10 min at 37 °C with occasional thorough shaking. Fat cells were separated from residual tissue by passing through a nylon mesh filter. The suspension of cells was centrifuged in polyethylene centrifuge tubes for 30 s at 400 x g. The fat cells floated to the surface while the stromal-vasicular cells sedimented. The stromal-vascular cells were removed by aspiration and the fat cells washed by resuspending in 10 ml of Krebs-Henseleit buffer (37 °C) containing 0.7 % BSA and centrifuging for 30 s at 400 x g. This procedure was repeated three times. Finally, the cells were resuspended in 15 ml of Krebs Henseleit buffer containing 0.7 % BSA and 0.2 uM adenosine, regassed and incubated with shaking at 37 °C for 1 h. After the preincubation, cells were resuspended in fresh Krebs Henseleit buffer containing 0.7 % BSA and sub-aliquotted into final incubations. 2.2.2 Purification of MBP kinase. Polysine-agarose chromatography. Ammonium sulphate pellets were resuspended in buffer A (12.5 mM Mops, pH 7.2, 12.5 mM J3-glycerolphosphate, 0.5 mM EGTA, 7.5 mM magnesium acetate, 2.5 mM benzamidine, and 2 p.g/ml each of pepstatin A and leupeptin) and clarified by centrifugation in an Eppendorf centrifuge (16,500 x g). A further clarification was achieved by passing the protein sample through a 0.22 p. filter. The sample was desalted using a 10 DG column (Bio-Rad), and was immediately loaded on a polylysine column (1.6 x 12 cm) at a flow rate of 1 ml/min. After washing with 3 column volumes of buffer A, the column was developed in three stages: a linear NaCl gradient 0-200 mM in 50 ml, 58 followed by a step gradient at 200 mM NaCl in 50 ml and lastly a linear gradient 200-600 mM in 200 ml buffer A. Four ml fractions were collected and 5 ul aliquots assayed for MBP phosphotransferase activity. Size exclusion chromatography. Fractions from the polylysine column were concentrated using centriprep 10 concentrators (Amicon). The concentrated samples were precipitated with 50 % ammonium sulphate before storage at -70 °C. The pellets were then resupended in buffer A and filtered through 0.22 u filters. The samples were applied on a Sephacryl 200 FIR column (1.6 x 40 cm ), or Superdex 200 column (1.6 x 70 cm) which was equilibriated in buffer A containing 200 mM NaCl. The MBP kinase co-eluted with the ovalbumin molecular weight marker (Mr 44,000). Heparin-agarose chromatography. Fractions from the gel filtration column containing MBP phosphotransferase activity were pooled, diluted 10-fold and applied onto a heparin-agarose column (1.6 x 1.5 cm) that had been equilibrated with buffer A. The MBP kinase did not bind to heparin-agarose and was collected in the flow through fraction. Mono Q anion-exchange chromatography. The flow through fraction from the heparin-agarose column, together with three column washes were loaded at 1 ml/min onto a Mono Q column (HR 5/5) previously equilibriated with buffer A. The kinase was eluted at the same flow rate, in 20 ml of a linear 0-800 mM NaCl gradient in buffer A. Fractions (0.25 ml) containing MBP phosphotransferase activity were stored in 50 % glycerol at -20 °C. 59 2.2.3 Source Q chromatography of insulin- and osmo-semitive MAP kinases. Ammonium sulphate pellets were resuspended in buffer B (10 mM Mops pH 7.2, 25 mM f3-glycerolphosphate, 2 mM EDTA, 5 mM EGTA and 2 mM sodium orthovanadate) and after removal of insoluble material by centrifugation (15,600 g, 5 min), were diluted-10 fold and immediately applied to a Source Q column (1 ml bed volume) equilibriated in buffer B. The column was washed with 2 ml of buffer B. Proteins were eluted with a 20-ml linear gradient of 0-800 mM NaCl in buffer B at a flow rate of 1 ml/min. Fractions (0.5 ml) were collected and aliquots of fractions 9-30 were assayed for MBP kinase activity. Separate aliquots (100 ul) of fractions were subjected to SDS-PAGE and Western blotting analysis using various anti-kinase antibodies. 2.2.4 Protein kinase assays. S6 kinase assays. Unless otherwise stated, S6 kinase assays contained in a final volume of 25 ul: 12 uM S6 peptide (32-mer), 200 uM [y-32P]ATP (1000 dpm/pmole), 7.5 mM magnesium acetate, 20 mM Mops pH 7.2 and 5 pi enzyme sample. All reaction incubations were performed at 4 °C. The kinase reactions were initiated by addition of [y-32P]ATP and were of 10 min duration. The reactions were terminated by spotting 20 ul of the reaction mixtures onto P81 phosphocellulose filter squares, which were immediately immersed in 0.85% phosphoric acid. The filters were washed 5 times (5 min/wash) in 0.85% phosphoric acid before being transferred to scintillation vials containing 10 ml water and counted in a scintillation counter. MBP kinase assays. MBP kinase assays were basically the same as those for the S6 kinase except that the reaction mixtures contained MBP (1 mg/ml) 1 uM cAMP-dependent protein kinase inhibitor peptide (PKI), 12.5 mM P-glycerolphosphate, 12.5 mM Mops pH 7.2, 7.5 mM magnesium acetate, 5 mM EGTA and 0.1 mM sodium orthovanadate. 60 c-Jun kinase assays. Kinase assays with GST-c-Jun contained in a final volume of 80 ul: 1 ug GST-c-Jun (immobilized on GSH-agarose), 12.5 magnesium acetate, 2.5 mM manganese chloride, 20 mM Mops pH 7.2 and 125 uM [y-32P]ATP. Assays proceeded for 30 min at 30 °C and were terminated by the addition of 1 ml of buffer C (12.5 mM Mops pH 7.2, 12.5 mM P-glycerolphosphate, 5 mM EGTA, 7.5 mM magnesium acetate, 0.5 mM NaF) containing 0.5% Triton X-100. After centrifugation (15,600 x g, 5 min), the supernatant was aspirated off. The pellet containing the GST-c-Jun beads was washed with 1 ml of buffer C containing 0.8 M sodium chloride. After centrifugation and removal of the supernatant as above, 40 ul of SDS-sample buffer were added. Proteins were resolved by SDS-PAGE and 32P-incorporation into c-Jun was analysed using autoradiography and a phosphoimager. At other times, 500 ul of HSS extracts were incubated with 2 ug GST-c-Jun immobilized on GSH-agarose, at 4 °C for 4 h. The beads were washed 4 times with 20 mM pH 7.4, 50 mM NaCl, 0.1 mM EDTA and 0.05% Triton X-100. [y-32P]ATP was then added to phosphorylate c-Jun with the bound kinases. The reactions were terminated after 30 min at 30 °C and the products resolved by SDS-PAGE followed by Western blotting analysis. 32P-incorporation into c-Jun was analysed by autoradiography and quantitated with a phosphoimager. The affinity bound kinases were detected by probing the blots with antibodies directed against SAPK isoforms (a, P, y). Hsp27 kinase assays. Hsp27 kinase assays contained in a final volume of 25 ul: 2 ug Hsp27, 12.5 mM Mops pH 7.2, 12.5 mM P-glycerolphosphate, 5 mM EGTA, 7.5 mM magnesium acetate, 0.1 mM sodium orthovanadate and 200 uM [y-32P]ATP. Reactions proceeded for 10 min at 30 °C and were terminated by the addition of 25 ul of SDS sample buffer. Proteins were resolved by SDS-PAGE and 32P-incorporation into Hsp27 was analysed by j autoradiography and quantitated by phosphoimaging. 61 2.2.5 Fatty acid biosynthesis. Rates of fatty acid synthesis were assayed according to the method of Stanbie et al. (1976) with the following changes. Isolated fat pads were pre-incubated in Krebs-Henseleit buffer for 20 min followed by a 60 min incubation in iso-, hypo- or hypertonic Krebs-Henseleit buffer containing 70 uCi/ml of tritiated-water. The lipid residues were dissolved in 7 ml ACS scintillation fluid (Amersham) and radioactivity assayed with a Beckman LS 6000IC scintillation counter. 2.2.6 Glycogen synthase activity, The activity of glycogen synthase was determined according to Thomas et al. (1968). Fat pads were treated for various times in the absence or presence of insulin or vanadyl sulfate. Cytosolic fractions were prepared as in section 2.2.1. Twenty five ul of the cytosolic fractions were added to 50 ul of pre-warmed (30 °C, 8 min) assay buffer (75 mM NaF, 75 mM Mops pH 7.4, 10 mg/ml glycogen, plus or minus 15 mM glucose 6-phosphate, 2 mM UDP-[14C]glucose (500 dpm/nmple). The assay was 30 min in duration and was terminated by spotting 50 ul of the reaction mixture onto Whatman 3MM paper squares, which were immediately immersed in 500 ml of 66 % ethanol. The filter papers were washed two more times in 500 ml of 66 % ethanol (30 min/wash with shaking), to remove unincorporated substrate from precipitated glycogen. Following air-drying, the filters were subjected to liquid scintillation counting. 2.2.7 Lipolysis, Fat cells were incubated in the absence or presence of insulin or vanadyl sulphate for 30 min at 37 °C. This was followed by a further 30 min incubation in the presence or absence of isoproterenol. Incubations were terminated by removal of 1 ml of the medium (excluding cells), and heating to 95 °C for 5 min. The samples were then cooled on ice for 62 10 min and centrifuged (Eppendorf, 15,600 x g, 5 min). The clear supernatant (800 ul) was mixed with 100 ul 7 % ZnS04 and placed on ice for 10 min. Samples were then heated (5 min, 95 °C), mixed with 200 ul of 0.1 N NaOH, and cooled on ice for 5-10 min. Finally, the samples were centrifuged (Eppendorf, #5,600 x g, 10 min) and the clear supernatant used for glycerol assays. Glycerol assay. Glycerol was determined using the original enzymatic assay of Garlan and Randle (1962). Assays were performed in quartz cuvettes with a 1 cm light path. The clear supernatant (400 ul) was mixed with 300 ul solution 1 (7 mM MgS04.7H20, 0.9 mM NADH, 3.3 mM ATP, 4.9 mM phosphoenolpyruvate in 136 mM glycylglycine buffer pH 7.4), 290 ul distilled water and 5 ul solution 2(1 mg/ml lactate dehydrogenase, 2.9 mg/ ml pyruvate kinase in 3.2 M (NH4)2S04). Samples were vortexed, incubated for 5 min at room temperature (RT) and the absorbance at 340 nm measured. Following addition of solution 3 (5 ul of 1 mg/ml glycerol kinase in 3.2 M (NH4)2S04), samples were vortexed, incubated (RT, 20-30 min) and the absorbance at 340 nm measured. The absorbance differences were used to calculate the amount of NADH oxidized which, in turn is stoichiometric with the amount of glycerol. 2.2.8 Acetyl-CoA carboxylase activity. Samples containing ACC were preincubated for 20 min at 37 °C with 10 mM or 1 mM sodium citrate. Assays were initiated with the addition of 50 ul pre-incubated enzyme I to 450 ul assay medium, pH 7.2 (50 mM Hepes, 10 mM MgS04, 0.5 mM EDTA, 5 mM ATP, 2.5 mM glutathione 1 % (w/v) defatted BSA, 0.2 mM acetyl-CoA, 15 mM [14C]-KHC03). The specific activity of bicarbonate was 500-1000 dpm/nmole, and was determined (in duplicate) prior to assays by counting 10 ul samples of assay buffer in the presence of the C02-trapping compound 2-phenylethylamine. Reactions were stopped after 2 min at 37 °C with 200 ul of 5 N HC1. Samples were vortexed and centrifuged 63 (15,600 x g, Eppendorf, 5 min, 4 °C) and 500 pi of the acid supernatant evaporated to dryness in order to remove the last traces of unreached [14C]-KHC03. The remaining [14C]-malonyl-CoA was measured by liquid scintillation counting (ACS cocktail, Amersham, Oakville, Ont.). One unit of ACC activity is defined as the amount of enzyme which catalyzes the formation of 1 urnol of malonyl-CoA in one minute. 2.2.9 Immunoprecipitations. Protein kinase B. Protein kinase B (PKB) was immunoprecipitated using an antibody directed towards a peptide within the PH domain of PKBa. Cytosolic or particulate samples (1 mg) were diluted with an equal volume of immunoprecipitation buffer (50 mM Tris-HCl pH 7.4, 50 mM NaF, 5 mM EDTA, 100 mM NaCl) containing Nonidet P40 (NP 40, 3 % w/v). Anti-PKB antibody (10 and Protein A (40 pi of a 50 % w/v solution) were added and the mixture incubated at 4 °C for 3 h. The immunoprecipitates were recovered by centrifugation (Eppendorf, 15,600 x g, 2 min), and washed once with the immunoprecipitation buffer containing nonidet NP 40 (NP 40, 3 %, w/v) and once with kinase assay buffer (12.5 mM P-glycerol phosphate. 12.5 mM Mops pH 7.2, 5 mM EGTA, 20 mM MgCl2, 50 mM NaF, 0.25 mM DTT). After the final wash, the kinase assay buffer (30 pi) and MBP (5 pg) were added to the immunoprecipitates. Kinase assays were initiated by the addition of [y-32P]ATP and proceeded for 20 min. SDS-sample buffer (30 pi) was added to terminate the assays and the proteins were separated by SDS-PAGE. Phospho-proteins were visualised by autoradiography and quantitated by liquid scintillation of excised bands. MBP kinase. The fat cell MBP kinase was immunoprecipitated using an anti-actin antibody (N 350, Amersham). Fractions from the Superdex 200 gel filtration column were concentrated and the buffer changed to 15 mM Mops pH 7.2, 10 mM NaCl 1 % (w/v) 64 NP40. Protein G-agarose conjugate (40 ul of a 50 % w/v solution) and the anti-actin antibody (5 ul) were added to the gel filtration column fraction samples (500 ul). The mixtures were incubated at 4 °C for 4 h. Immunoprecipitates were recovered by centrifugation (Eppendorf, 15,600 x g, 2 min) and washed three times with RIPA buffer (PBS, 1 % (w/v) NP 40, 0.5 % sodium deoxycholate, 0.1% SDS) and twice with kinase assay buffer (12.5 mM p-glycerol phosphate, 12.5 mM Mops pH 7.2, 5 mM EGTA, 20 mM MgCl2, 0.25 mM DTT). MBP (5 ug), and kinase assay buffer (20 ul) were added and phosphorylations initiated by the addition of [y-32P]ATP. After 20 min, SDS-sample buffer was added to terminate the reactions and the proteins were separated by SDS-PAGE. Proteins were transfered to Immobilon membrane which was probed with the R2 antibody. Phosphorylated MBP was visualized by autoradiography or phosphoimaging. Actin. Actin was immunoprecipitated using ERK 1 (C-16, Santa Cruz Biotech. Inc.), an antibody raised against a peptide that corresponded to amino acids 352-367 of rat ERK 1 protein. NP 40 (1 % w/v), C-16 antibody (5 ul) and protein A-agarose conjugate (40 ul of a 50 % w/v solution) were added to Superdex 200 column fractions (900 ul). The mixture was incubated at 4 °C for 4 h. Immunoprecipitates recovery, washing and the MBP phosphotransferase assay were performed as described under MBP kinase above. Western blotting analysis was done using the anti-actin antibody. 38 Hog MAP kinase. The tyrosine phosphorylation of p38 Hog MAP kinase was examined by immunoprecipitation with anti-p38 antibody, followed by Western blotting with antiphosphotyrosine (4G10, Upstate Biotech. Inc., NY). SDS (1 % w/v) was added to sample aliquots (500 ul) and diluted with an equal volume of immunoprecipitation buffer (50 mM Tris-HCl pH 7.4, 50 mM NaF, 5 mM EDTA, 100 mM NaCl) containing NP 40 (6 % w/v). Protein A-agarose (20 ul of a 50% w/v solution) was added and the mixture incubated at 4 °C for 20 min. After centrifugation (15,600 x g, 1 min), the pellet which 65 i contained protein-A bound proteins was discarded. Anti-p38 antibody (5 pi) was added and the samples incubated overnight at 4 °C. The following day, 40 pi of protein A-agarose were added and the samples incubated for a further 2 h at 4 °C. The immunoprecipitates were recovered by centrifugation (15,600 x g 1 min) and washed twice with the immunoprecipitation buffer containing NP 40 (6 %) and twice with the immunoprecipitation buffer without detergent. After the final wash, SDS-sample buffer (40 pi) was added to the immunoprecipitates and the proteins were separated by SDS-PAGE followed by Western blotting analysis. 2.2.10 SDS-PAGE and autoradiography. SDS-PAGE was carried out in 1.5 mm thick gels with the discontinuous buffer system of Laemmli (1970). Gels (3% stacking and 10 % separating) were electrophoresed at constant amperage (20 mA/gel). Following staining by Coomasie blue or silver stain (Rabilloud et al., 1988) gels were dried. Mini gels were electrophoresed at 200V for 40 i min using the Bio-Rad mini gel apparatus. Autoradiography was performed using Kodak X-OMAT XAR-5 initially, and later Reflectance (NEN) films. The film was preflashed and exposed at -70 °C to polyacrylamide gels in cassettes with intensifying screens (Dupont Cronex Ffl-Plus). After exposure, the film was developed in an automatic developer (Kodak M35 A X-OMAT processor). In some cases, gels were analyzed using a phosphoimager (Moleculer Dynamics). i 2.2.11 Western blotting. After SDS-PAGE, gels were incubated (15-30 min), in transfer buffer, pH 9.2 (48 mM Tris and 39 mM glycine). Electroblotting onto PVDF membrane with a Trans-Blot SD (Bio-Rad) occurred at 15 V for 30 min for mini and 20 V for 1 h for large gels. 66 Current limits of 3 mA/cm2 and 5.5 mA/cm2 for large and mini gels, respectively, were used to prevent excessive heat production during the electrophoresis periods. The following incubations were performed on a rotary shaker at room temperature. Blots were briefly washed in Tris-buffered saline-Tween (TBS-T) pH 7.6 (20 mM Tris-HCl, 137 mM NaCl) and blocked for 2 h in 5% milk or 3% BSA in TBS-T. After washing briefly in TBS-T, the blots were incubated for 2 hours in primary antibodies. This was followed by another washing procedure: once for 15 min and twice (5 min per wash) in TBS-T. The blots were incubated with horseradish peroxidase (HRP) or alkaline phosphatase (AP) labelled-secondary antibodies for 1 h. This was followed by another washing procedure as described above. Blots using HRP-labelled secondary antibodies were developed using the ECL reagents (Amersham), and those using AP-labelled secondary antibodies were developed using the CDP-Star substrate (New England Biolabs). In some cases, blots were stripped and reprobed with different antibodies. The blots were incubated in 100 mM 2-mercaptoethanol, 2% SDS, 62.5 mM Tris-HCl pH 6.7 at 50 °C for 30 min. After washing twice (10 min per wash) in TBS-T, the blots were blocked and reprobed as described above. 2.2.12 Protein determination and statistical analyses. Protein determination was performed using the Bradford dye-binding assay, using bovine y-globulin as the standard (Bradford, 1976). Where indicated results were expressed as mean ± SEM and the difference between treatments, assessed by the paired Student's t-test was considered significant if P<0.5. 67 2.2.13 Immunofluorescence. NTH 3T3 cells were grown on coverslips in Dulbecco's modified Eagle medium (DME) supplemented with 10 % calf serum at 37 °C in a 5 % C02/95 % air atmosphere. Cells were then incubated in DME supplemented \vjth 0.5 % serum for 4 h, followed by a further 10 min incubation in the absence or presence of 87 nM insulin. Prior to fixing with paraformaldehyde (2.5 % w/v, 15 min at 37 °C) cells were washed twice with PBS (136 mM NaCl, 3.6 mM KC1, 8.1 mM Na2HP04, 1.4 mM KH 2P0 4, pH 7.4). This was followed by three washes (40 min/ wash) in PBS supplemented with 0.9 mM CaC12 and 0.5 mM MgCl2.6H20 (PBS++). Cells were permeabilized (0.2 % saponin, 10 % goat serum in PBS) for 5 min at RT and incubated with either the R2 antibody (1/100, 30 min) or with Texas red labelled-phalloidin (1/500, 30 min). After washing with PBS+ +, the cells were re-permeabilized as above and immediately incubated with the secondary antibody (FITC-labelled anti-rabbit, 20 min). Finally, the cells were washed in PBS + + and the coverslips were mounted onto glass slides. Cells were observed by means of a standard fluorescence microscope. 68 C H A P T E R T H R E E S T A B I L I Z A T I O N , P U R I F I C A T I O N A N D C H A R A C T E R I Z A T I O N O F A N I N S U L I N - S T I M U L A T E D M B P K I N A S E F R O M R A T A D D ? O S E T I S S U E . 3.0 R A T I O N A L E . The general hypothesis addressed here is that the actions of insulin on cell metabolism are mediated by mechanisms involving reversible phosphorylation of proteins. Insulin mediated increases in fatty acid biosynthesis occur through the stimulation of glucose transport and of several intracellular enzymes including acetyl-CoA carboxylase (ACC), but understanding of the mechanisms of the action of insulin is still very fragmentary. The activation of ACC by insulin is associated with increases in serine phosphorylation in a tryptic peptide designated as the I-peptide (Brownsey and Denton, 1982; 1987). Several insulin-sensitive Ser/Thr kinases have been described, but none appear to phosphorylate ACC at the I-site, except a fat pad protein kinase which has yet to be identified (Borthwick et al, 1990). The goal of this study was to purify, characterize and identify the ACC I-site kinase and to establish its relationship to other insulin sensitive kinases. The focus of this work was on MBP/MAP kinases, because previous studies in this laboratory had indicated the coelution of ACC kinases and MBP kinases on Mono Q anion exchange chromatography (Zhande, 1992). Moreover, a MAP kinase from sea-star oocytes had been shown to phosphorylate ACC, apparently on the insulin-directed site (Pelech et al, 1991). A further general goal of the studies was to define the fundamental biochemical properties of the MBP kinases purified from a physiologically important tissue. Studies of the native protein should complement those done with recombinant expressed proteins. Studies of kinases are often technically simplified by use of model substrates that are convenient, if the physiological enzymes must be isolated by laborious and lengthy procedures. In addition, the cellular substrate enzymes often (like ACC, of interest in this 69 study) contain multiple phosphorylation sites which would require additional 2-dimensional phosphopeptide analyses in order to determine the individual phosphorylated sites. From my initial studies, I concluded that the use of ACC itself as a primary substrate would be extremely time-consuming and really not feasible as a routine assay for following kinase activity during purification procedures. MBP had been shown to be an excellent substrate for MAP kinases in a number of studies. In addition, it is commercially available and binds strongly to P-81 phosphocellulose paper which makes it ideally suitable for filter assays. As a result, MBP was used as the substrate for many of the routine kinase assays in this set of studies. 3 . 1 R E S U L T S A N D D I S C U S S I O N . 3.1.1 STABILIZATION OF THE ACTIVITY OF R A T F A T C E L L MBP KINASE. Among the physiological targets of insulin action, the major tissues most commonly used to study insulin effects are muscle, liver, adipose and lactating mammary glands. Of these possible experimental systems, adipose tissue can be most easily manipulated in vitro, and shows striking changes in metabolism following in vitro incubations with insulin. The major points addressed in this study were preserving the insulin-activated MBP kinase(s) from adipose tissue, and then subsequent purification and characterization. Initial studies of the insulin-stimulated MBP kinases were carried out using freshly-prepared high speed supernatant fractions. Further progress in the purification and characterization of these kinase(s) of interest was hampered by the rapid loss in enzyme activity upon storage. The insulin-stimulated MBP kinase(s) proved to be labile under many commonly used storage conditions such as at low temperature (4°C, -20°C or -70°C) and despite the use of stabilizing agents such as glycerol, protease and phosphatase inhibitors. The immediate concern was therefore, to try to stabilize these insulin-stimulated MBP kinase(s). After a number of trials in which different initial purification steps were 70 attempted (ion-exchange, phenyl-Sepharose, hydroxyapatite and poly-lysine), protein kinase stabilization was ultimately achieved by employing a procedure that included rapid centrifugation and ammonium sulphate precipitation in the presence of a mixture of phosphatase and protease inhibitors. Following tissue isolation, hormone treatment, and homogenization, the freshly prepared high-speed cytosolic fractions were precipitated with ammonium sulphate (50% saturation) and the pellets stored at -70°C until further use. Several advantages were achieved by using ammonium sulphate. Firstly and by far the greatest advantage was stabilization of the labile fat cell MBP kinases. These kinases could now be stored as ammonium sulphate pellets for up to 3 months with minimal decay of the MBP phosphotransferase activity. The high ammonium sulphate salt concentration employed inhibits the action of many enzymes and the precipitated proteins could be stored in a stable form with minimal protease or phosphatase action. Secondly, precipitation with ammonium sulphate enabled large sample volumes to be treated and stored until use without a significant loss in activity. This also meant that control and insulin-treated samples could be easily processed in parallel. Finally, the resulting pellets could be dissolved in a small amount of buffer, thus increasing the protein concentration of the sample and probably aiding in stabilization. In addition to these benefits of rapid precipitation with ammonium sulphate, the stability of the insulin-activated protein kinases was aided by the presence of phosphatase inhibitors in the extraction buffer. Initially, these phosphatase inhibitors included 0-glycerol phosphate, p-nitrophenyl phosphate, orthovanadate and P-methylaspartic acid. Then fortuitously, two extremely potent inhibitors of protein phosphatase (PP) 1 and 2A (major fat cell phosphatases) were discovered. These were okadaic acid and microcystin-LR (Cohen et al, 1990; Honkanen et al, 1990). The effects of microcystin-LR were investigated in experiments whereby the MBP phosphotransferase activity of freshly i prepared fat cell cytosolic fractions was monitored. Results showed a microcystin-LR dependent increase in recovery/stabilization of MBP phosphotransferase activity (Zhande, 71 1992). The presence of 100 nM microcystin- LR in the phosphorylation reaction mixture led to approximately 3-fold increase in MBP phosphorylation. This observation indicates that PP1 and/or PP2A may be among the major inactivators of MBP kinases in fat cells, a finding which is supported by a number of independent studies that have shown dephosphorylation and subsequent inactivation of MAP kinases by purified PP2A (Haystead et al, 1990a; Anderson et al, 1990). Further support has been obtained from the observation that treatment of a variety of cell types (Gotoh et al, 1990; Miyasaka et al, 1990; Haystead et al, 1990) with okadaic acid results in the activation of MBP kinases. Together, these results infer a direct role for PP2A (and maybe PP1) and emphasize the importance of reversible protein phosphorylation in the regulation of the insulin-stimulated MBP kinases. In view of this finding, microcystin-LR was routinely included in the extraction buffer. 3.1.2 PURIFICA TION OF RAT FAT CELL MBP KINASE. Having overcome the problem of instability of the MBP kinase(s), the next priority was purification and characterization of the insulin-stimulated enzyme(s). A number of column chromatography procedures were tested. These included anion exchange (DEAE-cellulose and Mono Q), hydrophobic interaction (phenyl-Sepharose), size exclusion (Superose 6, Sephacryl S-200, Sephadex G-100) and affinity chromatography (tyrosine-agarose, polylysine-agarose, heparin-agarose, hydroxyapatite phosphocellulose). Although a number of these columns were unsuitable to be used in the final purification scheme, important insights about the nature of these kinases were gained. Eventually, purification was achieved using sequential chromatography on polylysine-agarose, size exclusion (Sephacryl 200 HR or Superdex 200), heparin-agarose and Mono Q columns. Two peaks of MBP phosphotransferase activity were resolved using the polylysine-agarose column. Peak I (fractions 15-25) was larger and eluted at 0.2 M NaCl, while Peak II (26-32) was 72 smaller and eluted between 0.225 and 0.244 M NaCl (Fig. 4A). Further analysis of the polylysine-agarose column fractions was performed using Western blotting with an anti-MAP kinase antibody. This antibody referred to as R2, is directed towards a peptide with the sequence based on residues 333-367 of the C-terminus of rat 43-kDa ERK1 MAP kinase (PFTFDMELDDLPKERLKELIFQETARFQPGAPEAP). R2 recognizes both the 44- and 42-kDa MAP kinase isoforms. The results (Fig. 4B) showed the presence of 42-and 44-kDa bands in the peak fractions from the polylysine column. The 44-kDa band eluted earlier in fractions 14-29, while the 42-kDa band overlapped somewhat in fractions 25-35. Based on the Western blotting analysis, the 44-kDa MAP kinase isoform coeluted with the major peak of MBP phosphotransferase activity. A complete separation of the two MAP kinase isoforms on the polylysine-agarose column was generally not achieved. Indeed in some cases, only one peak of MBP kinase activity was obtained, therefore all fractions containing active enzyme (15-30) were pooled, concentrated and applied to a gel filtration column (initially Sephacryl 200 HR and later Superdex 200). The size exclusion column served as a rapid step to remove the majority of high molecular weight proteins as shown by the elution profile from the Superdex 200 column (Fig. 5). Two peaks of MBP phosphotransferase activities were resolved. Peak I was broad, eluted in fractions 28-38 and contained low levels of MBP phosphotransferase activity, whereas Peak II (fractions 44-50) was large and sharp. The elution position of Peak II coincided with that of the ovalbumin molecular weight marker (44-kDa), indicating a monomelic size for the MBP kinase. Further analysis by Western blotting showed the presence of both the 44- and 42-kDa bands in Peak II. Surprisingly, R2-reactive protein (predominantly the 44-kDa band) was also recognized in fractions from Peak I which eluted before the catalase standard (MW 232 kD). Peak I may therefore, represent protein complexes containing at least the R2-reactive 44 kD protein. The ratio of amount of R2-reactive protein (44-kDa) in Peak I over Peak II ranged from 73 0.6-0.8. The distribution of the 44-kDa band between the two peaks was apparently unaffected by insulin treatment. Fractions 44-48 from the Superdex 200 column were pooled, diluted and passed over a heparin-agarose column. The MBP kinase did not bind and was recovered in the flow through fractions. The heparin affinity column was nevertheless extremely useful in removing contaminating proteins which include the catalytic subunit of PKA and some S6 kinase isoforms which do bind effectively to heparin-agarose. Following heparin-agarose chromatography, the MBP kinase fraction was subjected to ion exchange chromatography. The elution profile of the fat cell MBP kinases on the Mono Q column is shown in Fig. 6A. The MBP kinase assay produced a single peak of activity. Fraction 28 contained the highest MBP phosphotransferase activity which exhibited a 4-fold activation in fractions obtained from tissue which had been treated with insulin (compared to control tissue). The silver stained gel of this final purified fraction (Fig. 6B) contained a major 44-kDa band which copurified with the peak of MBP phosphotransferase activity. The highly purified MBP kinase subunit (44-kDa) was also recognized by Western blotting analysis using the R2 antibody (see later, Fig. 9B). Assignment of this band as a kinase was supported by its comigration with Ser/Thr phosphotransferase activity and immunoreactivity with antibodies which recognize ERK1 and ERK2. 74 F I G U R E 4. P O L Y L Y S I N E - A G A R O S E C H R O M A T O G R A P H Y O F R A T F A T C E L L M B P KINASES. Fat pads were incubated at 37°C for 10 min in the absence (open circles) or presence (closed) of insulin (87 nM) in Krebs-Henseleit buffer. Homogenates were prepared and centrifuged (215 000 x g a v for 1 h). Cytosolic fractions were precipitated with ammonium sulphate. The pellets were resuspended, desalted and applied onto a 30-ml polylysine-agarose column. The column was developed with a step NaCl gradient as shown by the dotted line (A). B Western blot using R2 antibody. 0 10 20 30 40 50 60 Frac t ion n u m b e r B Fraction # 1 3 5 7 9 11 13 15 17 19 21 23 25 27 29 31 33 35 37 75 FIGURE 5. SIZE EXCLUSION CHROMATOGRAPHY OF FAT CELL MBP KINASES. Pooled polylysine-agarose column chromatography fractions (15-30) of extracts from untreated (open circles) and insulin-treated (87 nM, filled circles) rat fat tissue were concentrated using a Centriprep 10 and precipitated with an equal volume of saturated ammonium sulphate solution. The pellet was dissolved (500 pi) and applied onto a Superdex 200 gel filtration column. A: Elution profile showing MBP phosphotransferase activity. Numerical numbers indicate the elution positions (in kDa) of protein markers. The elution position of blue dextran is indicated by the letter, V . Peaks 1 and 2 consist of fractions 28-38 and 44-50, respectively. B: Western blotting analysis with the R2 antibody. Frac t ion number B Fraction # 16 18 20 22 24 26 28 30 32 34 36 38 40 42 44 46 48 50 76 FIGURE 6. MONO Q ANION EXCHANGE CHROMATOGRAPHY OF FAT C E L L MBP KINASES. Fractions (44-48) from the Superdex 200 column (described in Fig. 5) containing MBP phosphotransferase activity were diluted 10-fold and loaded onto a 3 ml-heparin-agarose column. The flow-through including 2 column washes were collected and chromatographed on a Mono Q column. Column fractions were assayed for phosphotransferase activity using MBP as a substrate. A shows the activity profile from fractions following purification from control adipose tissue (open circles) or insulin-treated adipose tissue (filled circles). B shows a silver stained gel of the insulin-treated samples (40 pl/lane). A 2 5 0 0 0.6 20 30 Frac t ion n u m b e r o o 77 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 78 T A B L E 7. PURIFICATION O F M B P KINASE. MBP phosphotransferase activity was determined at each stage of purification: in 200,000 x g supernatant fraction (cytosol), following precipitation with ammonium sulphate (ASP), in the first dominant peak from polylysine (PL), following S-200 gel filtration (GF) and finally following ion exchange chromatography employing Mono Q (MQ). Results are from a single experiment which is representative of at least 6 independent ones. Sample Volume Total Total Specific Percent Purification (ml) Protein Activity Activity Recovery (fold) (ma) (nmol/min) (nmol/min/ma) i —* Cytosol 62 118 36 0.3 100 1 ASP 10 24 20.8 0.9 58 3 PL 1 8 10 1.2 28 4 GF 4 0.2 4.5 22.7 13 74 MQ 0.8 0.005 2.6 530 7 1737 Using the sequence of column procedures described above, the MBP kinase was purified at least 1700-fold with respect to the initial high-speed supernatant, with a recovery of about 7 % (Table 7). Purified preparations following the final Mono Q step typically contained 5-10 ug of protein representing the recovery from 10-15 g white adipose tissue from both epididymal and perirenal fat pads of 10 rats in the 180-200 g weight range. The specific activity of the purified kinase was approximately 0.5-1 umol/min/mg with MBP. This specific activity is within the range reported for M A P kinases in other studies: 3 umol/min/mg for ERK1 (Boulton et al., 1991); 0.9 umol/min/mg for the sea star MAP kinase (Sanghera et al., 1990). The specific activity for the MBP kinase in this study is probably subject to error for at least two reasons. Firstly, 7 9 the purified sample contained very little protein. Consequently, accurate determination by standard protein assays was difficult. Secondly, further studies revealed that the kinase was contaminated with actin (see later) which comigrated exactly on SDS-PAGE. This means that the true amount of MAP kinase protein may be overestimated and the specific activity of the kinase may be higher than our estimates indicate. Because the sequences of several highly-related MBP kinases (also known as MAP kinases or ERKs) had been described (Boulton et al, 1991; Her et al, 1991), it was important to attempt to sequence the MBP kinase in order to clearly identify the activity I had purified from this major insulin target tissue. An attempt at sequencing the purified kinase revealed a major contaminating protein, actin. The removal of actin was therefore necessary in order to sequence the kinase. This however, proved to be surprisingly difficult (see below), and the identification of the insulin-stimulated adipose tissue MBP kinase therefore relied on immunological techniques and further biochemical characterization. 3.I.3 IMMUNOLOGICAL IDENTIFICA TION OF THE MBP KINASE AS A MAP KINASE. Western blotting analysis was used to identify the purified fat cell MBP kinase. Identification was necessary because various MAP kinase isoforms had been discovered. Most of these isoforms had been identified in cultured cells such as 3T3-L1 adipocytes (Ray and Sturgill, 1987) and rat 1 fibroblasts overexpressing the human insulin receptor (Boulton et al, 1991). Since cultured cells may not display the phenotypes of fully differentiated tissue, it was therefore important to characterize the MBP kinase from a physiological insulin target tissue. As mentioned earlier the antibody used (R2) recognized both the 44-kDa and 42-kDa MAP kinase isoforms. In this study, the R2 antibody recognized both MAP kinase isoforms in crude fat cell extracts (Fig. 7) and after partial purification (Fig. 4). The antibody also demonstrated prominent positive immunoreactivity 80 in the final purified Mono Q fraction but in contrast to the crude extract, the purified fraction contained mainly the 44-kDa MAP kinase isoform. Thus, the co-elution of 44-kDa MAP kinase (as judged by Western blotting) with the peak of MBP kinase activity indicates that the insulin-stimulated MBP kinase purified from rat white adipose tissue was an ERK/MAP kinase. Based on the subunit size of 44-kDa, determined with SDS-PAGE gels, the purified fat cell MAP kinase was most likely to be ERK1. A definitive identification can strictly only be inferred after sequence analysis and this proved surprisingly difficult as described later. 81 F I G U R E 7. I M M U N O L O G I C A L IDENTIFICATION O F M B P KINASE. Samples from the ammonium sulphate pellet (lane 1) and Mono Q column (lane 2) were subjected to Western blotting analysis using the R2 antibody. The antibody recognized a doublet in the ammonium sulphate pellet sample. The upper band of this doublet was the only band recognized in the Mono Q sample. The antibody also recognized sea star MAP kinase (lane 3) as well as recombinant human ERK which migrates as a major 70-kDa band (lane 4). The positions of the molecular weight markers are indicated on the left. 1 2 3 4 200 87 69 46 -> 30 — > 82 3.1.4 PHOSPHOR YIA TION OF ACC BY THE PURIFIED FA T CELL MBP KINASE. As mentioned earlier, ACC contains multiple sites which are phosphorylated by a number of different kinases including the AMP- and cAMP-dependent kinases. Determination of the exact sites phosphorylated, requires two-dimensional phosphopeptide analyses. A second tier of complications associated with the phosphorylation of ACC is the presence of endogenous kinase activity, which is known to incorporate as much as 0.3 mol [P] per ACC subunit (Winz, 1993). In this study, the phosphorylation of ACC by exogenous kinases was estimated as the phosphate-incorporation that occurred above that of the auto-phosphorylated enzyme. Incubation of ACC with [y-32P]ATP led to incorporation of 0.02 mol [P]/mol ACC subunit. The extent of phosphorylation did not change significantly following addition of the purified MBP kinase. This low extent of phosphorylation remained unchanged by 30 min (Fig. 8). In contrast, the purified MBP kinase phosphorylated MBP reaching a stoichiometry of 0.25 mol [P]/mol MBP within 10 min. These results indicate that the fat cell MBP kinase does not phosphorylate ACC. Significantly, our initial hypothesis that MBP/MAP kinase might be a significant fat pad ACC-kinase had to be rejected because acetyl-CoA carboxylase was poorly phosphorylated and the I-site was not detectably phosphorylated. I conclude that though clearly insulin-sensitive, the purified fat cell MBP kinase was not directly responsible for the increases in ACC phosphorylation at the insulin-directed site. The possibility that the MBP kinase/ERK (and other MAP kinases) might play some other functions in metabolic signaling have been further evaluated (see Chapter 5). At this point, the focus of the study shifted to further characterization of the purified fat cell MBP kinase. 83 FIGURE 8. PHOSPHORYLATION OF ACC WITH PURIFIED MBP KINASE. ACC (10 ug) purified from rat liver was incubated with [y-32P]ATP in the presence of purified fat cell MBP kinase for the indicated times at 30 °C. Following SDS-PAGE, the incorporation of 3 2 P into ACC was estimated by phosphoimaging. M B P Time (min) 84 3.1.5 CHARACTERIZATION OF THE MBP KINASE. OTHER SUBSTRATES OF THE MBP KINASE. The preferred metal ion, nucleotide triphosphate and protein/peptide substrates of the purified adipose tissue MBP kinase were examined. ATP was preferred over GTP as the nucleotide substrate for the purified fat cell MBP kinase. The rate of phosphate transfer from [y-32P]ATP to MBP catalyzed by the purified MBP kinase was unaffacted by a 4-fold excess of GTP (Table 8). The purified fat cell MBP kinase exhibited low activity in the presence of Mn 2 + , the activity with 1 mM Mn 2 + being only 16% of that seen with 7.5 mM Mg 2 + (Table 8). Surprisingly, this contrasts sharply with purified ERK1, which had an activity at 1 mM Mn 2 + that was 70 % of that at 10 mM Mg 2 + (Boulton etal, 1991). Higher concentrations of Mn 2 + (up to 10 mM) actually led to a further decline and even complete inhibition of MBP phosphotransferase activity. 85 TABLE 8. EFFECTS OF GTP AND M n 2 + ON THE ACTIVITY OF MBP KINASE. MBP kinase was purified from insulin treated tissue and assayed for 10 min in the presence of 50 pM [y-32P]ATP and the indicated concentrations of GTP or ATP. Assays were performed as described in the Methods section. Results are expressed as percent incorporation of 3 2 P into MBP assayed at 50 pM [y-32P]. The data was obtained from a single experiment which was performed in duplicate. COMPOUND ACTIVITY % 50 pM [y-32P]ATP 100 +10 pM GTP 99 +100 uM GTP 106 +200 uM GTP 101 +10 uM ATP 103 +100 pM ATP 49 +200 uM ATP 32 7.5 mMMg 2 + 100 1.0mMMn2+ 16 10mMMn 2 + 0 With respect to phospho-acceptor substrates, MAP kinases are,proline-directed protein kinases that select for protein/ and peptide substrates with proline at the +1 position (Songyang et al, 1996). The minimal motif recognized by MAP kinases is therefore, Ser/Thr-Pro. Peptide substrates containing Pro at the -2 position are further strongly preferred. Thus, the optimum consesus sequence recognized by MAP kinases is Pro-X-Ser/Thr-Pro where X is ideally a neutral or basic amino acid (Clark-Lewis et al, 1991; Gonzalez et al, 1991; Songyang et al, 1996). The Km for MBP which was 86 estimated to be 30 uM, is similar to that reported for the sea star MAP kinase (25 uM; Sanghera et al, 1990) and ERK2 (50 uM; Erickson et al, 1990). As noted, the insulin-stimulated adipose tissue protein kinase was purified on the basis of its ability to phosphorylate MBP. Although MBP is an excellent substrate for MAP kinases, it is also phosphorylated by other kinases such as protein kinase C, PKA and Ca2+/calmodulin-dependent protein kinase (Kishimoto etal, 1985; Shoji etal, 1987). However, these kinases are not pro-directed and phosphorylate different sites on MBP. So far, only MAP kinases have been shown to phosphorylate Thr-97 in bovine MBP, so I attempted to confirm the proline specificity of the adipose tissue MBP kinase using a peptide substrate and by analysis of the phosphorylated MBP product. A proline-containing peptide (APRTPGGRR), modelled on residues 95-98 from bovine MBP (Clark-Lewis et al, 1991) was also tested as a substrate for the purified MBP kinase. This was done by parallel assays of column fractions with MBP and the MBP peptide phosphotransferase activities following Mono Q chromatography during the purification of the MBP kinase. These parallel assays established that the MBP and MBP peptide phosphotransferase activities co-eluted at this step; (compare Fig. 6, MBP activity with Fig. 9, MBP peptide activity). In both cases, the maximum activity appeared in fraction 28. There is however, a discrepancy in elution of the MBP peptide activity (Fig. 9A) and the protein (Fig. 9B) especially in fractions 24-27. The most likely explanation is that these fractions (24-27) contain inactive kinase. Thin-layer analysis of phosphoamino acids of MBP also revealed that the purified fat pad kinase phosphorylated predominantly threonine (Fig. 10A). Finally, tryptic phosphopeptides released from MBP following phosphorylation by the proline-directed sea star MAP kinase or by the purified MBP kinase were compared by 2-dimensional TLC mapping and showed a similar pattern (Fig. 10 B and C.) Together, these results indicate that the purified MBP kinase is Pro-directed and can be classified with other MAP kinases. 87 FIGURE 9. EVIDENCE THAT THE PURIFIED MBP KINASE IS PRO-DIRECTED. Fractions from the final Mono Q column were assayed using the peptide APRTPGGRR. Panel A shows the activity profiles obtained from control (open circles) or insulin-treated tissue (filled circles). Fractions were analysed by Western blotting analysis using the R2 antibody (Panel B). Frac t ion n u m b e r 88 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 200 97 69 46 30 14 89 FIGURE 10. PHOSPHOAMINOACID AND PHOSPHOPEPTIDE ANALYSES OF MBP PHOSPHORYLATED WITH PURHTED MBP KINASE. MBP was phosphorylated with the purified kinase, separated by SDS-PAGE and transferred to Immobilon membrane. Protein bands were visualized by staining with Ponceau S, excised and hydrolysed with constant boiling HC1. The hydrolysate was subjected to phosphoamino acid analysis as described in the Methods section. Phosphoamino acid standards were visualized with ninhydrin. Phosphorylated MBP was also subjected to trypsin digestion and analyzed by 2-D TLC employing high voltage electrophoresis in one dimension and ascending chromatography in the other. A: phosphoamino acid analysis. B: tryptic phosphopeptide map of MBP after phosphorylation with either the purified MBP kinase from adipose tissue or with purified sea star MAP kinase (C). A pT -> pY -> Origin —> 90 Table 9 shows the rates of phosphorylation of various substrates by the purified MBP kinase. The S6 peptides (8- and 32-mer), kemptide, and histones were poorly phosphorylated by the purified MBP kinase. In contrast, these peptide substrates are rapidly and extensively phosphorylated by protein kinase A and S6 kinases. Protamine was also a poor substrate for the purified fat pad kinase, and as mentioned earlier, ACC was also a poor substrate. Because of a possible feed-back regulatory role of proline-directed kinases, I also tested the insulin substrate-1 (IRS-1, Upstate Biotech.) as a possible substrate for the purified MBP kinase. Again [32P] incorporation was very slight, indicating that the recombinant protein was not an effective substrate in vitro. 91 TABLE 9. SUBSTRATE SPECIFICITY OF PURIFIED MBP KINASE. Purified MBP kinase from insulin treated tissue was assayed for 10 min at 30 °C, in the presence of 200 uM [y-32P]ATP and 0.4 mg/ml of the protein substrates. Peptide substrates were assayed at 1 mM and the results are expressed as percent 3 2 P incorporation into MBP assayed at 0.4 mg/ml. Results are from a single experiment which was perfomed in duplicate. SUBSTRATE ACTIVITY PERCENT MBP 100 MBP Peptide 300 HISTONE IIS 35 HISTONE H2AS 23 HISTONE H2S 24 HISTONE H3S 21 CASEIN 17 S6 32mer 13 BRADYKININ 21 KEMPTIDE 4 ACC <1 IRS-1 <i 92 EFFECTS OFpH, SALTS, ACTIVATORS AND INHIBITORS. A sample of the purified adipose tissue MBP kinase was assayed for MBP phosphotransferase activity over a range of pH. Optimal activity was found in a broad peak around neutral pH (Fig. 11). This value is lower than pH 8, which was found to be optimal for ERK2 (Ray and Sturgill, 1988). It is not quite clear why there is a difference of a whole pH unit. ERK2 MAP kinase used by Ray and Sturgill was only partially purified and this conceivably affected the actual pH sensitivity. In addition, since the MAP kinase isoforms in comparison here are different (p44 versus p42), the isoforms might display different optima. Furthermore, the exact assay conditions might not have been reproduced, thus leading to different values. The MBP phosphotransferase activity of the purified kinase was completely unaffected by the peptide inhibitor (PKT) of cAMP-dependent protein kinase (PKA). Nevertheless, MBP kinase assays were still performed in the presence of 1 uM PKI to eliminate any possible contributions by PKA. Various compounds known to affect protein kinases were tested for their ability to modulate the purified adipose tissue MBP kinase. KF inhibited the fat cell MBP kinase (Fig. 12). MBP kinase activity was completely inhibited by 80 mM KF and half maximal inhibition was observed with approximately 30 mMKF. This inhibition by KF is similar to that reported for ERK2 MAP kinase (Ray and Sturgill, 1988). Fluoride ions are frequently included in extraction buffers to inhibit Ser/Thr phosphatases. For example the purification of ERK1 from rat cells proceeded in buffers containing 50 mM sodium fluoride (Boulton et ai, 1991). Since fluoride ions inhibit the MBP kinase, caution should therefore be exercised not to include them in the assay reaction mixtures. Another similarity between the MBP kinase (in this study) and ERK2 was observed following incubation with heparin. At low concentrations (5-10 ug/ml) of heparin the activities of both kinases were unaffected. However, at higher concentrations 93 (100 pg/ml), the compound induced modest stimulation (40 % above control). The latter result distinguishes both kinases from the fibroblast ERK1 whose activity was unaffected by the polyanion (Boulton et al., 1991). The effects of heparin on the MBP kinase also distinguishes the fat cell enzyme from casein kinase II (CKII) which is potently inhibited by the polyanion. This finding rules out any possible contamination of the purified MBP kinase by CKII. At lower concentrations, the polycation polylysine, elicited a modest 60 % activation of the MBP kinase. However, at concentrations higher than 50 pg/ml, polylysine became inhibitory. In sharp contrast, polylysine increased MAP-2 phosphotransferase activity of p54 MAP kinase (JNK2/SAPK) by 8-fold (Kyriakis and Avruch, 1990). The stimulation which was dose-dependent, peaked at 50 pg/ml polylysine. Interestingly, the effects of the compound are substrate-specific, as demonstrated by the inhibition of JNK2/SAPK MBP phosphotransferase activity. In view of these different responses among substrates, polylysine and perhaps other basic polypeptides probably act as substrate modulators, without themselves becoming phosphorylated. The behaviour of the MBP kinase in these studies towards polylysine mimics that of JNK2/SAPK kinase with MAP-2 as a substrate, although the fold stimulation was significantly different. Polylysine activated the MBP phosphotransferase activities of the adipose tissue kinase in these studies but inhibited p54 MAP kinase. The purified adipose tissue MBP kinase is therefore, quite distinct from the SAPK. This is especially important because one SAPK isoform (p46) has a molecular size which is very close to that of the MBP kinase. Modest inhibition was observed when the purified MBP kinase was assayed in the presence of P-glycerolphosphate (Fig. 12). Half-maximal inhibition of adipose tissue MBP kinase occured at approximately 80 mM of P-glycerolphosphate, while the half-maximal inhibition of ERK2 MAP kinase by the same compound was observed at a concentration of 45 mM (Ray and Sturgill, 1988). P-glycerolphosphate was previously shown to protect 94 the activation of an S6 kinase in Swiss 3T3 cells (Novak-Hofer and Thomas, 1985). Subsequently, the compound has been used frequently as a general inhibitor of Ser/Thr phosphatases. For example, 80 mM P-glycerolphosphate was used during the extraction of ERK1 from rat 1 FflRc B cells (Boulton etal., 1991). Although useful to preserve kinase activity, P-glycerolphosphate can potentially inhibit the phosphotransferase activity of MAP kinases. The enzyme was strongly inhibited by ZnCl2. Addition of 1 mM ZnCl2 abolished 96 % of the MBP phosphotransferase activity. This sensitivity was also reported for the sea star MAP kinase. ZnCl2 is a general phosphotyrosine phosphatase inhibitor. Because of its potent inhibition of MAP kinases its benefit during the extraction of these kinases should be carefully considered. 95 FIGURE 11. EFFECT OF pH ON THE ACTIVITY OF THE MBP KINASE. Purified MBP kinase was assayed in the presence of MBP as described in the Methods section, except that the pH was varied from 6.5 to 8.0 using 20 mM Pipes, Mops or Hepes buffers. The data is from a single experiment which was performed in duplicate. 96 FIGURE 12. EFFECTS OF KF AND P-GLYCEROLPHOSPHATE ON THE ACTIVITY OF THE MBP KINASE. MBP kinase purified from insulin treated tissue, was assayed as described in the Methods section in the presence of the indicated concentrations of KF and P-glycerolphosphate. The results are expresed as percent 3 2 P incorporation into MBP in the absence of added compounds. The data was derived from a single experiment which was done in duplicate. ' > o o CD CO o CD M— CO c o o _c Q_ CO O J= Q_ CL CQ 120 100 0 50 100 150 Concentration (mM) 200 97 DETECTION OF PHOSPHOTYROSINE AND A UTOPHOSPHORYLATION OF MBP KINASE. The dual phosphorylation of the tripeptide motif (TXY) which leads to their activation is one of the hallmarks of MAP kinases. Because both tyrosine and threonine phosphorylations are required to activate the MAP kinases, phosphotyrosine can be used as a marker for the activated enzyme. Western blotting analysis using the anti-phosphotyrosine antibody, 4G10, was therefore used to determine whether the purified MBP kinase contained phosphotyrosine. Tyrosine phosphorylation of the purified MBP kinase was indeed confirmed (Fig. 13). Furthermore, the phosphotyrosine markedly increased after autophosphorylation of the enzyme. The MBP phosphotransferase activity of the autophosphorylated enzyme was determined in order to test whether any autoactivation had occurred. As shown in Fig. 14, a modest increase in MBP kinase occurred upon autophosphorylation. MAP kinases autophosphorylate on both tyrosine and threonine residues apparently with only slight increase in activity (Seger et al., 1991; Childs and Mak, 1993). The observed autophosphorylation behaviour of the purified MBP kinase is therefore consistent with that of other MAP kinases and indicates that additional activating kinase (MEK) is required for full, physiological activation. Further confirmation of tyrosine phosphorylation of the adipose tissue MAP kinases is provided by studies carried out subsequently (Chapter 5). 98 FIGURE 13. AUTOPHOSPHORYLATION AND DETECTION OF PHOSPHOTYROSINE. A sample (20 pi) of the purified MBP kinase with low specific activity, was incubated at 30 °C for 30 min in the absence (lane 2) or presence of 200 uM ATP (lane 3). The reactions were stopped by the addition of SDS-sample buffer. Following SDS-PAGE, proteins on the gel were transferred to PVDF membrane. Immunoblotting analysis was carried out using the 4G10 antibody. The arrow indicates the position of the MBP kinase. ATP -> 99 FIGURE 14. LACK OF AUTOACTIVATION UPON AUTOPHOSPHORYLATION OF THE MBP KINASE. A sample (5 pi) containing the highly purified MBP kinase was incubated at 30 °C for 30 min in the absence (lane 1) or presence of 200 pM ATP (lane 2). This was followed by a further 30 min incubation in the presence of 1 mg MBP and 200 p M [y-^p]ATP. Assays were terminated by the addition of SDS-sample buffer. Proteins were separated by SDS-PAGE and the gels stained by Coomassie blue. The gels were analysed by autoradiography. The arrow indicates the position of MBP. ATP MBP -> 100 DEACTIVATION BY PHOSPHATASES. As mentioned earlier, the preservation of fat cell MBP kinase activity was aided by the inclusion of phosphatase inhibitors (in particular microcystin-LR) in the extraction buffer. This observation provided initial evidence that the mode of regulation of the enzyme involved reversible protein phosphorylation. Confirmation of this hypothesis was obtained by treating the MBP kinase with purified protein tyrosine phosphatase-IB (PTP-1B). As shown in Fig. 15, incubation of a sample of the purified MBP kinase with PTP-1B induced a time-dependent inactivation of the MBP phosphotransferase activity of the kinase. Incubation of the MBP kinase with the phosphatase abolished approximately 50 % of the activity within 20 min. At the end of the 60 min incubation period, only 17 % of the activity remained. The inclusion of 500 uM sodium orthovanadate completely blocked the effects of the phosphatase. These observations emphasize the importance of i phosphotyrosine in the regulation of the MBP kinase activity. Although PTP-1B clearly deactivates the MBP kinase in vitro, it is not clear whether it plays this role in intact cells. The Ser/Thr phosphatase 2A (PP2A) as well as dual specificity phosphatases selectively inactivate MAP kinases (Nebreda, 1994; Hunter, 1995). Unlike PP2A and PTP-1B which dephosphorylates the phosphothreonine or phosphotyrosine, respectively, these dual specificity phosphatases selectively remove both the phospho-threonine and-tyrosine. Moreover, the genes encoding the latter phosphatases are inducible by growth factors and other stimuli that activate the MAP kinases. This observation may indicate that the dual specificity phosphatases are the relevant physiological inactivators of MAP kinases. 101 FIGURE 15. DEACTIVATION OF MBP KINASE BY TYROSINE PHOSPHATASE-1B. Purified MBP kinase was incubated at 37 °C with PTP-1B in the absence (open circles) or presence (filled circles) of 500 pM sodium orthovanadate, for the indicated times. This was followed by a further 10 min incubation in the presence of MBP and [y-32P]ATP. Reaction mixtures were subjected to SDS-PAGE and autoradiography. Phosphorylated MBP bands were isolated and quantitated by liquid scintillation counting. The results are from a single experiment which was performed in duplicate. 0 I 1 1 I L _ I I I 0 1 0 2 0 3 0 4 0 5 0 6 0 7 0 T i m e ( m i n ) 102 REACTIVATION OF THE MBP KINASE. * The ability of the fat cell MBP kinase to be phosphorylated and activated in vitro by an upstream kinase (MEK) was also evaluated. The MEK family consists of at least 6 known isoforms. These enzymes are dual specificity kinases that phosphorylate MAP kinases on both Thr and Tyr residues. MEKs display an unusual substrate specificity in that they phosphorylate no other substrates beyond the MAP kinases. In addition, each MEK isoform selectively phosphorylates a limited set of MAP kinase members. Finally, MEKs do not recognize denatured protein or peptides derived from MAP kinases. So far, only MEKs 1 and 2 are known to phosphorylate and activate ERKs 1 and 2. The MBP kinase purified from rat adipose tissue, and exhibiting a low specific activity, was incubated with a sample containing a consitutively active mutant of MEK 1 (MEK(AN3), Mansour et al., 1994), and the activity of the MBP kinase monitored through the phosphorylation of MBP. As shown in Fig. 16, the MBP kinase was stimulated approximately 6-fold within 20 min. The absolute activity of the MBP kinase following treatment with MEK(AN3) is still at least 5 times less than that measured from the MBP kinase purified from insulin-treated tissue, so the activation may still be incomplete. Given that the basal activity of MEK(AN3) is 45 times greater than that of the wild type MEK1 (Mansour et al., 1994), the 6-fold activation obtained is quite modest. For example, recombinant ERK1 was stimulated 20-fold following incubation with a partially purified MEK from phorbol ester treated T-cells (Alessandrini et al., 1992). Robbins and coworkers (1993) reported a 500-fold activation of recombinant ERK1 and ERK2 using a highly purified MEK from skeletal muscle. It is not clear why the MBP kinase in this study was activated to such a smaller extent. The activation conditions may not have been optimal for MEK(AN3), but other explanations are also conceivable. For example, it is possible that the deletion of residues 32-51 of MEK to produce MEK(AN3) interfered with binding of the substrate, MAP kinase. MEKs contain a conserved motif (the docking site), at the amino termini which is believed to mediate the 103 high-affinity interaction of MEKs with their cognate MAPKs (Bardwell and Thorner, 1996). Consequently, deletion of residues 2-32 of human MEK1 is accompanied by a 10-fold reduction in basal activity (Mansour, et al., 1994). Finally, it is conceivable that the fat cell MBP kinase is not the cognate MAP kinase for MEK1. Further studies are required to establish the regulation of the fat cell enzyme. 104 FIGURE 16. ACTIVATION OF FAT CELL MBP KINASE BY MEK1(AN3). Purified fat cell MBP kinase was incubated with MEK1(AN3) for 20 min at 30 °C. Five ul aliquots of the reaction mixture were then added to reaction mixtures containing MBP and [y-32P]ATP. Assays proceeded for the indicated times and stopped by addition of SDS-sample buffer. Following SDS-PAGE, incorporation of 3 2 P into MBP was measured by liquid scintillation counting of the excised bands. Results shown are from a single experiment which was performed in duplicate. 105 3.2 S U M M A R Y An insulin-sensitive myelin basic protein kinase was identified in rat adipose tissue, but proved to be very labile and enzyme activity rapidly decayed upon storage. To enable purification of the enzyme, the kinase had to be stabilized and this was achieved by a rapid initial purification which consisted of differential centrifugation and ammonium sulphate precipitation. This rapid partial purification technique offered the benefits of speed, large volume capability and protein stabilization. The high ammonium sulphate concentration probably protects against possible proteolysis and dephosphorylation of the MBP kinases by inhibition of proteases and phophatases. The use of the phosphatase inhibitors together with the rapid ammonium sulphate precipitation was very effective in recovering and stabilizing the protein kinase activity. Not only were the activities enriched but they could be stored for months at -70 °C with apparently very little loss in activity, as was demonstrated by the subsequent studies aimed at further purification. Purification of the MBP kinase was achieved by use of sequential chromatography on polylysine-agarose, size exclusion, heparin-agarose and Mono Q columns. The final purified fraction contained a major 44-kDa band as judged by Western blotting analysis using an anti-MAPK antibody, as well as by silver staining of SDS-PAGE gels. The MBP kinase band contained phosphotyrosine which increased upon autophosphorylation but with apparently very little autoactivation. Based on the range of substrates tested, the kinase was proline-directed, which is consistent with other MAP kinases. An initial hypothesis that MBP/MAP kinase may be a significant insulin-stimulated ACC-kinase must be rejected, because the kinase did not appreciably phosphorylate ACC or specifically the I-site in ACC. The relevant insulin-sensitive ACC kinase therefore has yet to be identified. A number of biochemical characteristics of the purified insulin-activated adipose tissue MBP kinase have been defined and these generally confirm the close relationship to the established ERKs, notably ERK1. 106 CHAPTER FOUR COPURIFICATION OF ACTIN AND THE MBP KINASE: IS IT COINCIDENTAL OR DOES IT INDICATE A SPECD7IC INTERACTION? 4.0 RATIONALE. It is now generally accepted that a variety of MAP kinase cascades regulating many different functions within the same cell exist in both yeast and mammals. The components of these cascades are very similar but may exert distinct intracellular functions. Moreover, some kinases can act in more than one cascade as shown by the participation of Stel 1 and Ste7 in both the invasive and pheromone response pathways of S. cerevisiae. An interesting question which arises is how cells activate the proper subset of kinases to phosphorylate the right substrates in response to a particular stimulus. Although an exact answer to this question is unknown, one may propose at least two general mechanisms. Firstly, elements in a given signaling pathway may maintain fidelity by virtue of an inherent high degree of substrate specificity. Classically, a level of specificity has been ascribed to the sequential interaction of the kinases with their substrates i.e. MEKK interacts with MEK which in turn interacts with ERK. Indeed stable and relatively high affinity interactions between MAP kinases and MEKs have been described. For example, the Ste7-MAPK complexes are known to have an affinity (Kd = 5 nM), which is higher than ordinary kinase-substrate interactions and longer dissociation times (half time for dissociation = 2 min; Bardwell and Thorner, 1996). Because of specific contacts between the active site and the phospho-acceptor region of MAPK, the additional MEK/MAPK interaction imparts a double selection that provides fidelity of signal transmission. Secondly, signaling fidelity may be maintained by means of localization mechanisms which group components of a signaling pathway together. Examples of signaling elements that are regulated by localization mechanisms are protein phosphatases. The latter, were earlier considered non-specific counter regulatory enzymes for reversing 107 signals generated by protein kinases. However, several lines of evidence indicates interaction of phosphatases with targeting subunits that confer a high degree of specifity. Targeting proteins have also been found to interact with protein kinases. These targeting proteins are usually non-catalytic polypeptides which bind to the kinases and position them relative to their upstream regulators and/or substrates. Examples include the A kinase anchoring protein AKAP79 which simultaneously binds cAMP-dependent protein kinase A, the phosphatase calcineurin and protein kinase C (Klauck et al, 1996). More relevant to the MAP kinase cascade is the yeast protein Ste5 which forms a platform to assemble a signaling complex made up of Stel 1 (MEKK), Ste7 (MEK) and FUS3 and KSS1 (MAPKs) kinases. Ste5 therefore, acts like a structural scaffold, which nucleates the components of the pheromone MAP kinase cascade. Such localization of signaling complexes insulates components of one cascade from the others, providing fidelity in signal transmission. It also allows for more efficient signal transmission by facilitating signaling aspects such as substrate availability, activating and attenuating mechanisms as well as cross talk with other pathways. So far, no mammalian homologue of Ste5 has yet been reported. • Another putative function of the Ste5 signaling complex is to provide a link to the actin cytoskeleton. This is thought to occur through additional members of the Ste5 signaling complex which include the rho-like GTPase Cdc42 and the SH3-domain containing Beml protein (Leeuw et al., 1995). Beml binds actin providing a link of the MAP kinase cascade with the cytoskeleton. The involvement of the cytoskeleton with elements of the MAP kinase signaling pathway has been reported before. At the apex of this signaling cascade is the GTPase Ras, whose function is to recruit cytoplasmic Raf to the plasma membrane, where it binds to the cytoskeleton (Stokoe et al, 1994). Ras plays a regulatory role of targeting Raf to a specific cellular location, linking the activity of Raf to downstream elements of the pathway. 108 The cytoskeleton has also been implicated in other signaling pathways. For example, the tyrosine kinase Abl, contains SH 2 and 3 domains, a nuclear translocation signal as well as actin-binding domains. Mutant Abl, lacking the DNA- and actin-binding domains, causes lethality in mice, indicating that the cellular location of this kinase is crucial for its function (Schwartzenberg et al., 1991). The copurification of actin with the fat cell MAP kinase in particular, the difficulty encountered in their separation together with observations from other proteins above, led me to consider the proposal that a specific interaction exists between actin and MAP kinase. 4.1 R E S U L T S A N D DISCUSSION. 4.1.1 IDENTIFICATION OF ACTIN AS A MAJOR CONTAMINANT OF THE MAP KINASE. As mentioned above, attempts at sequencing the fat cell MAP kinase identified actin as a major contaminant. Actin copurified with the MAP kinase through several chromatographic steps. The two proteins also comigrated on SDS-PAGE gels. Initially, some of the unique properties of actin were exploited in order to remove it from the MBP kinase. Firstly, the ability of actin to bind deoxyribonuclease I (DNAase I) was used. This DNAase I-actin association has been successfully applied to extract actin from various non-muscle tissues (Zechel, 1980). Therefore, a DNAase I affinity column was used to bind actin just before the final Mono Q chromatographic step. Although some of the fat cell actin was removed by the DNAase I affinity column, the majority of it still copurified with the MAP kinase. In retrospect, since about equal amounts of F- and G-actin are present in cell homogenates (Blikstad et al., 1978), and F-actin binds very slowly to DNAse I (Hitchcock et al., 1976), it is not surprising that not all of the actin was extracted. 109 Secondly, the ability of actin to polymerize was used to extract it from the fat cell samples. Cytosolic extracts were adjusted to 100 mM KC1, and following incubation were subjected to centrifugation. Some of the actin was indeed polymerized and pelleted, but the majority still remained in solution. Curiously, some of the MAP kinase cosedimented with actin. In addition to salts, the rate of actin polymerization is enhanced by some actin-binding proteins such as myosin (Yagi et al., 1965). Cytosolic extracts were therefore, incubated with purified myosin followed by centrifugation. Analysis of the pellets and supernatants showed that only a fraction of the actin had been precipitated. Actin polymerization may be affected by soluble actin binding proteins which bind and subsequently stabilize monomeric actin (Pollard & Cooper, 1986). Thirdly, the ability of actin to interact with certain glycolytic enzymes such as aldolase (Arnold & Pette, 1970) was exploited. The actin binding domain within the aldolase molecule has been localized to a region (corresponding to residues 32-52) which is homologous with a region at the C-terminus of actin itself (O'Reilly & Clarke, 1993). Purified aldolase was coupled to Affi-gel and subsequently used to remove actin from fat cell extracts. Like the other methods mentioned above quantitative removal of actin was not achieved. Actin and the MBP kinase copurified on anion exchange, size exclusion, hydroxylapatite and phenyl-Sepharose columns. Chromatofocussing was therefore another attractive method to test, since it separates proteins according to their isoelectric points. There was no enzyme activity recovered from this column. Moreover, Western blotting analysis of the fractions did not reveal any bands corresponding to the MBP kinase. As a result, this method was abandoned. The only methods tested, which completely separated actin from the MBP kinase were isoelectric focussing coupled with SDS-PAGE and affinity chromatography using anti- ERK1 antibody. The former method was of low capacity and time consuming. Therefore, it could not be used to obtain enough kinase for sequencing. Actin-free MAP 110 kinase was obtained by using the anti-ERK antibody column. However, the amount of enzyme obtained was insufficient for sequence analysis. 4.1.2 DOES THE COPURIFICA TION OF MBP KINASE AND ACTIN IMPLY A MEANINGFUL ASSOCIATION BETWEEN THE PROTEINS? Actin copurified with the MBP kinase over several different chromatographic steps. Size exclusion chromatography would not have resolved the two proteins since their molecular sizes are nearly the same. It is however intriguing that other methods which separate by means of surface charge or even hydrophobicity of molecules could not resolve these two proteins. It is therefore tempting to speculate that a specific interaction exists between actin and the fat cell MBP kinase. A combination of strategies was used to test the validity of this hypothesis. The strategies included analysis of elution profiles of MBP kinase and actin on size exclusion columns, Western blotting and immunoprecipitation with anti-MAPK and anti-actin antibodies. In addition, immunofluorescence staining was used to determine possible subcellular localization of the two proteins. 4.1.3 COPURIFICATIONOFACTINAND THE MBP KINASE ON SIZE EXCLUSION COLUMNS. As mentioned above, at least two peaks of MBP phosphotransferase activity were resolved on the Superdex 200 size exclusion column (Fig. 5 Peak 1 = fractions 28-38, Peak II = fractions 44-50). Peak II eluted with an apparent molecular size of 44-kDa which corresponds to the monomelic size of ERK 1. In contrast, Peak I eluted before the catalase molecular weight marker (232-kDa). So far, few kinases with such large molecular sizes are known. Conceivably, the MBP phosphotransferase activity(s) in this peak may have been catalyzed by small sized kinases eluting as large complexes. A high molecular weight form of MBP kinase was also observed on a different size exclusion 111 column (Sephacryl S-200 HR, Fig. 17) and was therefore not just an artifact of the Superdex 200 size exclusion column. The fact that the complexes were not disrupted in the presence of 0.2-0.5 M NaCl minimizes the risk of the presence of merely aggregated denatured protein. Western blotting analysis of Peak I fractions containing high molecular weight form of MBP kinase (Peak I, fractions 28-38 of Superdex fractions, Fig. 5), revealed the presence of the 44-kDa MAP kinase as well as actin (Fig. 18). It appears therefore, that both the 44-kDa MAP kinase as well as actin existed in complexes with molecular masses greater than 232-kDa. The simplest explanation to account for high molecular weight actin is the presence of oligomeric and/or filamentous actin (F-actin) in the fat cell cytosolic extracts. If the explanation is correct then, agents like phalloidin which bind and stabilize F-actin should increase the amount of actin eluting in Peak I. Phalloidin treatment caused a 25 % increase in the amount of actin which eluted in Peak I (Table 10). There was a concomitant decrease (from 57 % to 32 %) of monomeric actin in Peak II. Thus, phalloidin led to a shift in the elution of actin microfilaments. Because of the specificity of phalloidin in stabilization of microfilaments, those proteins whose elution is shifted along with the microfilaments must be microfilament-associated proteins. This is an adaptation of the technique by Carraway and Weis (1985). i Immunoblotting analysis of Peak I fractions with the anti-MAPK antibody, R2, revealed a 11 % increase of MAPK eluting in Peak I in the presence of phalloidin. A corresponding 11 % decrease of R2-reactive protein was also observed in Peak II. The results indicate that some of the cellular MAPK associates with actin microfilaments. To investigate further the association between MAPK and actin, immunoprecipitation analyses were performed. Immunoprecipitates were washed under stringent conditions (1 % NP40, 0.5 % sodium deoxycholate, 0.1 % SDS and 150 mM NaCl).The actin antibody precipitated MAPK and the MAPK antibody co-immunoprecipitated actin (Fig. 19). Actin and the MAP kinase comigrate on SDS-PAGE 112 gels. The posibility that the R2 antibody might cross-react with actin was ruled out by using purified actin. However, only the R2 antibody was able to immunoprecipitate active enzyme as judged by MBP phosphoryation. It is conceivable that the actin antibody inhibits the MAP kinase activity. Altogether, these results point to close association betweeen actin and a fraction of adipose tissue MAPK. At this point however, it is not clear whether the association is direct or mediated by an accessory protein such as another actin-binding protein. This question may be answered by studying the association of purified actin and the MAPK in vitro. i The involvement of the cytoskeleton in cellular signaling is hardly unprecedented. A number of studies have shown that growth factor receptors interact in vivo with the cytoskeleton. These receptors include those for nerve growth factor (Vale and Shooter, 1983), PDGF (Zippel etal, 1989) and EGF (Wiegant etal, 1986). Likewise, signaling proteins involved in the pathways initiated by some of these receptors have been shown to associate with the actin microfilament system. For example in the EGF pathway, Ptdlns 4-kinase, PtdIns(4)P-5 kinase, diacylglycerol kinase and phospholipase C associate with the cytoskeleton (Payrastre et al, 1991). In other studibs, MAP kinase was shown to relocate to the cytoskeleton following activation by phenylephrine in differentiated contractile vascular cells (Khalil et al, 1995). More recently, the MAP kinase kinase, SEK1 was shown to bind directly and specifically to the actin-binding protein ABP-280 (Marti et al, 1997). ABP-280 was also shown to weakly but specifically interact with MEK1 in vitro. Finally, among MAP kinase substrates are cytoskeletal proteins such as caldesmon (Childs and Mak, 1993), and MAP2 (Ray and Sturgill, 1987). The actin-binding protein 280 is phosphorylated by p90rsk, a kinase which is activated by MAP kinase (Ohta and Hartwig, i 1966). The biological significance of the interaction of the cytoskeleton with these and other signaling proteins is intriguing. It is conceivable that the actin microfilament acts as a matrix facilitating the formation of signaling complexes consisting of receptors, regulators and substrates. This provides specificity and increases the efficiency of signal transmission 113 between the elements. FIGURE 17. CHARACTERIZATION OF MBP KINASE ACTIVITIES BY SEPHACRYL S-200 HR GEL FILTRATION CHROMATOGRAPHY. Fractions from the poly-lysine column containing MBP phosphotransferase activity from untreated (open circles) and insulin-treated rat fat tissue (solid circles) were concentrated and applied on a Sephacryl S-200 HR column. Aliquots (5 pi) of the eluted fractions were assayed for MBP phosphotransferase activity. Three distinct peaks of MBP kinase activity were obtained. 20 30 40 5 0 Frac t ion n u m b e r 115 FIGURE 18. IDENTIFICATION OF ACTIN AND MAPK IN SUPERDEX 200 -FRACTIONS OF FAT CELL EXTRACTS. Fat cell extracts were fractionated on a Superdex 200 column as described in the legend of Fig. 5. Column fractions (200 pi, for fractions 16-43 and 100 pi, for fractions 44-49) were subjected to SDS-PAGE and Western blotting with the R2 and anti-actin antibody. Lane numbers represent the higher of consecutively paired column fractions (lane 16 corresponds to fractions 16 plus 17). 16 18 20 22 24 26 28 30 32 34 36 38 40 42 44 46 48 50 52 R2 anti-actin 116 TABLE 10. EFFECT OF PHALLOEMN ON THE ELUTION OF ACTIN AND MBP KINASE ON SUPERDEX 200 COLUMN. Fat cell extracts were fractionated on a Superdex 200 column in the presence or absence of 10 ul/ml phalloidin. Fractions (200 ul) were subjected to SDS-PAGE and Western blotting analysis. Membranes were probed with the anti-actin and anti-MAPK (R2) antibodies. The amounts of actin and MBPK protein in Peak I (fractions 28-38) and Peak II (44-50) were calculated using densitometric scanning. The protein amount in each peak is expressed as a fraction of the total protein (Peaks I and II combined). Results represent values from a single experiment. T R E A T M E N T P E A K I P E A K II Actin Actin (-) phalloidin (+) phalloidin 43 68 57 32 MBPK MBPK (-) phalloidin (+) phallodin 47 58 53 42 117 FIGURE 19. CO-IMMUNOPRECIPITATION OF ACTIN AND MBP KINASE. Fat cell extracts from the Superdex 200 column were immunoprecipitated with anti-MAP kinase (C-16, A) and anti-actin (B) antibodies. Immunoprecipitated proteins were subjected to SDS-PAGE and Western blotting analysis with the MAP kinase (R2) antibody and anti-actin antibodies. IP: C-16 WB: anti-actin 25 33 36 39 48 Actin —> IP: anti-actin WB: R2 25 33 36 39 48 B MBPK 118 4.1.4 IMMUNOFLUORESCENCE STAINING OF ACTIN AND THE MBP KINASE. An immuno-cytochemical investigation was undertaken to determine whether actin-MAPK interactions may exist in intact cells. This was performed using indirect immunofluorescence. Intact 3T3 fibroblasts were fixed and treated with the MAP kinase (R2) antibody and phalloidin. The results (Fig. 20) showed colocalization of the MAP kinase with actin filaments. The specificity of the antibody was confirmed by omission of the primary antibody which produced undetectable labelling (data not shown). These results differ from those of Reszka et al. (1995), who reported colocalization of MAPK with microtubules in NTH 3T3 cells. The reason for this discrepancy is not clear, and should be addressed in future studies. Other issues to be addressed include the use of physiological relevant cells (adipocytes), and the colocalization pattern following insulin stimulation, or treatment with microfilament disruptive agents like cytochalasins. 119 F I G U R E 20. C O - L O C A L I Z A T I O N O F M A P K AND T H E A C T I N C Y T O S K E L E T O N . NTH 3T3 cells were fixed and labelled with the R2 antibody (A) and Texas red-conjugated phalloidin (B). C: superimposed image: green, anti-MAPK, red, phalloidin, yellow, colocalization. Photographs were taken using a standard fluorescence microscope. 120 4.2 S U M M A R Y . A possible link of the fat cell MBP kinase with the actin cytoskeleton has been investigated. The MBP kinase copurified with actin on anion exchange, hydrophobic interaction, hydroxyapatite and size exclusion columns. Three different approaches were used to probe for a possible actin-MAPK interaction. Firstly, phalloidin was used as a diagnostic tool to alter the elution of actin on size exclusion columns. Phalloidin binds to actin microfilaments and stabilizes them by reducing fragmentation. Size exclusion chromatography of phalloidin-treated fat cell extracts revealed an increase in the amount of actin which eluted in a high molecular weight form. Because of the specificity of phalloidin for actin filaments, those proteins that are shifted together with actin should be actin-associated. Western blotting analysis using the anti-MAPK antibody revealed that the fat cell MBP kinase shifted along with actin. This result indicates an association of the MBP kinase with actin. Secondly, immunoprecipitations were done using antibodies specific for the MBP kinase and actin. The anti-MBP kinase antibody immunoprecipitated actin and the anti-actin antibody precipitated the MBP kinase. Finally, preliminary immunocytochemical analysis indicated that actin and MAP kinase colocalized in NTH 3T3 fibroblasts. Altogether, the results support the hypothesis that actin and the MAP kinase may associate with each other. An important caveat at this stage is the question of the extent of co-association between actin and the MBP kinase. Certainly, the majority of MBP kinase exhibits an apparent molecular size of 44-kDa on the size exclusion columns suggesting that it is largely monomelic. This indicates that only a small percentage of total MBP kinase may be present in larger molecular aggregates (unless these have been dissociated as a result of tissue homogenization and fractionation). Even under these stringent conditions, a small percentage of total MBP kinase may associate with actin and this might provide the basis for a significant physiological role of this localized MBP kinase. The actin cytoskeleton may provide a matrix whereby signaling complexes containing MAP 121 kinases are attached. Such signaling complexes are known to exist in yeast. For example, elements of the MAP kinase cascade associate with the scaffold protein Ste5 (Choi et al., 1994; Marcus etal., 1994; Printen and Sprague, 1994). Moreover, these yeast MAPK complexes have been shown to associate with the actin cytoskeleton through the Beml protein (Leeuw et al., 1995). The existence of signaling complexes may be a mechanism whereby specificity among parallel MAPK cascades is maintained. 122 CHAPTER FIVE DIFFERENTIAL REGULATION OF MAP KINASE ISOFORMS BY INSULIN AND EXTRACELLULAR OSMOLARITY IN RAT WHITE ADIPOSE TISSUE. 5.0 RATIONALE. A role of MAP/ERK kinase as an ACC-kinase is unlikely (see Chapter 3). However, it is conceivable that MAP/ERK kinase may still be involved in other aspects in the overall stimulation of fatty acid biosynthesis by insulin. Alternatively, related MAP kinases may mediate the insulin effects on fatty acid biosynthesis. These MAP kinase isoforms include members of the jun N-terminal kinases (JNKs) and p38 (also known as RK or p40), the mammalian homolog of the protein kinase Hogl in Saccharomyces cerevisiae. Both p38 and JNKs have been shown to be activated in response to hyperosmotic stimuli, cytokines, protein synthesis inhibitors, ultraviolet light, growth factors and insulin (Davies, 1994; Moxham et al., 1996). The hypothesis that this new group of MAP kinase which responds to changes in extracellular osmolarity, may be involved in mediating some aspects of the metabolic actions of insulin is further supported by evidence which demonstrates that increases in hepatocyte cell volume (elicited by changing extracellular osmolarity) can reproduce the anabolic effects of insulin on carbohydrate metabolism. For example, cell swelling has been shown to inhibit glycogenolysis and glycolysis, and proteolysis, while inducing the stimulation of glycogen synthesis, amino acid uptake, ureogenesis and protein sythesis. The anabolic effects of insulin on hepatocyte metabolism are accompanied by increases in cell volume (of the order 10-12%), which are sufficiently rapid and sustained to account for metabolic responses. Counter-regulatory catabolic effects of glucagon are reflected by cell shrinkage, which is also rapid and sustained, and the catabolic responses can be induced by hyper-osmotic buffers in the absence of glucagon. The aim of this study was therefore to evaluate the relative responsiveness to insulin and osmolarity of the three established MAP 123 kinase signaling pathways and to assess the roles ofithese pathways in the regulation of fatty acid biosynthesis in rat white adipose tissue. 5.1 R E S U L T S A N D DISCUSSION. 5.1.1 EFFECTS OF INSULIN AND EXTRACELLULAR OSMOLARITY ON FA TTY ACID BIOSYNTHESIS. Rates of de novo fatty acid biosynthesis were determined by following the incorporation of [3H] from [3H] water into saponifiable lipids in freshly-isolated rat white adipose tissue subjected to a range of extracellular osmolarities. The conventional iso-osmotic buffer employed was Krebs-Henseleit bicarbonate-buffered medium (nominally 316 mOsM). Hypo-osmotic buffers (228 mOsM) or hyper-osmotic buffers (404 mOsM) were generated by respectively reducing or increasing the concentration of sodium chloride or by adding sorbitol. In agreement with previous studies, the rate of fatty acid synthesis in iso-osmotic buffer in the absence of insulin was in the range 2 to 4 ug atoms [H]/g wet weight of tissue per hour. Rates observed in isolated tissues or cells are typically somewhat less than those estimated for intact tissue in vivo, where rates of fatty acid synthesis are 5-15 ug atoms [H[/g per hour in the absence of insulin (Stansbie et al., 1976). Results of six independent experiments (summarized in Fig. 21) illustrate the 2- to 3-fold stimulation of fatty acid synthesis following incubation of tissue in the presence of insulin (87 nM). The possibility that hypo-osmotic conditions might induce an anabolic response in adipose tissue as found in liver was not confirmed in these experiments. Indeed, basal rates of fatty acid synthesis were somewhat lower in hypo-osmotic medium than in iso-osmotic medium (average rates of 2.1 and 2.8 ug atoms [H]/g/h, respectively). Maximum rates (Fig. 21) were in the range 4.5 - 5.5 ug atoms [H]/g per hour and on a paired basis, the fold stimulations by insulin were also similar - being 2.0-fold (iso-osmotic), 2.1-fold (hypo-osmotic) and 1.6-fold (hyper-osmotic). These results indicate that the anabolic effects of cell swelling observed in studies of carbohydrate metabolism in 124 hepatocytes are not evident in adipose tissue and that the effects of insulin on fatty acid biosynthesis are not reproduced or enhanced by hypo-osmotic conditions. 125 FIGURE 2 1 . EFFECTS OF INSULIN AND OSMOLARITY ON FATTY ACID SYNTHESIS. Epididymal and perirenal fat pads were preincubated for 20 min at 37 °C in isotonic Krebs-Henseleit buffer. Tissues were transferred to fresh hypo-, iso- or hypertonic media (228, 316 and 404 mOsM, respectively), containing 3 H 2 0 (70 pCi/ml), without (shaded bars) or with insulin (87 nM, black bars). Incubations proceeded for 1 h at 37 °C. Incorporation of 3 H into fatty acids was detemined as described in the Methods. Results are given as pg-atoms of'H' incorporated/h per g wet weight of tissue and are shown as means ± S.E.M for 6 independent experiments. The asterisk denotes values following insulin treatment-are significantly different from paired non-insulin osmotic control and from iso-osmotic control (P<0.05). 126 5.1.2 EFFECTS OF INSULIN AND EXTRACELLULAR OSMOLARITY ON ERK ISOFORMS. The relationship between osmolarity and insulin action on adipose tissue metabolism was further exploited to examine the possible roles of the major MAP kinases. The role of MAP kinases as intermediates in volume regulation is supported by the existence of two distinct osmosensitive pathways in yeast. Exposure of yeast cells to hypertonic conditions activates the Hogl MAP kinase, which leads to increased glycerol synthesis and subsequent restoration of the osmotic gradient across the cell membrane. Likewise, the PCK1 pathway is activated following exposure of yeast cells to hypo-osmotic conditions. Related osmo-sensing protein kinases have been identified in mammalian cells. For example, exposure of Chinese hamster ovary cells to hyper-osmolar media leads to the activation of c-Jun kinases (Galcheva-Gargova et al., 1994). Similarly, hyper-osmolarity was shown to activate p38 which is the mammalian homolog of the yeast Hogl kinase (Raingeaud etal, 1996). Both ERK1 and ERK2 are activated following exposure of cultured hepatoma cells to hypo-osmolar conditions (Schliess et al, 1995). Following tissue incubation and homogenization as described in the Methods section, cytosolic fractions were prepared and subjected to ion exchange on a Source-15Q column (FPLC). The column was developed using a linear salt gradient and the fractions were assayed for MBP phosphotransferase activity. The fractions were also subjected to Western blotting analysis using an antibody raised against an epitope common to both ERK1 and ERK2 ("control" antibody, New England Biolabs) as well as a "phospho-specific" antibody which recognizes the activated (tyrosine phosphorylated) forms of these enzymes. Fig. 22 A shows a typical profile of MBP phosphotransferase activities eluted following ion exchange chromatography. Four peaks of MBP phosphotransferase activities are evident: a major complex of two closely-migrating peaks from fractions 11-20 (Peaks I and II, consecutively), two smaller peaks from fractions 22-24 (Peak III) and fractions 25-28 (Peak IV). The profile shown is one representative of a large number of 127 such separations employing either Mono Q or Source-15Q columns and the results are in general agreement with a large number of studies with various cell types. Immunoblotting confirmed (Fig. 22B) that the major doublet peak of MBP phosphotransferase activity contained 42-kDa ERK2 and 44-kDa ERK1. Fractions eluting before or after the complex doublet of peaks I and II contained little or no detectable ERK protein (fractions 1-9 or 22-40). Based on immunoblotting analysis, the two ERK isoforms appear to be equally abundant in the rat white tissues studied. In a set of four independent preparations subjected to immunoblotting with the anti-ERK antibody directed at the epitope common to the two isoforms, the average intensity of 42-kDa and 44-kDa bands analysed on the same blots were 18 and 16 arbitrary absorbance units respectively. On a paired basis, the average ERK1 signal intensity following immunoblotting was 96 % of the corresponding value for ERK2. In addition to the similarity in abundance, the two ERK isoforms also responded in coordinate fashion to insulin treatment in respect to the extent of activation (see below) and in time course (Fig. 22C). On the basis of immunoblotting as well as MBP phosphotransferase activity determinations, both ERK isoforms reach a peak of activation (approximately 5-fold in the example in Fig. 22C) within 5 min after exposure of adipose tissue to insulin. The subsquent deactivation of the two ERK isoforms is also apparently superimposable, with approximately 2-fold activation persisting through 40 min. Comparing Fig. 22 A and 22B, it appears there is a discrepancy in elution of MBP phosphotransferase activity and ERK protein. Notably, Peak II (fractions 15-20) contains similar total integrated MBP phosphotransferase activity but much less immuno-detected ERK protein than Peak I (fractions 10-14). There are two possible explanations for this discrepancy, that (i) Peak II may contain additional MBP kinases distinct from the ERKs and/or (ii) that the ERK protein in Peak II is substantially more active than that in Peak I. Both these possibilities may be valid because, PKB is now known to elute in the same salt gradient identical to Peak II and this enzyme is also able to phosphorylate MBP. Further, 128 analysis of ERK specific activity indirectly, by using anti-phospho ERK antibodies shows that the abundance of the activated forms of the ERKs is indeed more equavalent in Peaks I and II, consistent with the measured MBP phosphotransferase activities (see Fig. 23). 129 F I G U R E 22. A C T I V A T I O N O F ERK1 A N D ERK2 B Y I N S U L I N . A. Fat pads were incubated at 37 °C for 10 min in the absence or presence of insulin (87 nM) in iso-osmotic medium and then homogenates were prepared and centrifuged (350,000 x g for 10 min). Proteins in supernatant fractions were precipitated with ammonium sulphate and then subjected to anion exchange chromatography on a Source-15 Q column. MBP phosphotransferase activity was measured in samples (5 pi) of column fractions (500 pi) following chromatography of extracts of tissue incubated in the absence (open circles) or presence of insulin (filled circles). Four significant peaks (I-IV) of MBP phosphotransferase activities were detected in this representive chromatogram and very similar results were obtained in 6 additional independent experiments. B . The abundance of ERK protein subunits in the Source-15 Q column fractions was examined by subjecting samples (200 pi) to SDS-PAGE and Western blotting with the "control" anti-ERK antibodies (to detect both active and inactive ERK proteins). The upper and lower blots present results for extracts of control and insulin-treated tissue, respectively. Arrowheads indicate the migration of the 44 kD ERK1 and 42 kD ERK2 subunits. Lane numbers represent the higher of consecutively paired column fractions (lane #12 corresponds to fractions 11 plus 12). Column fractions 1-10 and 21-30 contained little or no immunoreactive ERK protein. C. The time course for ERK activation by insulin and decay was examined by subjecting high speed supernatant fractions to SDS-PAGE and Western blotting using "phospho-specific" anti-ERK antibodies. The amounts of activated phospho-ERKl (triangles) and phospho-ERK2 (circles) are expressed relative to total amount of the corresponding ERK isoform protein detected with the "control" antibody. The results represent the mean values from two independent experiments. 130 131 c 132 The activation of ERK isoforms was analysed following treatment of adipose tissue with or without insulin in iso-, hypo- and hyper-osmotic media. ERK activation was assessed by measuring MBP phosphotransferase activity and by determination of the extent of tyrosine phosphorylation of the ERK isoforms by immunoblotting (Fig. 23 A). Hypo-osmotic medium was found to cause ERK activation even in the absence of insulin, while hyperosmolarity alone was without any detectable effect on the ERKs (Fig. 23 A). ERK activation by insulin was very similar in iso- and hypo-osmotic medium and was only slightly more extensive than that observed by incubation of cells in hypo-osmotic medium alone. The parallels between the reponses of ERK1 and ERK2 to insulin in iso-osmotic conditions (noted above) appear also to be reflected in similar extent of activation in hypo-osmotic medium and lack of activation under hyper-osmotic conditions (Fig. 23 A). The elution of active phospho-ERK2 is somewhat sharper and earlier (especially fractions 11-14) than that of phospho-ERKl (notably fractions 14-18), indicating that ERK2 and ERK1 may contribute most importantly to Peaks I and II, respectively, of MBP phosphotransferase activity. The observations of ERK activation provide an important contrast to the impact of osmolarity on fatty acid synthesis, indicating divergent regulation. Two particularly notable conclusions may be drawn. First, activation of ERKs in hypo-osmotic medium is not accompanied by a parallel activation of fatty acid synthesis; second, the activation of fatty acid synthesis by insulin in hyper-osmotic medium occurs with no detectable activation of the ERK isoforms. Together, these observations confirm that the activation of ERK 1 and/or ERK2, though clearly insulin-sensitive, is neither necessary nor sufficient for one important metabolic effect of insulin, the activation of adipose tissue fatty acid biosynthesis. In view of the poor correlation between the effects of insulin on fatty acid synthesis and on the activities of the ERK isoforms, the possibility that insulin actions on this metabolic pathway may depend upon activation of related MAP kinase cascades was explored. The related kinase cascades consist of the c-Jun N-terminal (stress-activated) 133 protein kinases (JNK/SAPKs) and the mammalian homolog of the yeast Hogl M A P protein kinase (p38). 134 F I G U R E 2 3 . A C T I V A T I O N O F E R K 1 A N D E R K 2 B Y I N S U L I N A N D O S M O L A R I T Y . A. Fat pads were incubated in iso-, hypo- or hyper-osmotic buffer (316, 228 and 404 mOsm respectively) in the absence or presence of 87 nM insulin. Protein samples were prepared and subjected to chromatography on a Source 15Q column as described in the legend to Fig. 22. Consecutive pairs of column fractions were pooled and 200 ul of each pool subjected to SDS-PAGE and Western blotting analysis. Membranes were probed with the "phospho-specific" anti-ERK antibody which recognizes tyrosine phosphorylated ERK1 and ERK2. Gel lane numbers, at top, indicate higher of two pooled fraction numbers (lane 8 corresponds to column fractions 7 plus 8). The two major protein bands, in each of the six panels, correspond to 44-kDa ERK1 (upper band) and 42-kDa ERK2 (lower band). B . The effects of tissue treatment on MBP phosphotransferase activity were determined following Source-15Q chromatography. Integrated MBP phosphotransferase activity in Peak I (fractions 11-14) and in Peak II (fractions 16-20) were calculated as estimates of ERK2 (shaded bars) and ERK1 (open bars), respectively. The sum of activities in Peaks I and II (solid bars) represents the combined total of ERK 1 and ERK2. Results are presented as the mean ±SEM for five independent experiments. The asterisks indicate values significantly different from iso-osmotic control (P<0.05). 135 o a >. X 137 5.1.3 EFFECTS OF INSULIN AND EXTRA CELI, IJLA R OSMOLARITY ON .JNK/SAPK ISOFORMS. The responses of JNK/SAPKs were assessed by affinity purification followed by in vitro protein kinase assays (see Experimental Procedures) in which phosphorylation of GST/c-Jun[l-169] was assessed by SDS-PAGE, autoradiography and phosphorimaging. A summary of four independent experiments indicates that exposure of adipose tissue to insulin or to aniso-osmotic buffers induces marked JNK activation of 3- to 5-fold within 10 min (Fig. 24). JNK activity was increased to an equivalent extent when tissues were incubated either in hypo- or in hyper-osmotic bufffers. Further, JNK activities were increased to about the same maximum level by insulin, irrespective of the extracellular osmolarity. This indicates that, once activated by changing osmolarity, no significant additional activation of JNKs could be detected with the further addition of insulin (even the apparent increase with insulin in hyper-osmotic buffer was not statistically significant). Although the maximal activation of JNKs appears similar when adipose tissue is exposed to insulin or aniso-osmotic buffers (Fig. 24), the tissue responses may not be identical. For example, the decay of JNK activation with time (Fig. 25B) appears more extensive and rapid following insulin treatment (in iso-osmotic buffer) than following exposure of tissue to either hypo- or hyper-osmotic conditions. This observation might indicate that distinct regulatory mechanisms are involved in modulating JNK activation in these different physiological settings. In conclusion, changes in osmolarity alone lead to activation of JNKs (which may be more sustained than that induced by insulin) but no corresponding activation of fatty acid biosynthesis (Fig. 21), indicating that the activation of these protein kinases might be required but insufficient alone to induce this metabolic response. 138 FIGURE 24. ACTIVATION OF JNK/SAPK BY INSULIN AND OSMOLARITY. Adipose tissue was incubated for 10 min in hypo-, iso- or hyper-osmotic buffer (228, 316 or 404 mOsM, repectively) in the absence (shaded bars) or presence of insulin (87 nM, solid bars). Following homogenization and centrifugation, tissue extracts were incubated for 4 h with GST/c-Jun[l-169] which had been pre-bound to glutathione-agarose beads. After extensive washing, the beads were incubated with [y-32P]ATP for 30 min at 30 °C and the phosphorylated proteins were resolved by SDS-PAGE, visualized by autoradiography and incorporation of 3 2 P into GST/c-Jun quantified by densitometric scanning. The results are means + S.E.M. for 4 independent experiments and show 3 2 P-incorporation into GST/c-Jun as a percent of the isotonic control. The asterisks indicate values significantly different from isotonic control (P<0.01). 8 8 0 0 o o o CO CO > o o <D CO o CD CO C D o J Z Q _ CO O J Z C L C 3 ^ 3 I o 6 0 0 h 4 0 0 2 0 0 0 iso hypo '• hyper T rea tment 139 FIGURE 25. TIME COURSE OF JNK ACTIVATION AND DEACTIVATION. A. The phosphorylation of GST/c-Jun[l-169] by adipose tissue JNKs was determined as in the legend to Fig. 24. The autoradiogram illustrates incorporation of 3 2 P into GST/c-Jun, following exposure of tissue hyper-osmotic buffer (404 mOsM) for 0, 2, 5, 10, 20, 40 or 80 min (lanes 1-7, respectively). Arrows indicate the migration of GST/c-Jun and of standard protein markers with the assigned subunit sizes in kDa. B. The time course for activation and deactivation of JNKs was examined following exposure of tissue to hyper-osmotic buffer (404 mOsM, open circles), hypo-osmotic buffer (228 mOsM, closed circles) or to insulin in iso-osmotic buffer (triangles). Results are the mean of three independent experiments. A <-200 <-97 <-69 <-GST/c-Jun <-30 140 141 5.1.4 EFFECTS OF INSULIN AND EXTRACELLULAR OSMOLARITY ON HOG 1 KINASE ISOFORM. Three independent approaches were employed to assess the extent of the p38/RK protein kinase in response to insulin and/or changes in extracellular osmolarity: (i) determination of MBP kinase in Peak IV following Source-15 Q chromatography, (ii) determination of the level of tyrosine phosphorylation of the p38/RK protein by first immunoprecipitation (with anti-p38/RK antibodies) and then probing with anti-phosphotyrosine antibodies by Western blotting and finally (iii) by measuring the Hsp27 phosphotransferase activity in treated cells as a "downstream" index of the activation of p38/RK. Overall, results of these three sets of analyses indicate that changes in osmolarity (over the range 200-400 mOsM) induce slight or no changes in the activity of p38/RK. MBP kinase activity differed by less than 30% from control (iso-osmotic) values following exposure of tissue to hyper- or hypo-osmotic media. Similarly, the tyrosine phosphorylation of p38/RK and the activity of Hsp27 kinase differed by less than 20% and 10%, respectively, of values in iso-osmotic media. Exposure of adipose tissue to insulin produced marginally bigger changes in these three estimates of p38/RK activation, but still the effects were not large and did not reach statistical significance. The maximum effect of insulin on Peak IV MBP kinase activity was 40% above non-insulin treated controls, contrasting with several-fold activation of ERKs (Fig. 22) and c-Jun kinases (Fig. 24). Similarly, the tyrosine phosphorylation of p38/RK and Ffsp27 kinase activity increased, respectively, by 45-55 % and by 20-40 % above control following insulin treatment in all three osmotic conditions. Since changes in osmolarity in the range 200-400 mOsm had no detectable effect, the responses of the p38/RK to more extreme conditions of osmolarity were examined. The results (Fig. 26) illustrate that Hsp27 kinase activities can indeed be significantly stimulated in adipose tissue with increasing osmolarity up to 900 mOsM. At this level of 142 osmolarity, the response of Hsp27 kinase was rapid (maximal within 5 min exposure) and sustained for at least 60 min hyper-osmolarity. With even more extreme osmolarity of 1200 mOsM or more, Hsp27 kinase activities declined to values near or even below those seen in iso-osmotic controls (Fig. 26), perhaps reflecting loss of cell viability prior to tissue extraction. These observations underline the fact that although rat adipose tissue contains an osmosensitive p38/RK and Hsp27 kinase pathway, it is only marginally activated within the normal physiological range of extracellular osmolarity and shows very modest responses to insulin which seem unlikely to iaccount for the metabolic effects of the hormone. 143 T FIGURE 26. ACTIVATION OF p38 BY HYPEROSMOLARITY. A. Extracts of adipose tissue were prepared and subjected to Source-15Q chromatography as described in the legend of Fig. 22. Column fractions 11-28 (covering MBP kinase peaks I-IV) were subjected to SDS-PAGE and Western blotting with anti-p38 antibody. Arrows indicate the migration of p38 and of standard protein markers with the assigned subunit sizes in kDa. B. Hsp27 phosphotransferase activity was determined as an indirect (downstream) estimate of p38 activation. Adipose tissue was incubated in media with the indicated osmolalities (10 min), extracts prepared and incubated with purified F£sp27 in the presence of [y-3 2P] ATP, prior to SDS-PAGE and autoradiography or phosphoimaging. The autoradiogram indicates the phosphorylation of Hsp27 following incubation of adipose tissue at osmolalities of 228, 316, 441, 616, 916 and 1316 mOsM (lanes 1-6, respectively). Arrows indicate the migration of Ffsp27 and of standard protein markers with the assigned subunit sizes in kDa. C. The effects of hyper-osmolarity on Ffsp27 kinase activity was examined in a series of experiments in which the indicated osmolarity was achieved by varying the concentration of NaCl (shaded bars) or sorbitol (solid bars). The results are the average of three independent experiments. A 12 14 16 18 20 22 24 26 28 <-200 <-97 <-69 <-p38 <-30 144 5 6 <-200 <-97 4-46 <-Hsp27 <-21 145 c 2 2 8 3 1 6 441 616 9 1 6 1 3 1 6 Osmola r i t y (mosM) 146 j 5.2 S U M M A R Y . Changes in osmolarity alone, over the range from hypo-osmotic (228 mOsM) to hyper-osmotic (404 mOsM) did not stimulate fatty acid biosynthesis in rat white adipose tissue. Activation of the pathway by insulin occured to an equivalent extent under iso-osmotic (315 mOsM), hypo-osmotic and hyper-osmotic conditions. The activation of the ERKs differed from that of fatty acid synthesis because of two reasons. First, hypo-osmolarity alone activated the ERKs. Second, activation of ERKs by insulin was inhibited by hyperosmolarity. The c-Jun kinases were activated by both insulin and changes in osmolarity. Unlike fatty acid biosynthesis, c-Jun kinases were activated by both hypo- and hyper-osmolarity. The p38 pathway was activated by extreme hyper-osmolarity. Only small changes in the activity of p38 were determined following exposure of fat tissue to insulin and/or aniso-osmotic conditions within the physiological range. The activation of this pathway did not correlate with that of fatty acid synthesis. Taken together, the observations described above provide support for the argument that the stimulation of fatty acid biosynthesis in adipose tissue by insulin cannot be adequately explained by activation of any one of the established MAP kinase signaling pathways. To date, only the c-Jun kinases have been reported to participate in one of the metabolic effects of insulin, glycogen synthesis in the skeletal muscle of BDF1 mice (Moxham et ai, 1996). A general conclusion is therefore that insulin signaling for metabolic response of fatty acid biosynthesis, beyond the apparently critical activation of phosphatidylinositol-3-kinases, remains to be established. 147 CHAPTER SIX. ACTIVATION OF PROTEIN KINASE B BY INSULIN AND VANADIUM. 6.0 RATIONALE. Firm evidence now exists against a role of MAP kinases in the metabolic effects of insulin and the search for other pathways and mediating protein kinases therefore continues. One possible candidate is PKB, a recently-discovered Ser/Thr kinase which becomes active following stimulation with a variety of growth factors and insulin. The PKB signaling pathway has been under intense scrutiny recently, such that a picture of the i signaling elements involved has emerged. Compelling evidence now exists that activation of PI3-K is both necessary and sufficient for the growth factor or insulin stimulation of PKB. Time course and inhibitor studies have indicated a role of PKB in regulating GSK3 and glycogen synthesis (Cross et al, 1995; Hurel et ai, 1996). Other data have linked PKB with the transmission of growth signals. Specifically, p70s(^ is thought to lie downstream of PKB. This is based on cotransfection assays in which activated mutants of PKB stimulated p70s^ (Burgering and Coffer, 1995). Finally, more recent data have pointed to a role of PKB in regulating apoptotic signaling pathways. For example, the kinase was shown to mediate the anti-apoptotic effects of IGF-1 on cerebellar neurons (Dudek et al., 1997) or fibroblasts (Kulik et al, 1997). This role of PKB in cell survival may partially explain the oncogenic nature of the kinase. In fully differentiated cells like rat adipocytes, cellular metabolic rather than growth processes, are more important. In these cells, PI3-K is known to control insulin-mediated effects such as the stimulation of glucose transport, lipid and glycogen synthesis as well as inhibition of lipolysis. Since PKB lies downstream of PI3-K, it is intriguing which of these biological processes are also controlled by PKB. This study therefore set out to investigate the role of PKB in the metabolic effects of insulin in rat white adipose tissue. 148 6.1 R E S U L T S A N D DISCUSSION. 6 II DISTRIBUTION OF PROTEIN KINASE BIN RAT TISSUES, Several rat tissues (adipose, muscle, heart, liver, brain and kidney) were screened for the presence of PKB. This was done by Western blotting analysis using an antibody raised against a peptide sequence within the PH-domain of PKBct (anti-PKB-PH). The results (Fig. 27) show the presence of the anticipated 60-kDa PKB band in all tissues tested, with highest expression in heart and liver. A wide distribution of PKB has been reported in mouse tissues (Bellacossa et al, 1991) and rat tissues (Coffer and Woodgett, 1991), by using Northern (RNA) blotting analyses. In these previous studies, highest expression was found in the thymus, brain, heart and lung. The present results confirm these previous reports and extend them by reporting the expression of PKB in rat white adipose tissue. The wide distribution of PKB probably indicates an important role in intracellular signaling. In addition, to the 60-kDa band, other immunoreactive bands (35 and 97 kD in muscle, 30-kDa in heart and 100-kDa in liver) were also apparent (Fig. 27). The identities and/or relationship of these bands to PKB are unknown. However, since the PH-domain is found in a number of proteins, it is conceivable that the antibody might cross-react with some of these proteins if these PH domains also contain the epitope used to raise the antiserum. 149 F I G U R E 27. DISTRIBUTION O F P K B IN R A T TISSUES. Cytosolic fractions (100 ug) from each of the rat tissues fat (F), muscle (M), heart (H), liver (L), brain (B) and kidney (K), were separated on SDS-PAGE gels and electroblotted to Immobilon membrane. Western blotting analysis was performed using an antibody directed towards a peptide within the PH-domain of PKBa. The position of the molecular markers (in kDa) is indicated. M H L B K 200-> 97-> PKB—> 46-> 30-> 14-> 150 6.1.2 ACTIVA TION OF PROTEIN KINASE B BY INSULIN. Rat adipose tissue was incubated with or without insulin and then following tissue homogenization, cytosolic and membrane fractions were prepared. The activity of PKB was determined in two different ways. First, the shift in the mobility of the kinase on SDS-PAGE gels was monitored because this mobility shift is thought to occur as a result of increased incorporation of phosphate into the protein (Kohn et al., 1995; Andjelkovic et al, 1996), probably at Ser-473 and Thr-308 (Alessi et al, 1996). Second, the phosphotransferase activity of immunoprecipitated PKB was determined using MBP as a substrate. In untreated rat adipose tissue, one form of PKB protein (designated a) was apparent on Western blots. Upon insulin stimulation, a new apparently larger, form b appeared (Fig. 28). Form b appeared as early as 2 min following insulin treatment and persisted for the rest of the 20. min incubation with the hormone. Up to three different forms of PKB corresponding to three different phosphorylation states have so far been reported (Andjelkovic et al, 1996) but my results suggest a simpler pattern in rat white adipose tissue. Several reasons may explain the discrepancy of the number of bands observed in this study and that of Andejelkovic et al. Firstly, different tissues or cell lines might contain different PKB isoforms which on stimulation lead to different phosphoryation states. Andjelkovic and coworkers used Swiss 3T3 fibroblasts in their study, while the results in this thesis are from rat white adipose tissue. Also three different PKB isoforms have been reported, but my results suggest a simpler pattern in that only one additional form appeared following stimulation. While the ct-and (3- isoforms have a molecular mass of 60-kDa, the y-isoform is slightly smaller with a molecular mass of 55-kDa (Coffer and Woodgett, 1991; Konishi etal, 1995). Secondly the kinases responsible for these phosphorylations on PKB might be different in various tissues and cell lines. At least two different kinases are thought to phosphorylate Thr-308 and Ser-473 based on the sequence surrounding these residues (Alessi etal, 1996). Moreover, Ser-473 is missing in rat PKBy, indicating a different regulation from the other two isoforms. Finally, the 151 resolution of the various bands may depend on the conditions under which separation by SDS-PAGE is performed. The results presented here indicate that PKB expression in mature rat white adipose tissue may involve one major isoform which undergoes a rather "simple" bandshift to a single higher apparent molecular mass after stimulation. As mentioned above, the bandshift pattern of PKB remained unchanged for the 20 min incubation period (Fig. 28), implying that the activity of PKB remained enhanced. This was indeed confirmed as shown in Fig. 29. To further investigate the kinetics of PKB activation and possible deactivation, an extended time course was performed. Fat pads were incubated in the absence or presence of insulin for up to 3 h. Cytosolic fractions were prepared and the activity of PKB determined. Surprisingly, the bandshift pattern was sustained up to 3 h (Fig. 30). Several conclusions can be drawn from this observation. Firstly, the counter regulatory mechanisms which dephosphorylate and subsequently inactivate PKB had not become evident even at 3 h after initiation of sustained insulin treatment. Secondly, sustained PKB activation may occur as a result of lack of feedback inhibition of the upstream elements which include the insulin receptor, PI3-K and protein kinases responsible for phosphorylation of PKB. The PKB activation observed here with insulin is reminiscent of that seen with the ERKs following treatment of PC 12 cells with NGF, which also leads to a prolonged activation. In contrast, EGF only transiently stimulates the ERKs in PC 12 cells. This phenomenon in PC 12 cells, has been linked to the state of the receptors following agonist stimulation. Unlike the NGF receptor, the EGF is more rapidly downregulated through internalization and phosphorylation (Marshall, 1995). Finally, sustained activation can occur if the kinase translocates to the nucleus to phosphorylate nuclear substrates, including transcription factors. Sustained activation of the ERKs for example, is associated with nuclear translocation and induction of gene expression (Marshall, 1995). So far, there is no evidence to support the translocation of PKB to the nucleus and PKB substrates other than GSK3 and PFK-2 are unknown. In my own studies, persistent activation of cytoplasmic and "membrane-associated" PKB has 152 been demonstrated but we so far have no evidence, strictly, for a translocation phenomenon. PKB activity was also determined using immune complex assays. To this end, PKB was immunoprecipitated using the anti-PKB-PH antibody, followed by in vitro kinase assays using myelin basic protein as a substrate. Insulin caused a 2-fold stimulation of MBP phosphotransferase activity as early as 2 min and this peaked at approximately 3-fold at 15 min (Fig. 29). The temporal increase in MBP phosphotransferase activity corresponded very well with the mobility shift observed on SDS-PAGE gels. Furthemore, the enzymatic activity as well as evidence for mobility shift of PKB of samples from tissue treated with insulin was, also sustained up to 3 h (Fig. 30). It is believed that the stimulation of PKB by growth factors or insulin involves recruitment of the kinase to the membrane and its consequence activation. It should therefore, be possible to detect changes in the amount and/or activity of PKB in the membrane and cytosolic fractions. Particulate fractions were prepared and subjected to Western blotting analysis. Samples were also subjected to immune complex assays in order to determine the MBP phosphotransferase activity. Results (Fig. 30) show an insulin-dependent activation of PKB. Furthermore, insulin induced a prominent activation of the membrane-associated PKB. A 10-fold stimulation of the membrane-associated PKB was achieved, which was substantially greater than that of the cytosolic enzyme. The membrane-associated PKB activity also remained elevated up to 3 h. It is noteworthy that both cytosolic and membrane samples from control tissue contained an amount of deactivated enzyme. This observation indicates that in untreated adipose tissue, inactive PKB enzyme can be found in both the cytosol and the membranes. Also noteworthy are the stringent methods used to wash the immunocomplexes (100 mM NaCl, 3 % NP 40) and to prepare fat cell membranes (density-gradient centrifugation in the presence of Percol as described by Belsham et al. 1980). All these measures were taken to rule out any 153 artifacts and therefore, confirm PKB association with either the immunocomplexes or the membranes. 154 FIGURE 28. INSULIN INCREASES THE APPARENT MOLECULAR WEIGHT OF PKB PROTEIN ON SDS-PAGE GELS. High speed supernatant fractions were prepared following incubation of fat pads in the presence of insulin (87 nM) for the indicated times (0-40 min). Samples (100 ug) of cytosolic proteins were subjected to SDS-PAGE, transferred to Immobilon membrane and PKB detected with the anti-PH domain antibody. The control lane (time = 0) contains form "a" only whereas, the rest of the lanes contain an additional "b" form of the PKB protein. PKB-> 0 2 5 10 15 20 Incubation time with insulin (min) 155 F I G U R E 29. INSULIN P R O M O T E S RAPID A C T I V A T I O N O F P K B IN R A T ADIPOSE TISSUE. Cytosolic homogenates obtained from tissue incubated in the absence or presence of 87 nM insulin were immunoprecipitated with the anti-PKB-PH antibody as described in the Methods section. Immunoprecipitates were used to phosphorylate MBP which was then separated by SDS-PAGE. Phosphorylated MBP bands were isolated and quantified by scintillation counting. Results are the mean ±SEM for 3 independent experiments. o V) o - O CD > o > 3.5 3.0 h 2.5 h 2.0 h ~ 1 . 5 h o 1.0 h , ° 0 .5 h 0.0 0 2 5 10 15 20 icuba t ion t ime with insul in (m in ) 156 FIGURE 30. INSULIN INDUCES SUSTAINED AND PROMINENT ACTIVATION OF MEMBRANE-ASSOCIATED PKB IN RAT WHITE ADDPOSE TISSUE. Fat pads were incubated with insulin for the indicated times in minutes. PKB immunoprecipitates prepared from cytosolic and membrane homogenates were assayed for MBP phosphotransferase activity (A). Separate samples (100 ug) were subjected to immunoblotting analysis with an anti-PKB antibody (B). 12 B. o to D _ Q CD > o O C o o > o o TZ o 10 8 4 2 r-0 c y t o s o l m e m b r a n e 111 0 15 40 60 120 180 Incubat ion t ime with insul in (min) cytosol membrane 0 15 40 60 120 180 0 15 40 60 120 180 <-PKB 157 6.1.3 PHOSPHORYLATION OF ACETYL-COA CARBOXYLASE WITH PKB 1MMIJNOPRECIPITA TES. Acetyl-CoA carboxylase (ACC) represents an important control point in fatty acid biosynthesis. Activation of fatty acid synthesis by insulin is associated with increases in the activity of ACC and in the phosphorylation of the enzyme, at a specific site within a tryptic peptide called the "I-peptide". To investigate whether PKB is involved in the regulation of fatty acid biosynthesis by insulin, the phosphorylation of ACC by PKB immunoprecipitated from extracts of insulin treated tissue was performed. Following SDS-PAGE, gels were analysed by autoradiography, densitometric scanning and phosphoimaging. Results (Fig. 31) indicate that PKB immunoprecipitates contained an ACC-kinase which was apparently enhanced approximately 3-fold following incubation of adipose tissue with insulin. The 265-kDa ACC isoform was preferentially (almost exclusively) phosphorylated by the PKB immunoprecipitates (Fig. 31). This contrasts with PKA which preferentially phosphorylates the 280-kDa ACC isoform. The 265-kDa isoform of ACC contains at least 8 different sites which can be phosphorylated by various protein kinases, therefore analysis of phosphorylated ACC requires peptide analysis, here carried out by 2-dimensional mapping which resolves labelled phosphopeptides of the enzyme after trypsin hydrolysis. Fig. 32 shows a schematic phosphopeptide map of ACC 265 after phosphorylation by various kinases. PKA phosphorylates Ser-77 and Ser-1200 producing tryptic phosphopeptides which migrate at positions A and A*. Similarly, tryptic phosphopeptides obtained after phosphorylation with AMP-activated protein kinase (AMP-PK) migrate at the same positions. The residues phosphorylated by AMP-PK include Ser-79, -1200 and -1215. Other phosphopeptides migrate at positions B and C. The C peptides probably contain serine residues 23, 25, 27 and 34 from the N-terminal end of the enzyme. These residues are phosphorylated to a certain degree even when ACC is isolated from tissue incubated in the absence of 158 hormones including insulin and catecholamines, and have no apparent effect on the enzymatic activity. The residues on the B group of peptides, as well as identity of the kinases which phosphorylate them are unknown. The tryptic phosphopeptide obtained after insulin stimulation migrates at position I. | Fig. 32 shows a tryptic phosphopeptide map of ACC following phosphorylation by PKB immunoprecipitates. One major and three minor phosphopeptides were obtained. The major phosphopeptide accounted for about 70 % of total 3 2 P incorporation (judging from phospho-Images of 2-D maps) and migrated with the A* group of peptides. Two of the minor peptides migrated with A and C group of tryptic phosphopeptides. Qualitatively, the pattern of tryptic phosphopeptide map obtained from autophosphorylated ACC (phosphorylated in the presence of [y-32P] ATP only) closely resembles that obtained in the presence of PKB immunoprecipitates. The striking difference between these two tryptic phosphopeptide maps, is the quantitative enhancement of labelling achieved following incubation with the PKB immunoprecipitates (3-fold or greater). Two conclusions can be drawn from the above results. Firstly, since the phosphopeptide map from autophosphorylated ACC was similar to that obtained from ACC phosphorylated by PKB immunoprecipitates, it is conceivable that the autophosphorylating (endogenous) kinase is the same as the kinase in PKB immunoprecipitates. Secondly, PKB immunoprecipitates may have contained a factor (perhaps itself a protein kinase) which activated the endogenous ACC kinase. PKA was used as a positive control in these experiments and provided an important contrast in that, unlike the PKB immunoprecipitates, PKA preferentially phosphorylated ACC 280 (as expected in previous studies). In addition to the distinct ACC isoform preference, distinct ACC phosphopeptides were obtained with PKA and PKB immunoprecipitates. Thus, tryptic phosphopeptides derived from ACC after phosphorylation with PKA indicates the presence of a unique (ACC-280) phosphopeptide and additional peptides migrating as a smear between and below the A and A* groups. 159 It was also of interest to assess the biological significance of this phosphorylation. Accordingly, ACC was phosphorylated by PKB immunoprecipitates and the enzymatic activity determined by the bicarbonate fixation assay. The results (Table 11) indicate a lack of direct effect of immunoprecipitated PKB on AC@. In contrast, AMP-PK-mediated phosphorylation consistently inhibited the enzymatic activity of ACC. This finding implied that PKB immunoprecipitates were not phosphorylating the AMP-PK sites, especially Ser-79, which is associated with ACC inactivation. This was further supported by the failure of the PKB immunoprecipitates to phosphorylate the "SAMS" peptide (HMRSAMS.GLH), which is modelled on the sequence which contains Ser-79 of the ACC sequence. This peptide is avidly phosphorylated by AMP-PK. Further studies carried out jointly with Dr. Richard Roth (Stanford University) revealed no ACC phosphorylation by purified, recombinant PKB. Taken together, the ACC subunit and phosphopeptide analyses reveal that the kinase present in the PKB immunoprecipitates is clearly not explained by PKA (it does not phosphorylate ACC-280 and is not inhibited by PKI). Further, the PKB immunoprecipitates generated a peptide which migrated very close to that observed with AMP-PK, yet, it cannot be itself because, it did not phosphorylate the SAMS peptide. Attempts to sequence were not completely successful but a partial sequence [-L-I-L-S-E-T-S-I-F-D-V-] suggests a novel ACC-265 site. At least two reasons can account for the lack of effect of the phosphorylation of ACC by PKB immunoprecipitates on the enzymatic activity. First, the I-site on ACC which is associated with insulin-mediated increases in phosphorylation was not phosphorylated. Second, it is conceivable that optimal conditions for phosphorylation and/or reactivating the enzyme in vitro were not met. In addition to covalent modification (phosphorylation and dephosphorylation), the activity of ACC involves complex allosteric regulation. Citrate and fatty acyl-CoA esters are well known activators of the enzyme (Brownsey and Denton, 1987). Phosphorylation of the I-peptide within ACC by an 160 insulin-stimulated fat pad kinase, has been shown to be facilitated by the presence of CoA, an inhibitor of the enzyme (Moule et al, 1992). Furthermore, the activity of ACC is increased by interactions of the enzyme with a protein regulator (Quayle et al, 1993). However, the exact activation mechanisms of the regulator are not yet defined. 161 FIGURE 31. PHOSPHORYLATION OF ACC WITH PKB IMMUNOPRECIPITATES. A C C purified from rat liver was incubated with no added kinase (lane 1) PKA (lane 2) or PKB immunoprecipitates from control (lane 3) or insulin treated tissue (lanes 4, 5, 6). Insulin treatment was of 10 (lane 4), 15 (lane 5) or 40 (lane 6) min in duration. Phosphorylation reactions proceeded for 30 min at 30 C and were terminated by the addition of SDS-sample buffer. Following SDS-PAGE, the phosphoproteins were visualized by autoradiography. The positions of the 280- and 265-kDa isoforms of A C C are indicated by arrows. Details of preparation of PKB immunoprecipitates are given in the Methods section. 1 2 3 4 5 6 <-ACC 280 <-ACC 265 162 FIGURE 32. SCHEMATIC TRYPTIC PHOSPHOPEPTIDE MAP OF ACC. Phosphopeptides from 32P-labelled ACC generated by tryptic digestion and resolved by two-dimensional thin layer mapping produce a 'signature' phosphopeptide map as indicated. The relative mobility of the A, B, C, and I group of peptides are shown. (Adapted from Quayle, 1990.) r- 1 Ser 23 25 27 34 Ser 1200.1215 A Ser 77 79 A ' C C r- 0 B 1.0 Elect rophores is Relative to D N P - L y s i n e 163 F I G U R E 33. TWO-DIMENSIONAL MAPPING O F A C C T R Y P T I C PHOSPHOPEPTIDES F O L L O W I N G P H O S P H O R Y L A T I O N W I T H P K B IMMUNOPRECIPITATES. Purified liver A C C was incubated in the presence of [y- 3 2P]ATP without (B) or with (A) PKB immunoprecipitates (from insulin-treated tissue) for 30 min at 30 °C. Following SDS-PAGE, ACC was digested with trypsin and subjected to two-dimensional mapping with high voltage electrophoresis in the first dimension and ascending chromatography (TLC) in the second dimension. The autoradiographs show the migration of the A C C tryptic phosphopeptides. The origin (O) as well as the A-peptides (A) are indicated. A. B. A o 164 TABLE 11. EFFECT OF PHOSPHORYLATION ON THE ENZYMATIC ACTrVTTY OF ACC. The activity of ACC purified from rat liver, was tested following incubation with the indicated protein kinase. ACC was first incubated for 30 min at 30 °C, with the protein kinase preparations in the presence of Mg2+-ATP. Subsequently, ACC was separated from the PKB immunoprecipitates by centrifugation and further incubated with 1 mM or 10 mM citrate to induce enzyme activation prior to assay by incorporation of [14C] from bicarbonate into malonyl-CoA. The activity of ACC is expressed relative to no added kinase control with 10 mM citrate typically 1.0-1.5 Units/mg purified ACC. Results are a average of two independent experiments. ADDED PROTEIN KINASE ACC ACTIVITY 1mM citrate 10 mM citrate None 11 100 PKB-IP (-) insulin 14 109 PKB-IP (+) insulin 12 107 AMP-PK <1 9 PKA 14 100 165 6.1.4 ACTIVATION OF PKB WITH VANADIUM MIMICS INSULIN ACTION. A direct way of establishing whether PKB is required in the metabolic effects of insulin would require the use of a specific PKB inhibitor. Because of the lack of such a compound, vanadium an insulin mimetic, was used as a tool to probe the role of PKB in some of the metabolic effects of insulin. A variety of systems have so far been used to examine the insulin-like effects of vanadium (reviewed by Shechter, 1990). The insulin-like effects of vanadium include stimulation of glucose uptake (Dubyak and Kleinzeller, 1980), glycogen synthesis (Tamura et al, 1983), lipogenesis, glucose oxidation and inhibition of lipolysis (Duckworth et al., 1988). Because vanadium mimics a number of the effects of insulin on adipose tissue metabolism, I set out to establish if vanadium might act through a PKB-mediated mechanism. Fat pads were treated with vanadyl sulfate and the activity of PKB was assessed by measuring the activity of immunoprecipitated enzyme as well as bandshift analysis on SDS-PAGE gels. Vanadyl sulfate stimulated the activity of PKB in a dose-dependent manner (Fig. 34A). The maximum effect was approximately 3-fold and occurred at a concentration of 1 mM vanadyl sulfate. This was similar to the activation obtained using 87 nM insulin (3.5-fold). Again, the emergence of the slower migrating PKB band on SDS-PAGE gels corresponded very well with the activity of the enzyme as judged by MBP phosphorylation (Fig. 34). Thus, both vanadyl sulfate and insulin appear to activate PKB through a common mechanism, since they both induce similar electrophoretic mobility changes of the enzyme. This differs from the activation of the enzyme by isoproterenol and heat shock which occurs without any changes in the electrophoretic mobility of the kinase (Moule et al, 1997; Konishi et al, 1996; Matsuzaki et al, 1996). 166 F I G U R E 34. V A N A D I U M S T I M U L A T E S P K B IN R A T A D I P O C Y T E S . Fat pads were incubated in Krebs-Henseleit buffer for 1 h with no further additions (c), or in the presence of vanadium (numerical values indicate p M concentration of vanadyl sulfate), or 87 nM insulin (ins). Immunoprecipitated PKB from cytosolic homogenates was assayed for MBP phosphotransferase activity (A). B, cytosolic homogenates (100 pg) were also subjected to Western blotting analysis using an anti-PKB antibody. A . 4.0 , , c 5 25 50 100 5 0 0 1000 ins B. T rea tment c 5 25 50 100 500 1000 ins 167 6.1.5 ACTTVA TION OF GLYCOGEN SYNTHASE AND PKB BY VANADIUM. A cardinal metabolic response of white adipose tissue to insulin, is the stimulation of glycogen synthesis. The activations of PKB and glycogen synthase were compared by examining the dose-dependent effects of vanadium on the activities of the two enzymes. Incubation of fat pads with vanadyl sulfate enhanced glycogen synthase activity in a dose dependent manner (Fig. 35). The maximal response of a 3.5-fold activation was achieved using 1 mM vanadyl sulfate in the extracellular medium. This maximum activation was similar to that obtained with 87 nM insulin and the dose-dependency matched very well with that for activation of PKB (Fig. 34). Addition of insulin and vanadyl sulfate together, failed to provoke an additive increase in glycogen synthase activity, indicating that the two stimuli may activate this enzyme by a common mechanism. These two main observations, namely, the common dose-dependency for vanadium-induced activation of PKB and glycogen synthase (and fatty acid synthesis) together with a lack of additive effect of vanadyl sulfate and insulin support a role of PKB in the regulation of glycogen synthesis. These observations however, are still not definitive and further studies are required to assess the exact role of PKB in these metabolic responses of insulin. Such studies would probably involve the use of PKB inhibitors which are unavailable at this time. 168 FIGURE 35. ACTIVATION OF GLYCOGEN SYNTHASE BY VANADIUM. Fat pads were incubated in Krebs-Henseleit buffer for 1 h with no further additions (c), in the presence of vanadium (numerical values indicate pM vanadyl sulfate), 87 nM insulin (ins) or insulin in combination with 100 pM vanadyl sulfate. The activity of glycogen synthase in the cytosolic homogenates was determined. Results illustrate the glycogen synthase activity ratio (-/+ glucose-6-phosphate). Results are shown as means +S.E.M. (n=3). o "D 5.0 4 .5 |-4 .0 3 .5 -o 3 .0 -o T 2 .5 -2 .0 1.5 h 1.0 0 .5 0 .0 c 5 2 5 50 100 5 0 0 1000 i n s i n s / v s T rea tment 169 6.1.6 ANTI-LIPOLYTIC EFFECTS OF VANADIUM AND THE ACTIVITY OF PKB. In addition to the regulation of fatty acid and glycogen biosynthesis, insulin also activates the pathway that leads to the inhibition of lipolysis in adipose tissue. Therefore, studies were initiated to assess the role of PKB in the counter-regulation of lipolysis. Both vanadium and insulin inhibited isoproterenol-induced lipolysis in isolated fat cells as shown in Fig. 36. Inhibition with vanadium was apparent at 5 pM (approximately 20 % inhibition) and peaked at approximately 75 % inhibition with 100 pM vanadyl sulfate in the incubation medium. The inhibition was further enhanced to 80 % by increasing the vanadyl sulfate concentration to 0.5 mM. However, no further enhancement was obtained by increasing the concentration of vanadyl sulfate to 1 mM. In these experiments 50 pM vanadyl sulfate gave approximately a similar inhibition as was evident with 87 nM insulin. These results are in general agreement with those of Brownsey and Dong, (1995). The anti-lipolytic effects of insulin are known to be sensitive to wortmannin (Okada et al., 1994; Rahn et al., 1994), indicating the involvement of PI3-K. Based also on wortmannin inhibition studies, it has been concluded that the activation of PKB by insulin and growth factors proceeds in a PI3-K dependent manner. Although PI3-K is common to both the activation of PKB and the inhibition of lipolysis by insulin, it is unclear yet whether PKB is involved in this metabolic effect of the hormone. However, based on the finding that both insulin and isoproterenol (two hormones with opposing effects on lipolysis) activate PKB, albeit by different mechanisms, makes it highly unlikely that the kinase is required for counter-regulation of lipolysis. In the present studies, inhibition of lipolysis by vanadium occurred at concentrations of vanadyl sulfate (<100 pM) that were below the threshold required to stimulate PKB. This result demonstrates that PKB is not required for the antilipolytic effects of vanadium. Because insulin and vanadyl sulfate may inhibit lipolysis by different 170 mechanisms, the question whether PKB plays a role in the anti-lipolytic effects of insulin remains unanswered. 171 F I G U R E 36. ANTI-LIPOLYTIC E F F E C T S O F V A N A D I U M . Adipocytes were incubated in Krebs-Henseleit buffer with no further additions (c), in the presence of 5 nM isoproterenol (iso), isoproterenol plus vanadium (numerical values indicate uM concentration of vanadyl sulfate added) or isoproterenol plus insulin (ins). Lipolysis was measured as glycerol released to the medium during a 30 min incubation period. The glycerol output is expressed relative to isoproterenol alone (100 %). Absolute rates of lipolysis determined in control and isoproterenol-treated cells were 0.6 and 7.8 umole/h/g, respectively. All results represent mean determinations +SEM (n= 3). Treatment with insulin or vanadium (5 uM or higher) all gave significant inhibition of isoproterenol-induced lipolysis. 120 c iso 5 25 50 100 5 0 0 1 0 0 0 ins Trea tment 172 6.2 S U M M A R Y Insulin provoked a rapid and sustained activation of PKB in rat white adipose tissue. A membrane-associated fraction of PKB responded with a far greater fold-activation to insulin than the enzyme recovered in the cytoplasm. The activation of PKB was accompanied by a change in the mobility of the protein on SDS-PAGE gels. This band-shift in response to insulin (or growth factors), is thought to occur as a result of increases in the phosphorylation state of the protein. The PKB immunoprecipitates phosphorylated ACC, specifically the 265-kDa subunit. At least 70 % of 3 2 P incorporated into ACC was recovered in a single tryptic phosphopeptide. This peptide which is distinct from the ACC peptide observed following incubation of intact cells with insulin, comigrated with that obtained following phosphorylation of ACC with AMP-PK or PKA. Phosphorylation of ACC by PKB immunoprecipitates did not directly affect the maximal activity or sensitivity of ACC to citrate, indicating that the AMP-PK sites, which are associated with inactivation, were not being phosphorylated. This was further supported by the failure of PKB immunoprecipitates to phosphorylate the SAMS peptide, an excellent substrate for AMP-PK. Several hypotheses can be postulated to assess the significance of this phosphorylation of ACC with PKB immunoprecipitates. First, the phosphorylation could have been an in vitro artifact, with no really physiological relevance. Second, the phosphorylation of ACC probably plays a feedback regulatory role (though not directly inhibitory). This may occur if phosphorylated ACC becomes less sensitive to allosteric activators. Finally, the phosphorylation may mediate activation of ACC in combination with allosteric factors. A role of PKB in the regulation of glycogen synthesis has been suggested and remains attractive. In line with previous studies, the activation of PKB in rat adipose tissue was found to correlate with that of glycogen synthase. This was demonstrated by the use of vanadium. Concentrations of vanadyl sulfate required to activate PKB were also found to stimulate glycogen synthesis. 173 In contrast, the inhibition of lipolysis by vanadyl sulfate occurred below the threshold required to activate PKB. It is therefore, concluded that PKB is not required for the counter-regulation of lipolysis by vanadium. Whether, PKB is necessary for the inhibition of lipolysis by insulin is not clear. However, the finding that both isoproterenol and insulin stimulate the kinase, makes involvement of PKB highly unlikely. The use of vanadium has highlighted a potential important distinction between different metabolic responses of glycogen synthase activation and inhibition of lipolysis. 174 CHAPTER SEVEN CONCLUSIONS The stimulation of lipogenesis by insulin is effected at several steps including acetyl-CoA carboxylase (ACC), which contributes importantly to overall flux control in fatty acid biosynthesis. Increases in ACC activity are associated with phosphorylation of the enzyme at a site within a tryptic peptide termed the "I-peptide" and low levels of phosphorylation of inhibitory sites which are targets of PKA and AMP-PK. The identity of this insulin-stimulated ACC I-peptide kinase remains elusive. Initial studies led to the hypothesis that an adipose tissue MBP kinase might serve as the insulin-activated ACC-kinase and my work focussed on purification of this MBP kinase initially. Based on a number of properties including its size (44-kDa), its cross-reactivity with anti-MAP kinase antibodies, substrate and modulation sensitivities, the MBP kinase can be regarded as a member of the MAP kinase family. This conclusion was further supported by the fact that the fat cell MBP kinase was recognized by anti-phospho ERK antibodies and also contained phosphotyrosine as shown by immunoblotting with the anti-phosphotyrosine antibody, 4G10. The amount of phosphotyrosine increased upon autophosphorylation but was apparently not associated with major changes in activity, implying that other mechanisms exist for the activation of the MBP kinase. This was confirmed when an inactive fat cell MBP kinase sample was reactivated by a consitutively active form of MEK 1. In line with other MAP kinases, the active MBP kinase was deactivated by the phosphotyrosine phosphatase PTP-1B. Finally, the MBP kinase was found to be proline-directed, that is, it recognized the Pro-x-Ser/Thr-Pro motif contained in a synthetic peptide based on the site in MBP that is phosphorylated by MAP kinases. The 44-kDa MBP kinase purified from rat adipose tissue did not phosphorylate ACC, and is therefore not the insulin-sensitive ACC-kinase. 175 Attempts to confirm the identity of the fat-purified MBP kinase failed because the preparations were contaminated with actin. The continual presence of actin, in spite of all the efforts to remove it, led to the proposal that a specific interaction existed between actin and the MBP kinase. Size exclusion chromatography was performed in the absence or presence of phalloidin to enhance the formation of high molecular actin (microfilaments) and to examine the proteins which displayed a "molecular weight shift". Indeed, the MBP kinase did display a molecular shift together with actin. Because of the specificity of phalloidin for actin microfilaments, it is concluded that the MBP kinase has a specific association with actin filaments. Further support for this association was obtained from co-immunoprecipitation experiments. Anti-actin antibody preparations also co-precipitated the MBP kinase and conversely, the anti-MAP kinase antibody precipitated actin. Finally, immunofluorescence analysis of intact, cultured NTH 3 T 3 cells indicated co-localization of the MBP kinase with actin microfilaments. Association of the MAP kinase with the cytoskeleton may provide a means of targeting the kinase to a particular location. i This would ensure that the catalytic activity remains in close proximity with the correct substrates thus providing speed and efficiency in signaling as well as restricting potential cross-talk between pathways. Alternatively, the cytoskeleton may play a regulatory role by sequestering the enzyme. During the course of my studies, several experimental approaches provided evidence against a metabolic role for the MAP kinases and so I sought approaches to test the role of MAP kinases in the overall regulation of fatty acid biosynthesis. To this end, I examined the relationships between extracellular osmolarity, MAP kinases and insulin activation because changes in extracellular osmolarity had been demonstrated to affect the MAP kinases and also to affect hepatocyte metabolism. Unlike the studies with hepatocytes, changes in extracellular osmolarity alone did not elicit any stimulation of fatty acid biosynthesis in rat white adipose tissue. The activation of the ERKs differed from that of fatty acid biosynthesis in that hypo-osmotic medium alone activated the ERKs, while 176 hyper-osmotic medium abolished the stimulation of the ERKs by insulin. The activation of the ERKs was therefore, not correlated with that ofjfatty acid biosynthesis. The effect of insulin on JNKs has been debated with divergent results in the literature. In my studies with freshly isolated mature adipose tissue, a clear and dominant activation of JNKs with insulin was observed. Unlike fatty acid synthesis, JNKs were activated by changes in osmolarity. Again, the activation of these kinases did not correlate exactly with the stimulation of fatty acid biosynthesis. In contrast to JNKs an alternative "stress" response, the p38 pathway, showed essentially no response to insulin and became activated only at very high extracellular osmolarity. Taken together, the observations described above provide support for the argument that the metabolic responses of adipose cells to insulin cannot be adequately explained by activation of any one of the established MAP kinase signaling pathways. The possibility that a specific JNK isoform might mediate ACC activation is however still feasible. PKB is a newly discovered insulin-sensitive enzyme which lies downstream of PI-3 kinase, an enzyme which has been implicated in some of the metabolic effects of insulin. It was therefore, intriguing to find out which of these effects are also regulated by PKB. Insulin induced a rapid and sustained activation of PKB in rat adipose tissue. Prominent activation occured with a membrane-associated PKB. PKB immunoprecipitates phosphorylated the 265 isoform of ACC at a site distinct from that observed following insulin stimulation. The phosphorylated site also differed from those affected by well characterized ACC kinases including PKA, AMP-PK and casein kinases. Phosphorylation of ACC did not lead to any changes in enzymatic activity, indicating that PKB is not the insulin-stimulated ACC kinase. Vanadium, an insulin mimetic, also stimulated PKB in rat adipose tissue. The stimulation of PKB by vanadium correlated with the activation of glycogen synthesis but could be dissociated from that of the pathway leading to the inhibition of lipolysis. PKB may be necessary for the stimulation of glycogen synthesis. It is, however, not required for 177 the stimulation of ACC in response to insulin. Finally, it is not required for the anti-lipolytic effects of vanadium. A possible future avenue leading to the identification of the ACC I site-kinase would probably need to isolate the I-peptide first. This would then be used as a substrate to screen for protein kinases. 178 REFERENCES. Abraham, R.T. and Wiederrecht, G.J. (1996): Immunopharmacology of rapamycin. Annual Review of Immunology 14:483-510. Alessandrini, A., Crews, CM. and Erikson, R.L. (1992): Phorbol ester stimulates a protein-tyrosine/threonine kinase that phosphorylates and activates the Erk-1 gene product. Proc. Natl. Acad. Sci. USA 89:8200-8204. Alessi, D.R., Caudwell, F.B., Andjelkovic, M., Hemmings, BA. and Cohen, P. (1996): Molecular basis for the substrate specificity of protein kinase B; comparison with MAPKAP kinase-1 and p70 S6 kinase. FEBS LETTERS 399:333-338. Alessi, D.R., James, SR., Downes, CP., Holmes, A.B., Gaffney, P.R.J., Reese, CB. and Cohen, P. (1997): Characterization of a 3-phosphoinositide-dependent protein kinase which phosphorylates and activates protein kinase Ba. Current Biology 7:261-269. Alexander, M.C, Kowaloff, E.M., Witters, L.A., Dennihy, D.T. and Avruch, J. (1979): Purification of a hepatic 123,000-dalton hormone stimulated 32P-peptide and its identification as ATP-citrate lyase. The Journal of Biological Chemistry 254:8052-8056. Alvarez, E., Northwood, I.C, Gonzalez, F.A., Latour, D.A., Seth, A., Abate, C , Curran, T. and Davis, R.J. (1991): Pro-Leu-Ser/Thr-Pro is a consensus primary sequence for substrate protein phosphorylation. The Journal of Biological Chemistry 266:15277-15285. Ammerer, G. (1994): Sex, stress and integrity: the importance of MAP kinases in yeast. Current Opinion in Genetics and Development 4:90-95. Anderson, N.G., Mailer, J.L., Tonks, N.K. and Sturgill, T.W. (1990): Requirement for integration of signals from two distinct phosphorylation pathways for activation of MAP kinase. Nature 343:651-653. Andjelkovic, M., Jakubowicz, T., Cron, P., Ming, X.-F. and Han J.-W. (1996): Activation and phosphorylation of a pleckstrin homology domain containing protein kinase (RAC-PK/PKB) promoted by serum and protein phosphatase inhibitors. Proc. Natl. Acad. Sci. USA 93:5699-5704. Angel, P., Hattori, K., Smeal, T. and Karin, M. (1988): The Jun proto-oncogene is positively autoregulated by its product, Jun/AP-1. Cell 55:875-885. 179 Araki, E., Lipes, M.A., Patti, M-E., Bruening, J C , Haag III, B., Johnson, R.S. and Kahn, C.R. (1994): Alternative pathway of insulin signalling in mice with targeted disruption of the IRS-1 gene. Nature 372:186-190. Arnold, H. and Pette, D. (1970). Binding of aldolase and triosephosphate dehydrogenase to F-actin and modification of catalytic properties of aldolase. European Journal of Biochemistry 15:360-366. Auger, K.R., Serunian, L.A., Soltoff, S.P., Libby, P. and Cantley, L.C. (1989): PDGF-dependent tyrosine phosphorylation stimulates production of novel polyphosphoinositides in intact cells. Cell 57:167-175. Backer, J.M., Myers, M.G.Jr., Shoelson, S.E. Chin, D.J., Sun, X-J, Miralpeix, M., Hu, P., Margolis, B., Skolnik, Y., Schlessinger, J. and White, MF. (1992): The phosphatidylinositol 3-kinase is activated by association with IRS-1 during insulin stimulation. The EMBO Journal 11:3469-3479. Bardwell, L. and Thorner, J. (1996): A conserved motif at the amino termini of MEKs might mediate high-affinity interaction with the cognate MAPKs. Trends in Biochemical Sciences 21:373-374. Baserga, R. (1990): The cell cycle: myths and realities. Cancer Research 50:6769-6771. Beals, C.R., Sheridan, CM., Turck, C.W., Gardner, P. and Crabtree, G.R. (1997): nuclear export of NF-ATc enhanced by glycogen synthase kinase-3. Science 275:1930-1933. Bedoya, F.J., Matschinksy, F.M., Shimizu, T., O'Neill, J.J. and Appel, M.C. (1986): Differential regulation of glucokinase activity in pancreatic islets and liver of the rat. The Journal of Biological Chemistry 261:10760-10764. Bell, G.I., Burant, C.F., Takeda, J. and Gould, G.W (1993): Structure and function of mammalian facilitative sugar transporters. The Journal of Biological Chemistry 268:19161-19164. Belsham, G.J. Brownsey, R.W. and Denton, R.M. (1982): Reversibility of the insulin-stimulated phosphorylation of ATP citrate lyase and a cytoplasmic protein of subunit ML 22 000 in adipose tissue. Biochemical Journal 204:345-352. Belsham, G.J., Denton, R.M. and Tanner, M.J.A. (1980): Use of a novel rapid preparation of fat-cell plasma membranes employing Percoll to investigate the effects of insulin and adrenaline on membrane protein phosphorylation within intact fat-cells. Biochemical Journal 192:457-467. 180 Bellacosa, A., Testa, J.R., Staal, SP. and Tsichlis, P.N. (1991): A retroviral oncogene, akt, encoding a serine-threonine kinase containing an SH2-like region. Science 254:274-277. * Belsham, GJ. and Denton, R.M. (1980): The effect of insulin and adrenaline on the phosphorylation of a 22,000-molecular weight protein within isolated fat cells; possible identification as the inhibitor-1 of the 'general phosphatase'. Biochem. Soc. Trans. 8:382:383. Belsham, G.J., Brownsey, R.W., Hughes, W.A. and Denton, R.M. (1980): Anti-insulin receptor antibodies mimic the effects of insulin on the activities of pyruvate dehydrogenase and acetyl-CoA carboxylase and on specific protein phosphorylation in rat epididymal fat cells. Diabetologia 18:307-312. Blackshear, P.J., Haupt, D.M., App, H. and Rapp, U.R. (1990): Insulin activates the Raf-1 protein kinase. The Journal of Biological Chemistry 265:12131-12134. Blank, J.L., Gerwins, P., Elliott, E.M., Sather, S. and Johnson, G.L. (1996): Molecular cloning of mitogen-activated protein/ERK kinase kinases (MEKK) 2 and 3. The Journal of Biological Chemistry 271:5361-5368. Blikstad, I., Markey, F., Carlsson, L., Persson, T. and Lindberg, U. (1978): Selective assay of monomeric and filamentous actin in cell extracts, using inhibition of deoxyribonuclease I. Cell 15:935-943. Boni-Schnetzler, M., Sott, W., Waugh, S.M., DiBella, E. and Pilch, P.F. (1987): The insulin receptor. Structural basis for high affinity ligand binding. The Journal of Biological Chemistry 262:8395-8401. Borthwick, A.C., Edgell, N.J. and Denton, R.M. (1990): Protein-serine kinase from rat epididymal adipose tissue which phosphorylates and activates acetyl-CoA carboxylase- possible role in insulin action. Biochemical Journal 270:795-801. Borthwick, A.C., Wells, A.M., Rochford, J.J., Hurel, S.J., Turnbull, D.M. and Yeaman, S.J. (1995): Inhibition of glycogen synthase kinase-3 by insulin in cultured human skeletal muscle myoblasts. Biochemical and Biophysical Research Communications 210:738-745. " Boulton, T.G., Gregory, J.S., and Cobb, M.H. (1991): Purification and properties of extracellular signal-regulated kinase 1, an insulin-stimulated microtubule-associated protein 2 kinase. Biochemistry 30:278-286. Bradford, M.M. (1976): A rapid and sensitive method for the quantitation of microgram quantities of protein utilizing the principle of protein-dye binding. Analytical Biochemistry 72:248-254. 181 Brewster, J.L., de Valoir, T., Dwyer, N.D., Winter, E. and Gustin, M.C. (1993): An osmosensing signal transduction pathway in yeast. Science 259:1760-1763. Brown, E.J., Beal, P.A., Keith, C.T., Chen, I, Shin, TB. and Schreiber, S.L. (1995): Control of p70 S6 kinase by kinase activity of FRAP in vivo. Nature 377:441-445. Brownsey, R.W. and Denton, R.M. (1982): Evidence that insulin activates fat cell acetyl-CoA carboxylase by increased phosphorylation at a specific site. Biochemical Brownsey, R.W. and Denton, R.M. (1987): Acetyl CoA-carboxylase. In The Enzymes, 3rd edition, vol. 18, pp. 123-146. Brownsey, R.W. and Dong, GW. (1995): Evidence for selective effects of vanadium on adipose cell metabolism involving actions on cAMP-dependent protein kinase. Molecular and Cellular Biochemistry 153:131-137. Brownsey, R.W., Hughes, W.A., Denton, R.M. and Mayer, RJ. (1977): Demonstration of the phosphorylation of acetyl-CoA carboxylase within intact rat epididymal fat cells. Biochemical Journal 168:441-445. Brunn, G.J., Williams, J., Sabers, C, Wiederrecht, G., Lawrence, J.C. Jr. and Abraham, R.T. (1996): Direct inhibition of the signaling functions of the mammalian target of rapamycin by the phosphoinositide 3-kinase inhibitors, wortmannin and LY294002. The EMBO Journal 15:5256-5267. Burgering, B.M.T. and Coffer, P.J. (1995): Protein:kinase B (c-akt) in phosphatidylinositol-3-OH kinase signal transduction. Nature 376:599-602. Burgering, B.M.T., Pronk, G.J., van Weeren, P C , Chardin, P. and Bos, J.L. (1993): cAMP antagonizes p21ras-directed activation of extracellular signal-regulated kinase 2 and phosphorylation of mSos nucleotide exchange factor. The EMBO Journal 12:4211-4220. Cain, C C , Trimble, W.S. and Lienhard, GE. (1992): Members of the VAMP family of synaptic vesicle proteins are components of glucose transporter-containing vesicles from rat adipocytes. The Journal of Biological Chemistry 267:11681-Caro, J.F., Sinha, M.K., Raju, S.M., Ittoop, 0 . , Pories, W.J., Flickinger, E.G., Meelheim, D. and Dohm, G.L. (1987). Insulin receptor kinase in human skeletal muscle from obese subjects with and without noninsulin dependent diabetes. The Journal of Clinical Investigation 79:1330-1337. Journal. 202:77-86. 11684. 182 Carraway, C.A.C. and Weis, M. (1985): Phalloidin shift on velocity sedimentation sucrose gradient centrifugation for identification of microfilament-associated proteins. Experimental Cell Research 161:150-160. Carter, W.G., Sullivan, A.C., Asamoah, K.A. and Sale, G.J. (1996): Purification and Characterization of an insulin-stimulated insulin receptor serine kinase. Biochemistry 35:14340-14351. Chang, P-Y., Marchand-Brustel, Y.L., Cheatham, L.A. and Moller, D.E. (1995): Insulin stimulation of mitogen-activated protein kinase, p90rsk, and p70 S6 kinase in skeletal muscle of normal and insulin-resistant mice. The Journal of Biological Chemistry 270:29928-29935. Cheatham, B. and Kahn, CR. (1995): Insulin action and the insulin signaling network. Endocrine Reviews 16:117-142. Cheatham, B., Vlahos, C.J., Cheatham, L., Wang, L., Blenis, J. and Kahn, CR. (1994): Phosphatidylinositol 3-kinase activation is required for insulin stimulation of pp70 S6 kinase, DNA synthesis, and glucose transporter translocation. Molecular and Cellular Biology 14:4902-4911. Chen, R-H., Abate, C. and Blenis, J. (1993): Phosphorylation of the c-Fos transrepression domain by mitogen-activated protein kinase and 90-kDa ribosomal S6 kinase. Proc. Natl. Acad. Sci. USA 90:10952-10956. Chen, Y-H., Pouyssegur, J., Courtneidge, S.A. and Van Obberghen-Schilling, E. (1994): Activation of src family kinase activity by the G protein-coupled thrombin receptor in growth-responsive fibroblasts. The Journal of Biological Chemistry 269:27372-27377. Cheng, M., Boulton, T.G. and Cobb, M.H. (1996): ERK3 is a constitutively nuclear protein kinase. The Journal of Biological Chemistry 271:8951-8958. Cheng, M., Zhen, E., Robinson, M.J., Ebert, D., Goldsmith, E. and Cobb, M.H. (1996a): Characterization of a protein kinase that phosphorylates serine 189 of the mitogen-activated protein kinase homolog ERK3. The Journal of Biological Chemistry 271:12057-12062. Cherniack, A.D., Klarlund, J.K. and Czech, M.P. (1994): Phosphorylation of the Ras nucleotide exchange factor son of sevenless by mitogen-activated protein kinase.The Journal of Biological Chemistry 269:4717-4720. Childs, T.J. and Mak, A.S. (1993): MAP kinases from bovine brain: purification and characterization. Biochemistry and Cell Biology 71:544-555. 183 Childs, T.J. and Mak, A.S. (1993a): Smooth-muscle mitogen-activated protein (MAP) kinase: purification and characterization, and the phosphorylation of caldesmon. Biochemical Journal 296:745-751. Chin, J.E., Dickens, M., Tavare, J.M. and Roth, R.A. (1993): Overexpression of protein kinase C isoenzymes a, pi, y and e in cells overexpressing the insulin receptor. Effects on receptor phosphorylation and signaling. The Journal of Biological Chemistry 268:6338-6347. Choi, K-Y, Satterberg, B., Lyons, DM. and Elion, E.A. (1994): Ste5 tethers multiple protein kinases in the MAP kinase cascade required for mating in S. cerevisiae. Cell 78:499-512. Chou, M.M. and Blenis, J. (1995): The 70 kDa S6 kinase: regulation of a kinase with multiple roles in mitogenic signalling. Current Opinion in Cell Biology 7:806-814. Chou, C.K., Dull, T.J., Russell, D.S., Gherzi, R., Lebwohl, D., Ullrich, A. and Rosen, O.M. (1987): Human insulin receptors mutated at the ATP-binding site lack protein tyrosine kinase activity and fail to mediate postreceptor effects of insulin. The Journal of Biological Chemistry 262:1842-1847. Choi, J., Chen, J., Schreiber, S.L. and Clardy, J. (1996): Structure of the FKBP12-rapamycin complex interacting with the binding domain of human FRAP. Science 273:239-242. Clark-Lewis, I., Sanghera, J.S. and Pelech, S.L. (1991): Definition of a consensus sequence for peptide substrate recognition by p44mPk, the meiosis-activated myelin basic protein kinase. The Journal of Biological Chemistry 266:15180-15184. Clarke, J.F., Young, P.W., Yonezawa, K., Kasuga, M. and Holman, G.D. (1994): Inhibition of the translocation of GLUT 1 and GLUT4 in 3T3-L1 cells by the phosphatidylinositol 3-kinase inhibitor, wortmannin. Biochemical Journal 300:631-635. Cobb, M.H. (1986):An insulin-stimulated ribosomal protein S6 kinase in 3T3-L1 cells. The Journal of Biological Chemistry 261:12994-12999. Cobb, M.H. and Goldsmith, E.J. (1995): How MAP kinases are regulated. The Journal of Biological Chemistry 270:14843-14846. Coffer, P.J. and Woodgett, J.R. (1991): Molecular cloning and characterization of a novel putative protein-serine kinase related to the cAMP-dependent and protein kinase C families. European Journal of Biochemistry 201:475-481. 184 Cohen, P. (1987): Role of multisite phosphorylation in the hormonal control of glycogen synthase from mammalian muscle. In The enzymes, vol.18 (ed.E.G. Krebs and P.D. Boyer), pp.462-499. Cohen, P., Holmes, C.F.B. and Tsukitani, Y. (1990): Okadaic acid: a new probe for the study of cellular regulation. Trends in Biochemistry 15:98-102. Cohen, P. (1993): Dissection of the protein phosphorylation cascades involved in insulin and growth factor action. Biochemical Society Transactions 21:555-567. Coso, O.A., Chiariello, M., Yu, J.-C, Teramoto, H., Crespo, P., Xu, N., Miki, T. and Gutkind, J.S. (1995): The small GTP-binding proteins Racl and Cdc42 regulate the activity of the JNK/SAPK signaling pathway. Cell 81:1137-1146. Crespo, P., Cachero, T.G., Xu, N. and Gutkind, J.S. (1994): Dual effect of p-adrenergic receptors on mitogen-activated protein kinase. Evidence for a Py-dependent activation and a Gas-cAMP-mediated inhibition. The Journal of Biological Chemistry 270:25259-25265. i Cross, D.A.E., Alessi, D.R., Cohen, P., Andjelkovich, M. and Hemmings, B.A. (1995): Inhibition of glycogen synthase kinase-3 by insulin mediated by protein kinase B. Nature 378:785-789. Cross, D.A.E., Alessi, D.R., Vandenheede, J.R., McDowell, H.E., Hundal, H.S. and Cohen, P. (1994): The inhibition of glycogen synthase kinase-3 by insulin or insulin-like growth factor 1 in rat skeletal muscle cell line L6 is blocked by wortmannin, but not by rapamycin:evidence that wortmannin blocks activation of the mitogen-activated protein kinase pathway in L6 cells between ras and raf. Biochemical Journal 303: 21-26. Csermely, P., Schnaider, T., Cheatham, B., Olson, M.O.J, and Kahn, CR. (1993): Insulin induces the phosphorylation of nucleolin. A possible mechanism of insulin-induced RNA efflux from nuclei. The Journal of Biological Chemistry 268:9747-9752. Cuatrecasas, P. (1972): Affinity chromatography and purification of the insulin receptor of liver cell membranes. Proc. Natl. Acad. Sci. USA 69:1277-1281. Cushman, S.W. and Wardzala, L.J. (1980): Protein mechanism of insulin action on glucose transport in the isolated rat adipose cell. Apparent translocation of intracellular transport systems to the plasma membrane. The Journal of Biological Chemistry 255:4758-4762. 185 | Czech, M.P., Klarlund, J.K., Yagaloff, K.A., Bradford, A.P. and Lewis, RE. (1988): Insulin receptor signalling: activation of multiple serine kinases. The Journal of Biological Chemistry 263:11017-11020. Datta, K., Franke, T.F., Chan, T.O., Makris, A., Yang, S-I., Kaplan, D.R., Morrison, D.K., Golemis, E.A. and Tsichlis, P.N. (1995): AH/PH domain-mediated interaction between Akt molecules and its potential role in Akt regulation.Molecular and Cellular Biology 15:2304-2310. Daum, G., Eisenmann-Tappe, I., Fries, H.-W., Troppmair, J. and Rapp, U.R. (1994): The ins and outs of Raf kinases. Trends in Biochemical Sciences 19:474-479. Davenport, K.R., Sohaskey, M., Kamada, Y., Levin, DE. and Gustin, M.C. (1995): A second osmosensing signal transduction pathway in yeast. Hypotonic shock activates the PKC1 protein kinase-regulated cell integrity pathway. The Journal of Biological Chemistry 270:30157-30161. Davis, R.J. (1994): MAPKs: new JNK expands the group. Trends in Biochemical Sciences 19:470-458. Davies, S.P., Alastair, T.R.S. and Hardie, G. (1990): Location and function of three sites phosphorylated on rat acetyl-CoA carboxylase by the AMP-activated protein kinase. European Journal of Biochemistry 187:183-190. De Meyts, P. (1994): The structural basis of insulin and insulin-like growth factor-1 receptor binding and negative co-operativity, and its relevance to mitogenic versus metabolic signalling. Diabetologia 37.5135-5148. De Meyts, P., Gu, J-L., Shymko, R.M., Kaplan, B.E., Bell, G.I. and Whittaker, J. (1990). Identification of a ligand-binding region of the human insulin receptor encoded by the second exon of the gene. Molecular Endocrinology 4:409-416. Deng, T. and Karin, M. (1993): JunB differs from c-Jun in its DNA-binding and dimerization domains, and represses c-Jun by formation of inactive heterodimers. Genes and Development 7:479-490. Dent, P., Lavoinne, A., Nakielny, S., Caudwell, F.B., Watt, P. and Cohen, P. (1990): The molecular mechanism by which insulin stimulates glycogen synthesis in mammalian skeletal muscle. Nature 348:302-308. Denton, R.M. (1986): Early events in insulin actions. Adv. Cyclic Nucl. Prot. Phos. Res. 20:289-336. Denton, R.M., Brownsey, R.W. and Belsham, G.J. (1981): A partial view of the mechanism of insulin action. Diabetologia 21:347-363. 186 Denton, R.M. and Tavare, J. M. (1992): Mechanisms whereby insulin may regulate intracellular events. In Insulin molecular biology to pathology (ed. Ashcroft, FM. and Ashcroft, S.J.H.) pp. 235-261. Denton, R.M. and Tavare, J.M. (1995): Does mitogen-activated-protein kinase have a role in insulin action? The cases for and against. European Journal of Biochemistry 227:597-611. Deprez, J., Vertommen, D., Alessi, D.R., Hue, L. and Rider, M.H. (1997): Phosphorylation and activation of heart 6-phosphofructo-2-kinase by protein kinase B and other protein kinases of the insulin signaling cascades. The Journal of Biological Chemistry 272:17269-17275. j Derijard, B., Hibi, M., Wu, I-H., Barret, T., Su, B, Deng, T., Karin, M. and Davies, R.J. (1994) : JNK1: A protein kinase stimulated by UV light and Ha-Ras that binds and phosphorylates the c-Jun activation domain. Cell 76:1025-1037. Derijard, B., Raingeaud, J., Barrett, T., Wu, I.-H, Han, J., Ulevitch, R.J. and Davis, R.J. (1995) : Independent human MAP kinase signal transduction pathways defined by MEK and MKK isoforms. Science 267:682-685. Diggle, T.A., Moule, S.K., Avison, M.B., Flynn, A., Foulstone, E.J., Proud, C.G. and Denton, R.M. (1996): Both rapamycin-sensitive and -insensitive pathways are involved in the phosphorylation of the initiation factor-4E-binding protein (4E-BP1) in response to insulin in rat epididymal fat-cells. Biochemical Journal 316: 447-453. Diggle, T.A., Schmitz-Peiffer, C, Borthwick, A.C., Welsh, G.I. and Denton, R.M. (1991): Evidence that insulin activates casein kinase 2 in rat epididymal fat-cells and that this may result in the increased phosphorylation of an acid-soluble 22 kD protein. Biochemical Journal 279: 545-551. Dikic, I., Tokiwa, G., Lev, S., Courtneidge, S.A. and Schlessinger, J. (1996): A role for Pyk2 and Src in linking G-protein-coupled receptors with MAP kinase activation. Nature 383:547-550. Drewes, G., Lichtenberg-Kraag, B., Doering, F., Mandelkow, E.-M., Biernat, J., Goris, J., Doree, M. and Mandelkow, E. (1992): Mitogen activated protein (MAP) kinase transforms tau protein into an Alzheimer-like state. The EMBO Journal 11:2131-2138. Dubyak, G.R. and Kleinzeller, A. (1980): The insulin-mimetic effects of vanadate in isolated rat adipocytes. The Journal of Biological Chemistry 255:5306-5312. 187 Duckworth, W.C., Solomon, S.S., Liepnieks, J., Hamel, F.G., Hand, S. and Peavy, D.E. (1988): Insulin-like effects of vanadate in isolated rat adipocytes. Endocrinology 122:2285-2289. r Dudek, H., Datta, S.R., Franke, T.F., Birnbaum, MJ., Yao, R., Cooper, G.M., Segal, R.A., Kaplan, D.R. and Greenberg, M.E. (1997): Regulation of neuronal survival by the serine-threonine protein kinase Akt. Science 275:661-665. Ebina, Y., Araki, E., Taira, M., Shimada, F., Mori, M., Craik, C.S., Siddle, K., Pierce, SB., Roth, R.A. and Rutter, W.J. (1987): Replacement of lysine residue 1030 in the putative ATP-binding region of the insulin receptor abolishes insulin- and antibody-stimulated glucose uptake and receptor kinase activity. Proc. Natl. Acad. Sci. USA 84:704-708. Ellis, L., Morgan, D.O., Clauser, E., Roth, R.A. and Rutter, W.J. (1987): A membrane-anchored cytoplasmic domain of the human insulin receptor mediates a constitutively elevated insulin-independent uptake of 2-deoxyglucose. Molecular Endocrinology 1:15-24. Erickson, A.K., Payne, D.M., Martino, P.A., Rossomando, A.J., Shabanowitz, J., Weber, M.J., Hunt, D.F. and Sturgill, T.W. (1990): Identification by mass spectrometry of threonine 97 in bovine myelin basic protein as a specific phosphorylation site for mitogen-activated protein kinase. The Journal of Biological Chemistry 265:19728-19735. Erikson, R.L. (1991): Structure, expression, and regulation of protein kinases involved in the phosphorylation of ribosomal protein S6. The Journal of Biological Chemistry 266:6007-6010. Erikson, E., Mailer, J.L., and Erikson, R.L. (1991): Xenopus ribosomal protein S6 kinase II. in Methods in Enzymology, Vol. 200, p.253-268. Erikson, E., Stefanovic, D., Blenis, J., Erikson, R.L. and Mailer J.L. (1987): Antibodies to Xenopus egg S6 kinase II recognize S6 kinase from progesterone- and insulin-stimulated Xenopus oocytes and from proliferating chicken embryo fibroblasts. Molecular and Cellular Biology 7:3147-3155. Errede, B. and Levin, D.E. (1993): A conserved kinase cascade for MAP kinase activation in yeast. Current Opinion in Cell Biology 5:254-260. Faure, M., Voyno-Yasenetskaya, T.A. and Bourne, H.R. (1994): cAMP and Py subunits of heterotrimeric G proteins stimulate the mitogen-activated protein kinase pathway in COS-7 cells. The Journal of Biological Chemistry 269:7851-7854. 188 Fantl, W.J., Muslin, A.J., Kikuchi, A., Martin, J.A., MacNicol, A.M., Gross, R.W. and Williams, L.T. (1994): Activation of Raf-1 by 14-3-3 proteins. Nature 371:612-614. ; V Farrar, M.A., Alberola-Ila, J. and Perlmutter, R.M. (1996): Activation of the Raf-1 kinase cascade by coumermycin-induced dimerization. Nature 383:178-181. Feener, E.P., Backer, J.M., King, G.L., Wilden, P. A., Sun, X. J., Kahn, CR. and White, M.F. (1993): Insulin stimulates serine and tyrosine phosphorylation in the juxtamembrane region of the insulin receptor. The Journal of Biological Chemistry 268:11256-11264. Fingar, D.C and Birnbaum, M.J. (1994): Characterization of the mitogen-activated protein kinase/90-kilodalton ribosomal protein S6 kinase signaling pathway in 3T3-L1 adipocytes and its role in insulin-stimulated glucose transport. Endocrinology 134:728-735. Flores-Riveros, J.R., Sibley, E., Kastelic, T. and Lane, M.D. (1989): Substrate phosphorylation catalyzed by the insulin receptor tyrosine kinase. The Journal of Biological Chemistry 264:21557-21572. Forsayeth, J.R., Caro, J.F., Sinha, M.K., Maddux, BA. and Goldfine, ID. (1987): Monoclonal antibodies to the human insulin receptor that activate glucose transport but not insulin receptor kinase activity. Proc.Natl. Acad. Sci. USA 84:3448-3451. : Foufelle, F., Goubot, B., Pegorier, J.-P., Perdereau, D., Girard, J. and Ferre, P. (1992): Glucose stimulation of lipogenic enzyme gene expression in cultured white adipose tissue. A role for glucose 6-phosphate. The Journal of Biological Chemistry 267:20543-20546. Franke, T.F., Yang, S-I., Chan, TO., Datta, K, Kazlauskas, A., Morrison, D.K., Kaplan, D.R. and Tsichlis, P.N. (1995): The protein kinase encoded by the Akt proto-oncogene is a target of the PDGF-activated phosphatidylinositol 3 -kinase. Cell 81:727-736. Franke, T.F., Kaplan, D.R., Cantley, L.C and Toker, A. (1997): Direct regulation of the Akt proto-oncogene product by phosphatidylinositol-3,4-bisphosphate. Science 275:665-668. Freed, E., Symons, M., Mcdonald, S.G., McCormick, F. and Ruggieri, R. (1994): Binding of 14-3-3 proteins to the protein kinase Raf and effects on its activation. Science 265:1713-1716. 189 Freshney, N.W., Rawlinson, L., Guesdon, F., Jones, E., Cowley, S., Hsuan, J. and Saklatvala, J. (1994): Interleukin-1 activates a novel protein kinase cascade that results in the phosphorylation of Hsp27. Cell 78:1039-1049. Freychet, P., Roth, J. and Neville, Jr. D.M. (1971): Insulin receptors in the liver: specific binding of [125I]-insulin to the plasma membrane and its relation to insulin bioactivity. Proc. Natl. Acad. Sci. USA 68:1833-1837. Friedman, D.L. and Ken, R. (1988): Insulin stimulates incorporation of 3 2P ; into nuclear lamins A and C in quiescent BHK-21 cells. The Journal of Biological Chemistry 263:103-106. Fu, H., Xia, K., Pallas, D.C, Cui, C, Conroy, K., Narsimhan, R.P., Mamon, H., Collier, R.J. and Roberts, T.M. (1994): Interaction of the protein kinase Raf-1 with 14-3-3 proteins. Science 266:126-129. Galcheva-Gargova, Z., Derijard, B., Wu, I-H. and Davis, R.J. (1994): An osmosensing signal transduction pathway in mammalian cells. Science 265:806-808. Gammeltoft, S. (1984): Insulin receptors: binding kinetics and structure-function relationship of insulin. Physiological Reviews 64:1321-1378. Garland, P.B. and Randle, P.J. (1962): A rapid enzymatic assay for glycerol. Nature 196:987-988. Gibson, T.J., Hyvonen, M., Musacchio, A. and Saraste, M (1994): PH domain: the first anniversary. Trends in Biochemical Sciences 19:349-353. Gille, H., Sharrocks, A.D. and Shaw, P.E. (1992): Phosphorylation of transcription factor p62TCF by MAP kinase stimulates ternary complex formation at c-fos promoter. Nature 358:414-417. Gimeno, C.J., Ljungdahl, P.O., Styles, CA. and Fink, G.R. (1992): Unipolar cell divisions in the yeast S. cerevisiae lead to filamentous growth: Regulation by starvation and RAS. Cell 68:1077-1090. Girard, J., Perderau, D., Foufelle, F., Prip-Buus, C. and Ferre, P. (1994): Regulation of lipogenic enzyme gene expression by nutrients and hormones. FASEB Journal 8:36-42. Gonzalez, F.A., Raden, D.L. and Davis, R. (1991): Identification of substrate recognition determinants for human ERK1 and ERK2 protein kinase. The Journal of Biological Chemistry 266:22159-22163. i 190 Gotoh, Y., Nishida, E. and Sakai, H. (1990): Okadaic acid activates microtubule-associated protein kinase in quiescent fibroblastic cells. European Journal of Biochemistry 193:671-674. Gottschalk, W.K. (1991): The pathway mediating insulin's effects on pyruvate dehydrogenase bypasses the insulin receptor tyrosine kinase. The Journal of Biological Chemistry 266:8814-8819. j Gould, G.W. and Holman, G.D. (1993): The glucose transporter family: structure, function and tissue-specific expression. Biochemical Journal 295:329-341. Gould, G.W., Merrall N.W., Martins, S., Jess, T.J., Campbell, I.W., Calderhead, D.M., Gibbs, E.M., Holman, G.D. and Plevin R.J. (1994): Growth factor-induced stimulation of hexose transport in 3T3-L1 adipocytes:evidence that insulin-induced translocation of GLUT4 is independent of activation of MAP kinase. Cellular Signalling 6:313-320. Granner, D. and Pilkis, S. (1990): The genes of hepatic glucose metabolism. The Journal of Biological Chemistry 265:10173-10176. 1 Graves, L.M., Bornfeldt, K.E., Raines, E.W., Potts, B.C., MacDonald, S.G., Ross, R. and Krebs, E.G. (1993): Protein kinase A antagonizes platelet-derived growth factor-induced signaling by mitogen-activated protein kinase in human arterial smooth muscle cells. Proc. Natl. Acad. Sci. USA 90:10300-10304. Graves, L.M., Bornfeldt, K.E., Argast, G.M., Krebs, E.G., Kong, X., Lin, T.A. and Lawrence, J.C. (1995): cAMP- and rapamycin-sensitive regulation of the association of eukaryotic initiation factor 4E and the translational regulator PHAS-I in aortic smooth muscle cells. Proc. Natl. Acad. Sci. USA 92:7222-7226. Gregory, J.S., Boulton, T.G., Sang, B.-C. and Cobb, M.H. (1989): An insulin-stimulated ribosomal protein S6 kinase from rabbit liver. The Journal of Biological Chemistry 264:18397-18401. Griffith, J.P., Kim, J.L., Kim, E.E., Sintchak, M.D., Thomson, J.A., Fitzglbbon, M.J., Fleming, M.A., Caron, P.R., Hsiao, K and Navia, M.A. (1995): X-ray structure of calcineurin inhibited by the immunophilin-immunosuppressant FKBP12-FK506 complex. Cell 82:507-522. Gupta, S., Campbell, D., Derijard, B. and Davis, R.J. (1995): Transcription factor ATF2. Regulation by the JNK signal transduction pathway. Science 267:389-393. Gustafson, T.A., He, W., Craparo, A., Schaub, CD. and O'Neill, T.J. (1995): Phosphotyrosine-dependent interaction of She and insulin receptor substrate 1 with 191 the NPEY motif of the insulin receptor via a novel non-SH2 domain. Molecular and Cellular Biology 15:2500-2508. Gustafston, T.A. and Rutter, W.J. (1990): The cysteine-rich domains of the insulin and insulin-like growth factor I receptors are primary determinants of hormone binding specificity: evidence from receptor chimeras1. The Journal of Biological Chemistry 265:18663-18667. Han, J., Lee, J-D., Bibbs, L. and Ulevitch, R.J. (1994): A MAP kinase targeted by endotoxin and hyperosmolarity in mammalian cells. Science 265:808-811. Han, J., Lee, J-D., Jiang, Y., Li, Z., Feng, L. and Ulevitch, R.J. (1996): Characterization of the structure and function of a novel MAP kinase kinase (MKK6). The Journal of Biological Chemistry 271:2886-2891. Hanks, S.K., Quinn, A.M. and Hunter, T. (1988): The protein kinase family: Conserved features and deduced phylogeny of the catalytic domains. Science 241:42-52. Haslam, R.J., Kolde, H.B. and Hemmings, B.A. (1993): Pleckstrin domain homology. Nature 363:309-310. Hawes, B.E., van Biesen, T., Koch, W.J., Luttrell, L.M. and Lefkowitz, R.J. (1995): Distinct pathways of G r and Gq-mediated mitogen-activated protein kinase activation. The Journal of Biological Chemistry 270:17148-17153. Hawley, D.M, Maddux, B.A., Patel, R.G., Wong, K.Y., Mamula, P.W., Firestone, G.L., Brunetti, A., Verspohl, E. and Goldfine, I.D. (1989): Insulin receptor monoclonal antibodies that mimic insulin action without activating tyrosine kinase. The Journal of Biological Chemistry 264:2438-2444. Haycock, J.W., Ahn, N.G., Cobb, M.H. and Krebs, E.G. (1992): ERK1 and ERK2, two microtubule-associated protein 2 kinases, mediate the phosphorylation of tyrosine hydroxylase at serine-31 in situ. Proc. Natl. Acad. Sci. USA 89:2365-69. Haystead, T A J , Haystead, C.M.M., Hu, C, Lin, T-A. and Lawrence, J.C. Jr. (1994): Phosphorylation of PHAS-I by mitogen-activated protein (MAP) kinase. The Journal of Biological Chemistry 269:23185-23191. Haystead, T.A.J., Campbell, D.G. and Hardie, D.G. (1988): Analysis of sites phosphorylated on acetyl-CoA carboxylase in response to insulin in isolated adipocytes. Comparison with sites phosphorylated by casein kinase-2 and the calmodulin-dependent multi-protein kinase. European Journal of Biochemistry 175:347-354. 192 Haystead, T.A.J., Dent., P., Wu., J., Haystead, C.M.M. and Sturgill, T.W. (1992): Ordered phosphorylation of p42maPk by MAP kinase kinase. FEBS LETTERS 306:17-22. Haystead, T.A.J., Moore, F., Cohen, P. and Hardie, G. (1990): Roles of the AMP-activated and cyclic-AMP-dependent protein kinases in the adrenaline-induced inactivation of acetyl-CoA carboxylase in rat'adipocytes. European Journal of Biochemistry 187:199-205. Haystead, T.A.J., Weiel, J.E., Litchfield, D.W., Tsukitani, Y., Fischer, E.H. and Krebs, E.G. (1990a): Okadaic acid mimics the action of insulin in stimulating protein kinase activity in isolated adipocytes. The role of protein phosphatase 2A in attenuation of the signal. The Journal of Biological Chemistry 265:16571-16580. He, W., Craparo, A., Zhu, Y , O'Neill, T.J., Wang, L-M., Pierce, J.H. and Gustafson, T.A. (1996): Interaction of insulin receptor substrate-2 (IRS-2) with the insulin and insulin-like growth factor I receptors. The Journal of Biological Chemistry 271:11641-11645. I Heesom, K.J., Moule, S.K. and Denton, R.M. (1995): Purification of an insulin-stimulated acetyl-CoA carboxylase kinase from rat epididymal adipose tissue. Biochemical Society Transactions 23:180S. Hei, Y.-J., Pelech, S.L., Chen, X., Diamond, J. and McNeill, J.H. (1994): Purification and characterization of a novel ribosomal S6 kinase from skeletal muscle of insulin-treated rats. The Journal of Biological Chemistry 269:7816-7823. Heidenreich, K.A. and Kummer, J.L. (1996): Inhibition of p38 mitogen-activated protein kinase by insulin in cultured fetal neurons. The Journal of Biological Chemistry 271:9891-9894. Her, J.H., Wu, J., Rail, T.B., Sturgill, T.W., & Weber, M.J. (1991): Sequence of pp42/MAP kinase, a serine/threonine kinase regulated by tyrosine phosphoryation. Nucleic Acids Research 19:3743. Herskowitz, I. (1995): MAP kinase pathways in yeast: For mating and more. Cell 80:187-197. Hibi, M., Lin, A., Smeal, T., Minden, A. and Karin, M. (1993): Identification of an oncoprotein- and UV-responsive protein kinase that binds and potentiates the c-Jun activation domain. Genes and Development 7:2135-2148. Hill, CS. and Treiman, R. (1995): Transcriptional regulation by extracellular signals: mechanisms and specificity. Cell 80:199-211. 193 Hitchcock, S.E. (1976): Depolymerization of F-actin by deoxyribonuclease I. Cell 7:531-542. •i I •* Holman, G.D. and Cushman, S.W. (1994): Subcellular localization and trafficking of the GLUT4 glucose transporter isoform in insulin-responsive cells. BioEssays 16:753-759. Honkanen, R.E., Zwiller, J., Moore, R.E., Daily, S.L., Khatra, B.S., Dukelow, M. and Boynton, A.L. (1990): Characterization of microcystin-LR, a potent inhibitor of Type 1 and Type 2 A protein phosphatases. The Journal of Biological Chemistry 265:19401-19404. Hoshi, M., Ohta, K., Gotoh, Y., Mori, A., Murofushi, H., Sakai, H. and Nishida, E. (1992): Mitogen-activated-protein kinase-catalyzed phosphorylation of microtubule-associated proteins, microtubule-associated protein 2 and microtubule-associated protein 4, induces an alteration in their function. European Journal of Biochemistry 203:43-52. Houslay, M.D. and Siddle, K. (1989): Molecular basis of insulin receptor function. British Medical Bulletin 45:264-284. Hu, C, Pang, S., Kong, X., Velleca, M. and Lawrence, J.C. (1994): Molecular cloning and tissue distribution of PHAS-1, an intracellular target for insulin and growth factors. Proc. Natl. Acad. Sci. USA 91:3730-3754. Hubbard, M.J. and Cohen, P. (1989): Regulation of protein phosphatase-IG from rabbit skeletal muscle. European Journal of Biochemistry 186:711-716. Hubbard, S.R., Wei, L., Ellis, L. and Hendrickson, W.A. (1994): Crystal structure of the tyrosine kinase domain of the human insulin receptor. Nature 372:746-754. Hughes, K., Ramakrishna, S., Benjamin, W.B. and Woodgett, J.R. (1992): Identification of multifunctional ATP-citrate lyase kinase as the a-isoform of glycogen synthase kinase-3. Biochemical Journal 288:309-314. Hunter, T. (1995): Protein kinases and phosphatases: The yin and yang of protein phosphorylation and signaling. Cell 80:225-236. Hunter, T. and Plowman, G.D. (1997): The protein kinases of budding yeast: six score and more. Trends in Biochemical Sciences 22:18-22. Hurel. S.J., Rochford, J.J., Borthwick, A.C., Wells, A.M., Vandenheede, J.R., Turnbull, D.M. and Yeaman, S.J. (1996): Insulin action in cultured human myoblasts: contribution of different signalling pathways to regulation of glycogen synthesis. Biochemical Journal 320:871-877. 194 Isakoff, S.J., Taha, C, Rose, E., Marcusohn, J., Klip, A. and Skolnik, E.Y. (1995): The inability of phosphatidylinositol 3-kinase activation to stimulate GLUT4 translocation indicates additional signaling pathways are required for insulin-stimulated glucose uptake. Proc. Natl. Acad. Sci. USA 92:10247-10251. Irie, K., Gotoh, Y., Yashar, B.M., Errede, B., Nishida, E. and Matsumoto, K. (1994): Stimulatory effects of yeast and mammalian 14-3-3 proteins on the Raf protein kinase. Science 265:1716-1719. Iwasaki, Y., Nishiyama, H., Suzuki, K. and Koizumi, S. (1997): Sequential cis/trans autophosphorylation in TrkB tyrosine kinase. Biochemistry 36:2694-2700. Iynedjian, P.B. (1993): Mammalian glucokinase and its gene. Biochemical Journal 293:1-13. Iynedjian, P.B., Gjinovci, A. and Renold, A.E. (1988): Stimulation by insulin of glucokinase gene transcription in liver of diabetic rats. The Journal of Biological Chemistry 263:740-744. Janknecht, R., Ernst, W.H., Pingoud, V. and Nordheim, A. (1993): Activation of ternary complex factor Elk-1 by MAP kinases. The EMBO Journal 12:5097-5104. Jefferies, H.B.J., Reinhard, C , Kozma, S.C. and Thomas, G. (1994): Rapamycin selectively represses translation of the "polypyrimidine tract" mRNA family. Proc. Natl. Acad. Sci. USA 91:4441-4445. Jelinek, T., Dent, P., Sturgill, T.W. and Weber, M.J. (1996): Ras-induced activation of Raf-1 is dependent on tyrosine phosphorylation. Molecular and Cellular Biology 16:1027-1034. Johnson, G.L. and Vaillancourt, R.R. (1994): Sequential protein kinase reactions controlling cell growth and differentiation. Current Opinion in Cell Biology 6:230-238. Johnston, J.A., Wang, L-M., Hanson, E.P., Sun, X-J., White, M.F., Oakes, S.A., Pierce, J.H. and O'Shea, J.J. (1995): Interleukins 2,;4, 7, and 15 stimulate tyrosine phosphorylation of insulin receptor substrates 1 and 2 in T cells. The Journal of Biological Chemistry 270:28527-28530. Jones, P.F., Jakubowicz, T., Pitossi, F.J., Maurer, F. and Hemmings, B.A. (1991): Molecular cloning and identification of a serine/threonine protein kinase of the second-messenger subfamily. Proc.Natl. Acad. Sci. USA 88:4171-4175. 195 Kaburaki, Y., Momomura, K., Yamamoto-Honda, R., Tobe, K., Tamori, Y., Sakura, H., Akanuma, Y., Yazaki, Y. and Kadowaki, T. (1993): Site-directed mutagenesis of the juxtamembrane domain of the human insulin receptor. The Journal of Biological Chemistry 268:16610-16622. Kadowaki, T., Bevins, C.L., Cama, A., Ojamaa, K., Marcus-Samuels, B., Kadowaki, H., Beitz, L., McKeon, C. and Taylor, S.I. (1988): Two mutant alleles of the insulin receptor gene in a patient with extreme insulin resistance. Science 240:787-790. Kahn, CR. (1985): Current concepts of the molecular mechanism of insulin action. In: Creger, W.P. (ed.) Annual Review of Medicine. Annual Reviews Inc., Palo Alto, CA, vol. 36:429-451. Kahn, CR. (1994): Insulin action, diabetogenes, and the cause of type II diabetes. Diabetes 43:1066-1084. Kahn, C.R., Baird, K.L., Flier, J.S., Grunfeld, C, Harmon, J.T., Harrison, L.C, Karlsson, F.A., Kasuga, M., King, G.L., Lang, U., Podskalny, J.M. and Van Obberghen, E. (1981): Insulin receptors, receptors antibodies, and the mechanism of insulin action. Recent Prog. Horm. Res. 37:447-538. Kahn, CR. and White, M.F. (1988): The insulin receptor and the molecular mechanism of insulin action. The Journal of Clinical Investigation 82:1151-1156. Kanai, F., Ito, K., Todaka, M., Hayashi, H , Kamohara, S., Ishii, K., Okada, T., Hazeki, O., Ui, M. and Ebina, Y. (1993): Insulin-stimulated GLUT4 translocation is relevant to the phosphorylation of IRS-1 and the activity of PI 3-kinase. Biochemical and Biophysical Research Communications 195:762-768. Kasuga, M., Karlsson, F.A. and Kahn, CR. (1982a): Insulin stimulates the phosphorylation of the 95,000-dalton subunit of its own receptor. Science 215:185-187. Kasuga, M., Hedo, J.A., Yamada, K.M. and Kahn, CR. (1982b): The structure of the insulin receptor and its subunits: evidence for multiple non-reduced forms and a 21 OK possible proreceptor. The Journal of Biological Chemistry 257:10392-10399. ' Kauffrnann-Zeh, A., Rodriguez-Viciana, P., Ulrich, E., Gilbert, C, Coffer, P., Downward, J. and Evan, G. (1997): Suppression of c-Myc-induced apoptosis by Ras signalling through PI(3)K and PKB. Nature 385:544-548. Kayano, T., Burant, C.F., Fukumoto, H., Gould, G.W., Fan, Y.S., Eddy, R.L., Byers, M.G., Shows, T.B., Seino, S. and Bell, G.I. (1990): Human facilitative glucose transporters. The Journal of Biological Chemistry 265:13276-13282. 196 Kelly, K.L. and Ruderman, N.B. (1993): Insulin-stimulated phosphatidylinositol 3-kinase. Association with 185-kDa tyrosine-phosphorylated protein (IRS-1) and localization in a low density membrane vesicle. The Journal of Biological Chemistry 268:4391-4398. Khalil, R.A., Menice, C.B., Wang, C.-L.A. and Morgan, KG. (1995): Phosphotyrosine-dependent targeting of mitogen-activated protein kinase in differentiated contractile vascular cells. Circulation Research 76:1101-1108. Kharitonenkov, A., Schenkenburger, J., Chen, Z., Knyazev, P., Ali, S., Zwick, E., White, M. and Ullrich, A. (1995): Adapter function of protein-tyrosine phosphatase ID in insulin receptor/insulin receptor substrate-1 interaction. The Journal of Biological Chemistry 270:29189-29193. Kimball, S.R., Vary, T.C. and Jefferson, L.S. (1994): Regulation of protein synthesis by insulin. Annual Review of Physiology 56:321-348. Kishimoto, A., Nishiyama, K, Nakanishi, H., Uratsuji, Y., Nomura, H., Takeyama, Y. and Nishizuka, Y. (1985): Studies on the phosphorylation of myelin basic protein by protein kinase C and adenosine 3' :5'-monophosphate-dependent protein kinase. The Journal of Biological Chemistry 260:12492-12499. Kjeldsen, T., Andersen, A.S., Wilberg, F.C, Wiberg, F.C, Rasmussen, J.S., Schaffer, L., Balschmidt, P., Moller, KB. and Moller, N.P.H. (1991): The ligand specificities of the insulin receptor and the insulin-like growth factor I receptor reside in different regions of a common binding site. Proc. Natl. Acad. Sci. USA 88:4404-4408. Klarlund, J.K., Bradford, A.P., Milla, MG. and Czech, MP. (1990): Purification of a novel insulin-stimulated protein kinase from rat liver. The Journal of Biological Chemistry 265:227-234. Klauck, T.M., Faux, M.C, Labudda, K, Langeberg, L.K., Jaken, S. and Scott, J.D. (1996): Coordinating of three signaling enzymes by AKAP79, a mammalian scaffold protein. Science 271:1589-1592. Klippel, A., Reinhard, C, Kavanaugh, W.M., Apell, G., Escobedo, M-A. and Williams, L.T. (1996): Membrane localization of phosphatidylinositol 3-kinase is sufficient to activate multiple signal-transducing kinase pathways. Molecular and Cellular Biology 16:4117-4127. Klippel, A., Kavanaugh, W.M., Pot, D. and Williams, L.T. (1997): A specific product of phosphatidylinositol 3-kinase directly activates the protein kinase Akt through its pleckstrin homology domain. Molecular and Cellular Biology 17:338-344. 197 Koch, C.A., Anderson, D., Moran, M.F., Ellis, C. and Pawson, T. (1991): SH2 and SH3 domains: elements that control interactions of cytoplasmic signaling proteins. Science 252:668-674. Koch, W.J., Hawes, B.E., Allen, L.F. and Lefkowitz, R.J. (1994): Direct evidence that Gi-coupled receptor stimulation of mitogen-activated protein kinase is mediated by G py activation of p21ras. Proc. Natl. Acad. Sci. USA 91:12706-12710. Kohn, A.D., Kovacina, K.S. and Roth, R.A. (1995): Insulin stimulates the kinase activity of RAC-PK, a pleckstrin homology domain containing ser/thr kinase. The EMBO Journal 14:4288-4295. Kolch, W., Heidecker, G., Kochs, G., Hummel, R., Vahidi, H., Mischak, H., Finkenzeller, G., Marme, D. and Rapp, U.R. (1993): Protein kinase Ca activates RAF-1 by direct phosphorylation. Nature 364:249-252. Konishi, H., Kuroda, S., Tanaka, M., Matsuzaki, H , Ono, Y., Kameyama, K., Haga, T. and Kikkawa, U. (1995): Molecular cloning and characterization of a new member of the RAC protein kinase family: association of the pleckstrin homology domain of three types of RAC protein kinase with protein kinase C subspecies and subunits of G proteins. Biochemical and Biophysical Research Communications 216:526-534. Konishi, H., Matsuzaki, H., Tanaka, M., Ono, Y., Tokunaga, C, Kuroda, S. and Kikkawa, U. (1996): Activation of RAC-protein kinase by heat shock and hyperosmolarity stress through a pathway independent of phosphatidylinositol 3-kinase. Proc. Natl. Acad. Sci. USA 93:7639-7643. Kovacina, K.S., Yonezawa, K., Brantigan, D.L., Tonks, N.K., Rapp, U.R. and Roth, R.A. (1990): Insulin activates the kinase activity of the Raf-1 proto-oncogene by increasing its serine phosphorylation. The Journal of Biological Chemistry 265:12115-12118. Kozma, L., Baltensperger, K., Klarlund, J., Porras, A., Santos, E. and Czech, M.P. (1993): The ras signalling pathway mimics insulin action on glucose transporter translocation. Proc. Natl. Acad. Sci. USA 90:4460-4464. Krisak, L., Strich, R., Winters, R.S., Hall, J.P., Mallory, M.J., Kreitzer, D., Tuan, R.S. and Winter, E. (1994): SMK1, a developmentally regulated MAP kinase, is required for spore wall assembly in Saccharomyces cerevisiae. Genes and Development 8:2151-2161. 198 Kulik, G., Klippel, A. and Weber, MJ. (1997): Antiapoptic signalling by the insulin-like growth factor I receptor, phosphatidylinositol 3-kinase, and Akt. Molecular and Cellular Biology 17:1595-1606. Kunz, J. and Hall, M.N. (1993): Cyclosporin A, FK506 and rapamycin: more than just immunosuppression. Trends in Biochemical.Sciences 18:334-338. }? Kyriakis, J.M and Avruch, J. (1990): pp54 Microtubule-associated protein 2 kinase. A novel serine/threonine protein kinase regulated by phosphorylation and stimulated by poly-L-lysine. The Journal of Biological Chemistry 265:173 5 5 -173 63. Kyriakis, J.M., App, H., Zhang, X.F., Banerjee, P., Brautigan, D.L., Rapp, U.R. and Avruch, J. (1992): Raf-1 activates MAP kinase kinase. Nature 358:417-421. Kyriakis, J.M., Banerjee, P., Nikolakaki, E., Dai, T., Rubie, E.A., Ahmad, M.F., Avruch, J. and Woodgett, J.R. (1994): The stress-activated protein kinase subfamily of c-Jun kinases. Nature 369:156-160. Laemmli, U.K. (1970): Cleavage of structural proteins during the assembly of the head of bacteriophage T4. Nature 227:680-685. Lane, H.A. & Thomas, G. (1991): Purification and properties of mitogen-activated S6 kinase from rat liver and 3T3 cells. Nature 227:268-291. Lamer, J. (1988): Insulin-signaling mechanisms. Diabetes 37:262-275. Lavan, B.E., Lane, W.S. and Lienhard, G.E. (1997): The 60-kDa phosphotyrosine protein in insulin-treated adipocytes is a new member of the insulin receptor substrate family. The Journal of Biological Chemistry 272:11439-11443. Lavoinne, A., Erikson, E., Mailer, J.L., Price, D.J., Avruch, J. and Cohen, P. (1991): Purification and characterization of the insulin-stimulated protein kinase from rabbit skeletal muscle; close similarity to S6 kinase II. Eur. J. Biochem. 199:723-728. Lawrence, J.C. Jr. (1992): Signal transduction and protein phosphorylation in the regulation of cellular metabolism by insulin. Annual Review of Physiology 4:177-193. Lazar, D.F., Wiese, R.J., Brady, M.J., Mastick, C C , Waters, S.B., Yamauchi, K., Pessin, J.E., Cuatrecasas, P. and Saltiel, A.R. (1995): Mitogen-activated protein kinase kinase inhibition does not block the stimulation of glucose utilization by insulin. The Journal of Biological Chemistry 270:20801-20807. 199 Lazarides, E. & Lindberg, U. (1974): Actin is the naturally occurring inhibitor of deoxyribonuclease I. Proc. Natl. Acad. Sci. USA 71:4742-4746. Lee, J.C, Laydon, J.T., McDonnell, P.C, Gallagher, T.F., Kumar, S., Green, D., McNulty, D., Blumenthal, M.J., Heys, J.R.,Landvatter, S.W., Strickler, J.E., McLaughlin, M.M., Siemens, I.R., Fisher, S?M, Livi, G.P., White, J.R., Adams, J.L. and Young, P.R. (1994): A protein kinase involved in the regulation of inflammatory cytokine biosynthesis. Nature 372:739-754. Lee, J. and Pilch, P.F. (1994): The insulin receptor: structure, function, and signaling. American Journal of Physiology 266 (Cell Physiol. 35): C319-C334. Lee, J-D. Ulevitch, R.J. and Han, J. (1995): Primary structure of BMK1: a new mammalian MAP kinase. Biochemical and Biophysical Research Communications. 213:715-724. Leeuw, T., Fourest-Lieuvin, A., Wu, C, Chenevert; J., Clark, K., Whiteway, M., Thomas, D.Y. and Leberer, E. (1995): Pheromone response in yeast: Association of Bemlp with proteins of the MAP kinase cascade and actin. Science 270:1210-1213. Lechner, C, Zahalka, M.A., Giot, J-F., Moller, N.P.H., and Ullrich, A. (1996): ERK6, a mitogen-activated protein kinase involved in C2C12 myoblast differentiation. Proc. Natl. Acad. Sci. USA 93:4355-4359. Leevers, S.J., Paterson, H.F. and Marshall, CJ. (1994): Requirement for Ras in Raf activation is overcome by targeting Raf to the plasma membrane. Nature 369:411-414. Lemmon, M.A., Ferguson, K.M. and Schlessinger, J. (1996): PH domains: diverse sequences with a common fold recruit signaling molecules to the cell surface. Cell 85:621-624. Lev, S., Moreno, H., Martinez, R., Canoll, P., Peles, E., Musacchio, J.M., Plowman, G.D., Rudy, B. and Schlessinger, J. (1995): Protein tyrosine kinase PYK2 involved in Ca2+-induced regulation on ion channel and MAP kinase functions. Nature 376:737-745. Lewis, R.E., Wu, G.P., MacDonald, R.G. and Czech, M.P. (1990): Insulin-sensitive phosphorylation of serine 1293/1294 on the human insulin receptor by a tightly associated serine kinase. The Journal of Biological Chemistry 265:947-954. Lin, T-A, Kong, X., Haystead, T.A.J., Pause, A., Belsham, G., Sonenberg, N. and Lawrence, J.C. Jr. (1994): PHAS-1 as a link between mitogen-activated protein kinase and translation initiation. Science 266:653-656. 200 Lin, A., Minden, A., Martinetto, H. , Claret, F.-X., Lange-Carter, C , Mercurio, F., Johnson, G.L. and Karin, M . (1995): Identification of a dual specificity kinase that activates the Jun kinases and p38-Mpk2. Science 268:286-290. Lin, L - L . , Wartmann, M . , Lin, A.Y. , Knopf, J.L., Skh, A. and Davis, R.J. (1993): cPLA 2 is phosphorylated and activated by MAP kinase. Cell 72:269-278. Lin, T-A. and Lawrence, J.C. Jr. (1994): Activation of ribosomal protein S6 kinases does not increase glycogen synthesis or glucose transport in rat adipocytes. The Journal of Biological Chemistry 269:21255-21261. Lin, T-A., Kong, X., Saltiel, A.R., Blackshear, P.J. and Lawrence, J.C. Jr. (1995): Control of PHAS-1 by insulin in 3T3-L1 adipocytes. Synthesis, degradation, and phosphorylation by a rapamycin-sensitive and mitogen activated protein kinase-independent pathway. The Journal of Biological Chemistry 270: 18531-18538. Liu, J., Farmer, J.D.Jr., Lane, W.S., Friedman, J., Weissman, I. and Schreiber, S.L. (1991): Calcineurin is a common target of cyclophilin-cyclosporin A and FKBP-FK506 complexes. Cell 66:807-815. Liu, Ff., Styles, C A . and Fink, G.R. (1993): Elements of the yeast pheromone response pathway required for filamentous growth of diploids. Science 262:1741-1744. Low, M.G. and Saltiel, A.R. (1988): Structural and functional roles of glycosyl-phosphatidylinositol in membranes. Science 239:268-275. Luiken, J.J.F.P., Blommaart, E . F . C , Boon, L. , Vanwoerkom, G.M. and Meijer, A.J. (1994): Biochem. Soc. Trans. 22:516-522. Luo, Z., Tzivion, G., Belshaw, P.J. Vawas, D., Marshall, M . and Avruch, J. (1996): Oligomerization activates c-Raf-1 through a Ras-dependent mechanism. Nature 383:181-185. Lupashin, V.V. and Waters, M.G. (1997): t-SNARE activation through transient interaction with a Rab-like guanosine triphosphatase. Science 276:1255-1258. Mabrouk, G.M., Helmy, I.M., Thampy, K. and Wakil, S.J. (1990): Acute hormonal control of acetyl-CoA carboxylase. J. of Biol. Chem. 265:6330-6338. Maeda, T., Takekawa, M . and Saito, H. (1995): Activation of yeast PBS2 M A P K K by MAPKKKs or by binding of an SH3-containing osmosensor. Science 269:554-558. Magnuson, M.A. (1990): Glucokinase gene structure. Functional implications of molecular genetic studies. Diabetes 39:523-527. 201 r Magnuson, M.A., Andreone, T.L., Printz, R.L., Koch, S. and Granner, D.K. (1989): Rat glucokinase gene: structure and regulation by insulin. Proc. Natl. Acad. Sci. USA 86:4838-4842. Manchester, J., Kong, X., Lowry, OH. and Lawrence, J.C.Jr. (1994): Ras signaling in the activation of glucose transport by insulin. Proc. Natl. Acad. Sci. USA 91:4644-4648. Manser, E., Leung, T., Salihuddin, H., Zhao, Z-S. and Lim, L. (1994): A brain serine/threonine protein kinase activated by Cdc42 and Racl. Nature 367:40-46. Mansour, S.J., Matten, W.T., Hermann, A.S., Candia, J.M., Rong, S., Fukasawa, K., Vande Woude, G.F. and Ahn, N.G. (1994): Transformation of mammalian cells by constitutively active MAP kinase kinase. Science 265:966-970. Manzella, J.M., Rychlik, W., Rhoads, RE. Hershey, J.W.B. and Blackshear, P.J. (1991): Insulin induction of ornithine decarboxylase. Importance of mRNA secondary structure and phosphorylation of eucaryotic initiation factors eEF-4B and eIF-4E. The Journal of Biological Chemistry 266:2383-2389. Marais, R., Light, Y., Paterson, H.F. and Marshall, C.J. (1995): Ras recruits Raf-1 to the plasma membrane for activation by tyrosine phosphorylation. The EMBO Journal 14:3136-3145. Marcus, S., Polverino, A., Barr, M. and Wigler, M. (1994): Complexes between STE5 and components of the pheromone-responsive mitogen-activated protein kinase module. Proc. Natl. Acad. Sci. USA 91:7762-7766. Marshall, C.J. (1995): Specificity of receptor tyrosine kinase signaling: Transient versus sustained extracellular signal-regulated kinase activation. Cell 80:179-185. Marshall, C.J. (1996): Raf gets it together. Nature 383:127-128. Marti, A., Luo, Z., Cunningham, C, Ohta, Y., Hartwig, J., Stossel, T.P., Kyriakis, J.M. and Avruch, J. (1997): Actin-binding protein-280 binds the stress-activated protein kinase (SAPK) activator SEK-1 and is required for tumor necrosis factor-ct activation of SAPK in melanoma cells. The Journal of Biological Chemistry 272:2620-2628. Martin, G.A., Bollag, G., McCormick, F. and Abo, A. (1995): A novel serine kinase activated by rac/CDC42Hs-dependent autophosphorylation is related to PAK 65 and STE 20. The EMBO Journal 14:1970-1978. 202 Martin, B.R., Denton, R.M., Pask, H. and Randle, P.J. (1972): Mechanisms regulating adipose tissue pyruvate dehydrogenase. Biochemical Journal 129:763-773. Massague, J. and Czech, MP. (1982): Role of disulfides in the subunit structure of the insulin receptor. Reduction of Class I disulfides does not impair transmembrane signalling. The Journal of Biological Chemistry 257:6729-6738. i Massague, J., Pilch, P.F. and Czech, MP. (1981): Electrophoretic resolution of three major insulin receptor structures with unique subunit stoichiometrics. Proc. Natl. Acad. Sci. USA 77:7137-7141. Matsuzaki, H., Konishi, H., Tanaka, M., Ono, Y., Takenawa, T., Watanabe, Y., Ozaki, S., Kuroda, S. and Kikkawa, U. (1996): Isolation of the active form of RAC-protein kinase (PKB/Akt) from transfected COS-7 cells treated with heat shock stress and effects of phosphatidylinositol 3,4,5-trisphosphate and phosphatidylinositol 4,5-bisphosphate on its enzyme activity. FEBS LETTERS 396:305-308. Mayer, B.J., Ren, R., Clark, K.L. and Baltimore, D. (1993): A putative modular domain present in diverse signaling proteins. Cell 73:629-630. McClain, DA. (1991): Different ligand affinities of the two human insulin receptor splice variants are reflected in parallel changes in sensitivity for insulin action. Molecular Endocrinology 5:734-739. Michaud, N.R., Fabian, J.R., Mathes, KD. and Morrison, D.K. (1995): 14-3-3 is not essential for Raf-1 function: identification of Raf-1 proteins that are biologically activated in a 14-3-3- and Ras-independent manner. Molecular and Cellular Biology 15:3390-3397. Minden, A., Lin, A., Claret, F.-X., Abo, A. and Karin, M. (1995): Selective activation of the JNK signaling cascade and c-Jun transcriptional activity by the small GTPases Rac and Cdc42Hs. Cell 81:1147-1157. Miyasaka, T., Chao, M.V., Sherline, P. and Saltiel, A.R. (1990): Nerve growth factor stimulates a protein kinase in PC-12 cells that phosphorylates microtubule-associated protein-2. The Journal of Biological Chemistry 265:4730-4735. Moran, M.F., Koch, C.A., Anderson, D., Ellis, C, England, L., Martin, G.S. and Pawson, T. (1990): Src homology region 2 domains (direct protein-protein interactions in signal transduction. Proc. Natl. Acad. Sci. IFSA 87:8622-8626. Moule, S.K., Edgell, N.J., Welsh, G.I., Diggle, T.A., Foulstone, E.J., Heesom, K.J., Proud, C.G. and Denton, R.M. (1995): Multiple signalling pathways involved in the stimulation of fatty acid and glycogen synthesis by insulin in rat epididymal fat cells. Biochemical Journal 311:595-601. 203 Moule, S.K., Edgell, N.J., Borthwick, A.C. and Denton, R.M. (1992): Coenzyme A is a potent inhibitor of acetyl-CoA carboxylase from rat epididymal fat pads. Biochemical Journal 283:35-38. Moule, S.K., Welsh, G.I., Edgell, N.J., Foulstone, E.J., Proud, C.G and Denton, R.M. (1997): Regulation of protein kinase B and glycogen synthase kinase-3 by insulin and 3-adrenergic agonists in rat epididymal'fat cells. The Journal of Biological Chemistry 272:7713-7719. -Moustaid, N., Beyer, R.S., and Sul, H.S. (1994): Identification of an insulin response element in the fatty acid synthase promoter. The Journal of Biological Chemistry 269:5629-5634. Moxham, CM. and Malbon, C C (1996): Insulin action impaired by deficiency of the G-protein subunit G i a 2 . Nature 379:840-844. Moxham, CM., Tabrizchi, A., Davis, R.J. and Malbon, C C (1996): jun N-terminal kinase mediates activation of skeletal muscle glycogen synthase by insulin in vivo. The Journal of Biological Chemistry 271:30765-30773. Mueckler, M. (1994): Facilitative glucose transporters. Eur. J. Biochem. 219:713-725. Musacchio, A., Gibson, T., Rice, P., Thompson, J. and Saraste, M. (1993): The PH domain: a common piece in the structural patchwork of signalling proteins. Trends in Biochemical Sciences 18:343-348. Myers, M.G.Jr., Backer, J.M., Sun, X.J. et al., (1992): IRS-1 activates phosphatidylinositol 3-kinase by associating with src homology 2 domains of p85. Proc. Natl. Acad. Sci USA 89:10350-10354. Myers, M.G. Jr., Sun, X.J. and White, MF. (1994): The IRS-1 signaling system. Trends in Biochemical Sciences 19:289-293. Nakajima, T., Kinoshita, S., Sasagawa, T., Sasaki, K., Naruto, M., Kishimoto, T. and Akira, S. (1993): Phosphorylation at threonine-235 by a ras-dependent mitogen-activated protein kinase cascade is essential for transcription factor NF-IL6. Proc. Natl. Acad. Sci. USA 90:2207-2211. Nebreda, A.R. (1994): Inactivation of MAP kinases. Trends in Biochemical Sciences 19:1-3. Neiman, A.M. (1993): Conservation and reiteration of a kinase cascade. Trends in Genetics 9:390-394. 204 I -i Neiman, A.M., Stevenson, B.J., Xu, H-P., Sprague, G.F. Jr., Herskowitz, I., Wigler, M. and Marcus, S. (1993): Functional homology of protein kinases required for sexual differentiation in Schizosaccharomyces pombe and Saccharomyces cerevisiae suggests a conserved signal transduction module in eukaryotic organisms. Molecular Biology of the Cell 4:107-120. Nishibe, S., Wahl, M.I., Wedegaertner, P.B., Kim, J.J., Rhee, S.G. and Carpenter, G. (1990): Selectivity of phospholipase C phosphorylation by the epidermal growth factor receptor, the insulin receptor, and their cytoplasmic domains. Proc. Natl. Acad. Sci. USA 87:424-428. Northwood, I.C., Gonzalez, F.A., Wartmann, M., Raden, D.L. and Davis, R.J. (1991): Isolation and characterization of two growth factor-stimulated protein kinases that phosphorylate the epidermal growth factor receptor at threonine 669. The Journal of Biological Chemistry 266:15266-15276. Novak-Hofer, I. and Thomas, G. (1985): Epidermal growth factor-mediated activation of an S6 kinase in Swiss 3T3 cells. The Journal of Biological Chemistry 260:10314-10319. O'Brien, R.M. and Granner, D.K. (1991): Regulation of gene expression by insulin. The Biochemical Journal 278:609-619. O'Brien, R.M. and Granner, D.K. (1996): Regulation of gene expression by insulin. Physiological Reviews 76:1109-1161. Ohmichi, M., Pang, L., Ribon, V. and Saltiel, A.R. (1993): Inhibition of the translocation of GLUT1 and GLUT4 in 3T3-L1 cells by the phosphatidylinositol 3-kinase inhibitor, wortmannin. Endocrinology 33:46-56. Ohta, Y. and Hartwig, J.H. (1996): Phosphorylation of actin-binding protein 280 by growth factors is mediated by p90 ribosomal S6 kinase. The Journal of Biological Chemistry 271:11858-11864. Okada, T., Kawano, Y., Sakakibara, T., Hazeki, O. and Ui, M. (1994): Essential role of phosphatidylinositol 3-kinase in insulin-induced glucose transport and antilipolysis in rat adipocytes. The Journal of Biological Chemistry 269:3568-3573. O'Mahony, D.J., Smith, S.D., Xie, W. and Rothblum, L.I. (1992): Analysis of the phosphorylation, DNA-binding and dimerization properties and of the nucleolar fibrillar localization of the RNA polymeraseT transcription factors UBF1 and UBF2. Nucleic Acids Research 20:1301-1308. 205 fibrillar localization of the RNA polymerase I transcription factors UBF1 and UBF2. Nucleic Acids Research 20:1301-1308. O'Reilly, G. & Clarke, F. (1993): Identification of an actin binding region in aldolase. FEBS LETTERS 32:69-72. Pang, D.T. and Shafer, J.A. (1984): Evidence that insulin receptor from human placenta has a high affinity for only one molecule of insulin. The Journal of Biological Chemistry 259:8589-8596. Parker, P.J., Caudwell, F.B. and Cohen, P. (1983): Glycogen synthase from rabbit skeletal muscle. Effect of insulin on the state of phosphorylation of the seven phosphoserine residues in vivo. European Journal of Biochemistry 130:227-234. Pause, A., Belsham, G.J., Donze, O., Lin, T.-A., Lawrence, J.C. and Sonenberg, N. (1994): Insulin-dependent stimulation of protein synthesis by phosphorylation of a regulator of 5'-cap function. Nature 371:762-767. Pawson, T. (1995): Protein modules and signalling networks. Nature 373:573-580. Payrastre, B., van Bergen en Henegouwen, P.M.P., Breton, M., den Hartigh, J.C, Plantavid, M., Verkley, A.J. and Boonstra, J. (1991): Phosphoinositide kinase, diacylglycerol kinase and phospholipase C activities associated to the cytoskeleton:effect of epidermal growth factor. Journal of Cell Biology 115:121-128. Pelech, S.L., Sanghera, J.S., Paddon, H.B., Quayle, K.A. and Brownsey, R.W. (1991): Identification of a major maturation-activated acetyl-CoA carboxylase kinase in sea star oocytes as p44mPk. Biochemical Journal 274:759-767. Peraldi, P., Zhao, Z., Fillloux, C , Fischer, EH. and VanObberghen, E. (1994): Protein-tyrosine-phosphatase 2C is phosphorylated and inhibited by 44-kDa mitogen-activated protein kinase. Proc. Natl. Acad. Sci. USA 91:5002-5006. Plyte, S.E., Hughes, K., Nikolakaki, E., Pulverer, B.J. and Woodgett, J.R. (1992): Glycogen synthase kinase-3: functions in oncogenesis and development. Biochimica et Biophysica Acta 1114:147-162. Pollard, T.D. & Cooper, J.A. (1986): Actin and actin-binding proteins. A critical evaluation of mechanisms and functions. Annual Review of Biochemistry 55:987-1035. Pombo, CM., Kehri, J.H., Sanchez, I., Katz, P., Avruch, J., Zon, L.I., Woodgett, JR., Force, T. and Kyriakis J.M. (1995): Activation of the SAPK pathway by the human STE20 homologue germinal centre kinase. Nature 377:750-754. 206 Ponzio, G. Contreres, J.O., Debant, A., Baron, V , Gautier,N., Dolais-Kitabgi, J. and Rossi, B. (1988): Use of an anti-insulin receptor antibody to discriminate between metabolic and mitogenic effects of insulin: correlation with receptor autophosphorylation. The EMBO Journal 7:4111-4117. Printen, J.A. and Sprague, G.F. Jr. (1994) Protein-protein interactions in the yeast pheromone response pathway: Ste5p interacts with all members of the MAP kinase cascade. Genetics 138:609-619. Pulverer, B.J., Kyriakis, J.M., Avruch, J., Nikolakaki, E. and Woodgett, J.R. (1991): Phosphorylation of c-jun mediated by MAP kinases. Nature 353:670-674. Putnam, R.W. (1985): Effect of insulin on intracellular pH in frog skeletal muscle fibers. American Journal of Physiology 248:C330-C336. Proud, C.G. (1996): p70 S6 kinase: an enigma with variations. Trends in Biochemical Sciences 21:181-185. Quon, M.J., Butte, A.J. and Taylor, S.I. (1994): Insulin signal transduction pathways. Trends in Endocrinology and Metabolism 5:369-376. Rabilloud, T., Carpentier, G. and Tarroux, P. (1988): Improvement and simplification of low-backround silver staining of proteins by using sodium dithionite. Electrophoresis 9:288-291. Rafaeloff, R., Patel, R., Yip, C, Goldfine, ID. and Hawley, DM. (1989): Mutation of the high cysteine region of the human insulin receptor a-subunit increases insulin receptor binding affinity and transmembrane signaling. The Journal of Biological Chemistry 264:15900-15904. Rahn, T., Ridderstrale, M., Tornqvist, H., Manganiello, V., Fredrikson, G., Belfrage, P. and Degerman, E. (1994): Essential role of phosphatidylinositol 3-kinase in insulin-induced activation and phosphorylation of the cGMP-inhibited cAMP phosphodiesterase in rat adipocytes. FEBS LETTERS 350:314-318. Raingeaud, J., Gupta, S., Rogers, J.S., Dickens, M., Han, J., Ulevitch, R.J. and Davis, R.J. (1995): Pro-inflammatory cytokines and environmental stress cause p38 mitogen-activated protein kinase activation by dual phosphorylation on tyrosine and threonine. The Journal of Biological Chemistry 270:7420-7426. Raingeaud, J., Whitmarsh, A.J., Barrett, T., Derijard, B. and Davis, R.J. (1996): MKK3-and MKK6-regulated gene expression is mediated by the p38 mitogen-activated protein kinase signal transduction pathway. Molecular and Cellular Biology 16:1247-1255. ! 207 Ramakrishna, S., Murthy, KS. and Benjamin, W.Bi (1989): Effect of insulin on ATP-citrate lyase phosphorylation: regulation of peptide A and peptide B phosphorylations. Biochemistry 28:856-860. Ray, LB. and Sturgill, T.W. (1987): Rapid stimulation by insulin of a serine/threonine kinase in 3T3-L1 adipocytes that phosphorylates microtubule-associated protein 2 in vitro. Proc. Natl. Acad. Sci. USA 84:1502-1506. Ray, L.B. and Sturgill, T.W. (1988): Characterization of insulin-stimulated microtubule-associated protein kinase. Rapid isolation and stabilization of a novel serine/threonine kinase from 3T3-L1 cells. The Journal of Biological Chemistry 263:12721-12727. Redpath, N.T., Foulstone, E.J. and Proud, C.G. (1996): Regulation of translation elongation factor-2 by insulin via a rapamycin-sensitive signalling pathway. The EMBO Journal 15:2291-2297. Reszka, A.A., Seger, R., Diltz, CD., Krebs, E.G. and Fischer, E.H. (1995): Association of mitogen-activated protein kinase with the microtubule cytoskeleton. Proc. Natl. Acad. Sci. USA 92:8881-8885. Roberts, R.L. and Fink, G.R. (1994): Elements of a single MAP kinase cascade in Saccharomyces cerevisiae mediate two developmental programs in the same cell type: mating and invasive growth. Genes and Development 8:2974-2985. Robbins, D.J., Zhen, E., Owaki, H., Vanderbilt, C.A., Ebert, D., Geppert, T.D. and Cobb, M.H. (1993): Regulation and properties of extracellular signal-regulated protein kinases 1 and 2 in vitro. The Journal of Biological Chemistry 268:5097-5106. Robinson, L.J., Razzack, Z.F., Lawrence, J.C. and James, D.E. (1993): Mitogen-activated protein kinase activation is not sufficient for stimulation of glucose transport or glycogen synthase in 3T3-L1 adipocytes. The Journal of Biological Chemistry 268:26422-26427. Rodbell, M. (1964): Metabolism of isolated fat cells. The Journal of Biological Chemistry 239:375-380. Rosen, O.M., Herrera, R., Olowe, Y., Petruzzelli, L.M. and Cobb, M.H. (1983): Phosphorylation activates the insulin receptor tyrosine protein kinase. Proc. Natl. Acad. Sci. USA 80:3237-3240. Rossomando, A.J., Dent, P., Sturgill, T.W. and MarshakD.R. (1994): Mitogen-activated protein kinase 1 MKK1 is negatively regulated by threonine phosphorylation. Molecular and Cellular Biology 14:1594-1602. 208 Rothenberg, P., Glaser, L., Schlessinger, P. and Cassel, D. (1983): Activation of Na /H exchange by epidermal growth factor elevates intracellular pH in A431 cells. The Journal of Biological Chemistry 258:12644-12653. Rothman, J.E. (1994): Mechanisms of intracellular protein transport. Nature 372:55-63. Rotin, D., Honegger, A.M., Margolis, B.L., Ullrich, A. and Schlessinger, J. (1992): Presence of SH2 domains of phospholipase Cyl enhances substrate phosphorylation by increasing the affinity toward the epidermal growth factor receptor. The Journal of Biological Chemistry 267:9678-9683. Rouse, J., Cohen, P., Trigon, S., Morange, M., Alonso-Liamazares, A., Zamanillo, D., Hunt, T. and Nebreda, A.R. (1994): A novel kinase cascade triggered by stress and heat shock that stimulates MAPKAP kinase-2 and phosphorylation of the small heat shock proteins. Cell 78:1027-1037. Ruderman, N., Kapeller, R., White, MF. and Cantley, L.C. (1990): Activation of phosphatidylinositol 3-kinase by insulin. Proc. Natl. Acad. Sci. USA 87:1411-1415. Ruibao, R., Mayer, B.J., Cicchetti, P. and Baltimore, D. (1993): Identification of a ten-amino acid proline-rich SH3 binding site. Science 259:1157-1161. Rylatt, D.B., Aitken, A., Bilham, J., Condon, G.D. and Cohen, P. (1980): Glycogen synthase from rabbit skeletal muscle. Amino acid sequence at the sites phosphorylated by glycogen synthase kinase-3, and extension of the N-terminal sequence containing the site phosphorylated by phosphorylase kinase. European Journal of Biochemistry 107:529-537. Sabe, H., Hata, A., Okada, M., Nakagawa, H. and Hanafusa, H. (1994): Analysis of the binding of the Src homology 2 domain of Csk to tyrosine-phosphorylated proteins in the suppression and mitotic activation of c-Src. Proc. Natl. Acad. Sci. USA 91:3984-3988. Saito, Y., Vandenheede, J.R. and Cohen, P (1993):'The mechanism by which epidermal growth factor inhibits glycogen synthase kinase 3 in A431 cells. Biochemical Journal 303:27-31. Saltiel, A.R. (1990): Second messengers of insulin action. Diabetes Care 13:244-256. Sanchez, I., Hughes, R.T., Mayer, B.J., Yee, K, Woodgett, J.R., Avruch, J., Kyriakis, J.M. and Zon, L.I. (1994): Role of SAPK/ERK kinase-1 in the stress-activated pathway regulating transcription factor c-Jun. Nature 372:794-798. 209 Sanchez, I., Hughes, R.T., Mayer, B.J., Yee, K., Woodgett, J.R., Avruch, J., Kyriakis, J.M. and Zon, L.I. (1994): Role of SAPK/ERK kinase-1 in the stress-activated pathway regulating transcription factor c-Jun. Nature 372:794-798. Sanghera, J.S., Aebersold, R., Morrison, H.D., Bures, E.J. and Pelech, S.L. (1990): Identification of the sites in myelin basic protein that are phosphorylated by meiosis-activated protein kinase p44mPk. FEBS LETTERS 273:223-226. Sanghera, J.S., Paddon, H.B., Bader, S.A., & Pelech, S.L. (1990): Purification and characterization of a maturation-activated myelin basic protein kinase from sea star oocytes. The Journal of Biochemical Chemistry 265: 52-57. Schliess, F., Schreiber, R. and Hausinger, D. (1995): Activation of extracellular signal-regulated kinases ERK1 and ERK2 by cell swelling in H41 IE hepatoma cells. Biochemical Journal 309:13-17. Schreiber, S.L. and Crabtree, G.R. (1992): The mechanism of action of cyclosporin A and FK506. Immunology Today 13:136-142. Schumacher, R., Soos, M.A., Schlessinger, J., Brandenburg, D., Siddle, K. and Ullrich, A. (1993): Signaling-competent receptor chimeras allow mapping of major insulin receptor binding domain determinants. The Journal of Biological Chemistry 268:1087-1094. Schwartzberg, P.L., Stall, A.M., Hardin, J.D., Bowdish, K.S., Humaran, T., Boast, S., Harbison, M.L., Robertson, E.J. and Goff, S.P. (1991): Mice homozygous for the ablm l mutation show poor viability and depletion of selected B and T cell populations. Cell 65:1165-1175. Seger, R., Ahn, N.G., Boulton, T.G., Yancopoulos, G.D., Panayotatos, N., Radziejewska, E., Ericsson, L., Bratlien, R.L., Cobb, M.H. and Krebs, E.G. (1991): Microtubule-associated protein 2 kinases, ERK1 and ERK2, undergo autophosphorylation on both tyrosine and threonine residues: implication of their mechanism of activation. Proc. Natl. Acad. Sci. USA 88:6142-6146. Sells, M.A. and Chernoff, J. (1997): Emerging from the Pak: the p21-activated protein kinase family. Trends in Cell Biology 7:162-167. Seth, A., Gonzalez, F.A., Gupta, S., Raden, DL. and Davies, R.J. (1992): Signal transduction within the nucleus by mitogen-activated protein kinase. The Journal of Biological Chemistry 267:24796-24804. Sevetson, B.R., Kong, X. and Lawrence, J.C. JR. (1993): Increasing cAMP attenuates activation of mitogen-activated protein kinase. Proc. Natl. Acad. Sci. USA 90:10305-10309. 210 Shechter, Y. (1990): Insulin-mimetic effects of vanadate. Diabetes 39:1-5. Sheorain, V.S., Juhl, H., Bass, M , Soderling, TR. (1984): Effects of epinephrine, diabetes and insulin on rabbit skeletal muscle glycogen synthase. Phosphorylation site occupancies. The Journal of Biological Chemistry 259:7024-7030. Shoelson, S.E., White, MF. and Kahn, CR. (1988): Tryptic activation of the insulin receptor. Proteolytic truncation of the a-subunit releases the P-subunit from inhibitory control. The Journal of Biological Chemistry 263:4852-4860. Shoji, S., Ohnishi, J., Funakoshi, T., Fukunaga, K., Miyamoto, E., Ueki, H. and Kubota, Y. (1987): Phosphorylation sites of bovine brain myelin basic protein. Phosphorylated with Ca 2 + -calmodulin-dependent protein kinase from rat brain. Journal of Biochemistry 102:1113-1120. • Simpson, LA. and Cushman, S.W. (1986): Hormonal regulation of mammalian glucose transport. Annual Review of Biochemistry 55:1059-1089. Smith, C.J., Rubin, CS. and Rosen, O.M. (1980): Insulin-treated 3T3-L1 adipocytes and cell-free extracts derived from them incorporate 3 2P into ribosomal protein S6. Proc. Natl. Acad. Sci. USA 77:2641-2645. Sollner-Webb, B. and Mougey, E.B. (1991): News from the nucleolus: rRNA gene expression. Trends in Biochemical Sciences 16:58-62. Sommercorn, J., Mulligan, J.A., Lozeman, F.J. and;Krebs, E.G. (1987): Activation of casein kinase II in response to insulin and to epidermal growth factor. Proc. Natl. Acad. Sci. USA 84:8834-8838. Sonenberg, N. (1993): Remarks on the mechanism of ribosome binding to eukaryotic mRNAs. Gene Expression 3: 317-323. Songyang, Z. and Cantley, L.C (1995): Recognition and specificity in protein tyrosine kinase-mediated signalling. Trends in Biochemical Sciences 20:471-475. Songyang, Z., Blechner, S., Hoagland, N., Hoekstra, M.F., Piwnica-Worms, H. and Cantley, L.C. (1994): Use of an oriented peptide library to determine the optimal substrates of protein kinases. Current Biology 4:973-982. Songyang, Z., Lu, K.P., Kwon, Y.T., Tsai, L.-H, Filhol, O., Cochet, C , Brinkey, D.A., Soderling, T.R., Bartleson, C, Graves, D.J., DeMaggio, A.J., Hoekstra, M.F., Blenis, J., Hunter, T. and Cantley, L.C. (1996): A structural basis for substrate specificities of protein ser/thr kinases: primary sequence preference of casein 211 kinases I and II, NIMA, phosphorylase kinase, calmodulin-dependent kinase II, CDK5, and ERK1. Molecular and Cellular Biology 16:6486-6493. Soos, M.A., OBrien, R.M., Brindle, N.P.J., Stigter, J.M., Okamoto, A.K. and Whittaker, J.W. (1989): Monoclonal antibodies to the insulin receptor mimic metabolic effects of insulin but do not stimulate receptor autophosphorylation in transfected NTH 3T3 fibroblasts. Proc. Natl. Acad. Sci. USA 86:5217-5221. Stadtmauer, L. and Rosen, O.M. (1986): Increasing the cAMP content of IM-9 cells alters the phosphorylation state and protein kinase activity of the insulin receptor. The Journal of Biological Chemistry 261:3402-3,407. Stambolic, V. and Woodgett, J.R. (1994): Mitogen inactivation of glycogen synthase kinase-3P in intact cells via serine 9 phosphorylation. Biochemical Journal 303:701-704. Stansbie, D., Brownsey, R.W., Crettaz, M. and Denton, R.M. (1976): Acute effects in vivo of anti-insulin serum on rates of fatty acid synthesis and activities of acetyl-Coenzyme A carboxylase and pyruvate dehydrogenase in liver and epididymal adipose tissue of fed rats. Biochemical Journal 160:413-416. Stein, B., Brady, H., Yang, M.X., Young, D.B. andBarbosa, MG. (1996): Cloning and characterization of MEK6, a novel member of the mitogen-activated protein kinase kinase cascade. The Journal of Biological Chemistry 271:11427-11433. Stein, B., Yang, M.X., Young, D.B., Janknecht, R., Hunter, T., Murray, B.W. and Barbosa, M.S. (1997): p38-2, a novel mitogen-activated protein kinase with distinct properties. The Journal of Biological Chemistry 272:19509-19517. Stokoe, D., Macdonald, S.G., Cadwallader, K., Symons, M. and Hancock, J.F. (1994): Activation of Raf as a result of recruitment to the plasma membrane. Science 264:1463-1467. Stralfors, P. (1988): Insulin stimulation of glucose uptake can be mediated by diacylglycerol in adipocytes. Nature 335:554-556. Stralfors, P. (1997): Insulin second messengers. BioEssays 19:327-335. Stralfors, P., Bjorgell, P. and Belfrage, P. (1984): Hormonal regulation of hormone-sensitive lipase in intact adipocytes. Identification of phosphorylated sites and effects on the phosphorylation by lipolytic hormones and insulin. Proc. Natl. Acad. Sci. USA 81:3317-3321. Stralfors, P., Hiraga, A. and Cohen, P. (1985): The protein phosphatases involved in cellular regulation. European Journal of Biochemistry 149:295-303. 212 Sturgill, T.W. and Wu, J. (1991): Recent progress in characterization of protein kinase cascades for phosphorylation of ribosomal protein S6. Biochimica et Biophysica Acta 1092:350-357. Sudhof, T.C. (1995): The synaptic vesicle cycle: a cascade of protein-protein interactions. Nature 375:645-653. f Sugimoto, S., Wandless, T.J., Shoelson, S.E., Neel, BG. and Walsh, C.T. (1994): Activation of the SH2-containing protein tyrosine phosphatase, SH-PTP2, by phosphotyrosine-containing peptides derived from insulin receptor substrate-1. The Journal of Biological Chemistry 269:13614-13622. Sun, X.J., Crimmins, D.L., Myers, M.G. Jr., Miralpeix, M. and White, M.F. (1993): Pleiotropic insulin signals are engaged by multisite phosphorylation of IRS-1. Molecular and Cellular Biology 13:7418-7428. Sutherland, C. and Cohen, P. (1994): The ct-isoform of glycogen synthase kinase-3 from rabbit skeletal muscle is inactivated by p70 S6 kinase or MAP kinase-activated protein kinase-1 in vitro. FEBS LETTERS 338:37-42. Sutherland, C, Leighton, LA. and Cohen, P. (1993a): Inactivation of glycogen synthase kinase-3P by phosphorylation: new kinase connections in insulin and growth-factor signalling. Biochemical Journal 296:1,5-19. Sutherland, C , Campbell, D.G. and Cohen, P. (1993b): European Journal of Biochemistry 212:581-588. Sutherland, C , Alterio, J., Campbell, D.G., Le Bourdelles, B., Mallet, J., Haavik, J. and Cohen, P. (1993c): Phosphorylation and activation of human tyrosine hydroxylase in vitro by mitogen-activated protein (MAP) kinase and MAP-kinase-activated kinases 1 and 2. European Journal of Biochemistry 217:715-722. Suzuki, K. and Kono, T. (1980): Evidence that insulin causes translocation of glucose transport activity to the plasma membrane from an intracellular storage site. Proc. Natl. Acad. Sci. USA 77:2542-2545. Sweet, L.J., Alcorta, D.A., Jones, S.W., Erikson, E. and Erikson, R.L. (1990): Identification of mitogen-responsive ribosomal protein S6 kinase II, in chicken embryo fibroblasts. Molecular and Cellular Biology 10:2413-2417. Sweet, L.J., Morrison, B.D. and Pessin, J.E. (1987): Isolation of functional a P heterodimers from the purified human placental OC2P2 heterotetrameric insulin receptor complex: a structural basis for insulin binding heterogeneity. The Journal of Biological Chemistry 262:6939-6942. 213 Takayama, S., White, MF. and Kahn, C.R. (1988): Phorbol ester induced serine phosphorylation of the insulin receptor decreases its tyrosine kinase activity. The Journal of Biological Chemistry 263:3440-3447. Tamemoto, H., Kadowaki, T., Tobe, K., Yagi, T., Sakura, Ff., Hayakawa, T., Terauchi, Y., Ueki, K., Kaburagi, Y., Satoh, S., Sekihara, H., Yoshioka, S., Horikoshi, H., Furuta, Y., Ikawa, Y., Kasuga, M., Yazaki, Y. and Aizawa, S. (1994): Insulin resistance and growth retardation in mice lacking insulin receptor substrate-1. Nature 372:183-186. Tamura, S., Brown, T.A., Dubler, R.E. and Larner, J. (1983): Insulin-like effect of vanadate on adipocyte glycogen synthase and on phosphorylation of 95,000 dalton subunit of insulin receptor. Biochem. Biophys. Res. Commun. 113:80-86 Tauer, T.J., Voile, D.J., Rhode, S.L. and Lewis, RE. (1996): Expression of the insulin receptor with a recombinant vaccinia virus. Biochemical evidence that the insulin receptor has intrinsic serine kinase activity. The Journal of Biological Chemistry 271:331-336. Tavare, J.M. and Siddle, K. (1993): Mutational analysis of insulin receptor function: consensus and controversy. Biochimica et Biophysica Acta 1178:21-39. Thomas, J.A., Schlender, K.K. and Larner, J. (1968): A rapid filter paper assay for UDPglucose-glycogen glucosyltransferase, including an improved biosynthesis of UDP-14C-glucose. Analytical Biochemistry 25:486-499. Thorens, B., Weir, G.C, Leahy, J.L., Lodish, H.F. and Bonner-Weir, S. (1990): Reduced expression of the liver /beta-cell glucose transporter isoform in glucose-insensitive pancreatic beta cells of diabetic rats. Proc. Natl. Acad. Sci. USA 87:6492-6496. Till, J.H., Annan, R.S., Carr, S.A. and Miller, W.T. (1994): Use of synthetic peptide libraries and phosphopeptide-selective mass spectrometry to probe protein kinase substrate specificity. The Journal of Biological Chemistry 269:7423-7428. Toker, A. and Cantley, L.C (1997): Signalling through the lipid products of phosphoinositide-3-OH kinase. Nature 387:673-676. Treisman, R. (1994): Ternary complex factors: growth factor regulated transcriptional activators. Current Opinion in Genetics and Development 4:96-101. Ueki, K., Matsuda, K , Tobe, Y., Gotoh, H., Tamemoto, M., Yachi, M., Akanuma, Y., Yakazaki, Y., Nishida, E. and Kadowaki, T. (1994): Feedback regulation of 214 mitogen-activated and phorbol ester stimulation. The Journal of Biological Chemistry 269:15756-15763. Ullrich, A. and Schlessinger, J. (1990): Signal transduction by receptors with tyrosine kinase activity. Cell 61:203-212. Ullrich, A., Bell, JR., Chen, E.Y., Herrera, R., Petruzzelli, L.M., Dull, T.J., Gray, A., Coussens, L., Liao, Y.-C, Tsubokawa, M., Mason, A., Seeburg, PH., Grunfeld, C , Rosen, O.M. and Ramachandran, J. (1985): Human insulin receptor and its relationship to the tyrosine kinase family of oncogenes. Nature 313:756-761. van Biesen, T., Hawes, B.E., Luttrell, D.K., Krueger, K.M., Touhara, K., Porfiri, E., Sakaue, M., Luttrell, L.M. and Lefkowitz, R.J. (1995): Receptor-tyrosine-kinase-and GPy-mediated MAP kinase activation by a common signalling pathway. Nature 376:781-729. van Corven, E.J., Hordijk, P.L., Medema, R.H., Bds J.L. and Moolenaar, W.H. (1993): Pertussis toxin-sensitive activation of p21ras by G protein-coupled receptor agonists in fibroblasts. Proc. Natl. Acad. Sci. USA 90:1257-1261. van Dam, H., Duyndam, M., Rottier, R., Bosch, A., de Vries-Smits, L., Herrlich, P., Zantema, A., Angel, P. and van der Eb, A.J. (1993): Heterodimer formation of c-Jun and ATF-2 is responsible for induction of c-Jun by the 243 amino acid adenovirus El A protein. The EMBO Journal 12:479:487. van den Berghe, N., Ouwens, D.M., Maassen, J.A., van Mackelenbergh, M.G.H., Sips, H.C.M. and Krans, H.M.J. (1994): Activation of the ras/mitogen-activated protein kinase signaling pathway alone is not sufficient to induce glucose uptake in 3T3-Ll adipocytes. Molecular and Cellular Biology 14:2372-2377. Vale, R.D. and Shooter, E.M. (1983): Conversion of nerve growth factor-receptor complexes to a slowly dissociating, triton X-100 insoluble state by anti nerve growth factor antibodies. Biochemistry 22:5022-5028. Vaulont, S. and Kahn, A. (1994): Transcriptional control of metabolic regulation by carbohydrates. FASEB Journal 8:28-35. von Manteuffel, S.R., Gingras, A-C, Ming, X-F., Sonenberg, N. and Thomas, G. (1996): 4E-BP1 phosphorylation is mediated by the FRAP-p70s6k pathway and is independent of mitogen-activated protein kinase. Proc. Natl. Acad. Sci. USA 93:4076-4080. von Manteuffel, S.R., Dennis, P.B., Pullen, N., Gingras, A-C, Sonenberg, N. and Thomas, G. (1997): The insulin-induced signalling pathway leading to S6 and initiation factor 4E binding protein 1 phosphorylation bifurcates at a rapamycin-215 sensitive point immediately upstream of p70s6k. Molecular and Cellular Biology 17:5426-5436. Wan, Y., Kurosaki, T. and Huang, X.Y. (1996): Tyrosine kinases in activation of the MAP kinase cascade by G-protein-coupled receptors. Nature 380:541-544. Wang, E. and Goldberg, A.R. (1978): Binding of debxyribonuclease I to actin: A new way to visualize microfilament bundles in non-muscle cells. J. Histochem. Cytochem. 26:745-749. Wedekind, F., Baer-Pontzen, K., Bala-Mohan, S., Choli, D., Zahn, H. and Brandenburg, D. (1989): Hormone binding site of the insulin receptor: Analysis using photoaffinity-mediated avidin complexing. Biol. Chem. Hoppe-Seyler 370:251-258. ! Wiegant, F.A.C., Blok, F.J., Defize, L.H.K., Linnemans, W.A.M., Verkley, A.J. and Boonstra, J. (1986): Epidermal growth factor receptors associated to cytoskeletal elements of epidermoid carcinoma (A431) cells. The Journal of Cell Biology 103:87-94. Welsh, G.I., Foulstone, E.J., Young, S.W., Tavare, J.M. and Proud, C.G. (1994): Wortmannin inhibits the effects of insulin and serum on the activities of glucogen synthase kinase-3 and mitogen-activated protein kinase. Biochemical Journal 303:15-20. Welsh, G.I. and Proud, C.G. (1993): Glycogen synthase kinase-3 is rapidly inactivated in response to insulin and phosphorylates eukaryotic initiation factor eIF-2B. Biochemical Journal 294:625-629. Welsh, G.I. and Proud, C.G. (1992): Regulation of protein synthesis in Swiss 3T3 fibroblasts. Rapid activation of the guanine-nucleotide-exchange factor by insulin and growth factors. Biochemical Journal 284:19-23. Welsh, G.I., Wilson, C. and Proud, C.G. (1996): GSK3: a SHAGGY frog story. Trends in Cell Biology 6:274-279. White, M.F. and Kahn, C.R. (1993): Mechanisms of insulin action. In: Insulin Resistance (Ed) Moller, D.E. John Wiley and Sons p. 9-47. White, M.F. and Kahn, C.R. (1994): The insulin signaling system. The Journal of Biological Chemistry 269:1-5. White, M.F., Shoelson, S.E., Kentmann, H. and Kahn, C.R. (1988): A cascade of tyrosine autophosphorylation in the P-subunit activates the insulin receptor. The Journal of Biological Chemistry 263:2969-2980. 216 White, M.F., Stegmann, E.W., Dull, T.J., Ullrich, A. and Kahn, C.R. (1987): Characterization of an endogenous substrate of the insulin receptor in cultured cells. The Journal of Biological Chemistry 262:9769-9777. Wiese, R.J., Mastick, C C , Lazar, D.F. and Saltiel, A.R. (1995): Activation of mitogen-activated protein kinase and phosphatidylinositol 3-kinase is not sufficient for the hormonal stimulation of glucose uptake, lipogenesis, or glycogen synthesis in 3T3-L1 adipocytes. The Journal of Biological Chemistry 270:3442-3446. Wilden, P.A., Kahn, C.R., Siddle, K. and White, M.F. (1992): Insulin receptor kinase domain autophosphorylation regulates receptor enzymatic function. The Journal of Biological Chemistry 267:16660-16668., Winz, R.A. (1993): Structure/function studies of rat acetyl-Coenzyme A carboxylase. PhD thesis, University of British Columbia. Witters, L.A. (1981): Insulin stimulates the phosphorylation of acetyl-CoA carboxylase. Biochem. Biophys. Res. Commun. 100:872-878. Witters, L.A., Watts, T.D., Daniels, D.L., Evans, J.L. 1988: Insulin stimulates the dephosphorylation and activation of acetyl-CoA carboxylase. Proc. Natl. Acad. Sci. USA 85:5473-5477. Wu, J., Dent, P., Jelinek, T., Wolfman, A., Weber, M.J. and Sturgill, T.W. (1993): Inhibition of the EGF-activated MAP kinase signaling pathway by adenosine 3', 5'-monophosphate. Science 262:1065-1072. Xie, W. and Rothblum, L.I. (1993): rDNA transcription and cardiac hypertrophy. Trends in Cardiovascular Medicine 3:7-11. Xing, J., Ginty, D.D. and Greenberg, ME. (1996): Coupling of the RAS-MAPK pathway to gene activation by RSK2, a growth factor-regulated CREB kinase. Science 273:959-963. Yagi, K., Mase, R., Sakabikara, I. and Asai, H. (1965): Function of heavy meromyosin in the acceleration of actin polymerization. The Journal of Biological Chemistry 240:2448-2454. Yamaguchi, Y., Flier, J.S., Yokota, A., Benecke, H., Backer, J.M. and Moller, D.E. (1991): Functional properties of two naturally occurring isoforms of the human insulin receptor in Chinese hamster ovary cells. Endocrinology 129:2058-2066. Yenush, L., Makati, K.J., Smith-Hall, J., Ishibashi, O., Myers, MG. and White, M.F. (1996): The pleckstrin homology domain is the principle link between the insulin receptor and IRS-1. The Journal of Biological Chemistry 271:24300-24306. 217 Yenush, L., Makati, K.J., Smith-Hall, J., Ishibashi, O., Myers, M.G. and White, M.F. (1996): The pleckstrin homology domain is the principle link between the insulin receptor and IRS-1. The Journal of Biological Chemistry 271:24300-24306. Yip, CC. (1992): The insulin-binding domain of insulin receptor is encoded by exon 2 and exon 3. The Journal of Cell Biochemistry 48:19-25. Yip, C C , Hsu, H., Patel, R.G., Hawley, D.M., Maddux, BA. and Goldfine, I.D. (1988): Localization of the insulin-binding site to the cysteine-rich region of the insulin receptor a-subunit. Biochem. Biophys. Res. Commun. 157:321-329. Yu, K.-T., Benjamin, W.B., Ramakrishna, S., Khalaf, N. and Czech, M.P. (1990): An insulin-sensitive cytosolic protein kinase accounts for the regulation of ATP citrate-lyase phosphorylation. Biochemical Journal 268:539-545. Zechel, K. (1980): Isolation of polymerization-competent cytoplasmic actin by affinity chromatography on immobilized DNAase I using formamide as eluent. European Journal of Biochemistry 110:343-348. Zhande, R. (1991): Purification and characterization of an insulin-stimulated kinase. M. Sc. thesis, University of British Columbia. Zhang, S., Han, J., Sells, M.A., Chernoff, J., Knaus, U.G., Ulevitch, R.J. and Bokoch, G.M. (1995): Rho family GTPases regulate p38 mitogen-activated protein kinase through the downstream mediator Pakl. The Journal of Biological Chemistry 270:23934-23936. Zheng, CF. and Guan, K.L. (1993): Dephosphorylation and inactivation of the mitogen-activated protein kinase by a mitogen-induced thr/tyr protein phosphatase. The Journal of Biological Chemistry 268:16116-16119. Zhou, G., Bao, Z.Q. and Dixon, J.E. (1995a): Components of a new human protein kinase signal transduction pathway. The Journal of Biological Chemistry 270:12665-12669. Zhou, M-M., Ravichandran, K.S., Olejniczak, E.T., Petros, A.M., Meadows, R.P., Sattler, M., Harlan, J.E., Wade, W.S., Burakoff, S.J. and Fesik, S.W. (1995): Structure and ligand recognition of the phosphotyrosine binding domain of She. Nature 378:584-592. Zick, Y. (1989): The insulin receptor: structure and function. Critical Reviews in Biochemisty and Molecular Biology 24:217-269. 218 

Cite

Citation Scheme:

        

Citations by CSL (citeproc-js)

Usage Statistics

Share

Embed

Customize your widget with the following options, then copy and paste the code below into the HTML of your page to embed this item in your website.
                        
                            <div id="ubcOpenCollectionsWidgetDisplay">
                            <script id="ubcOpenCollectionsWidget"
                            src="{[{embed.src}]}"
                            data-item="{[{embed.item}]}"
                            data-collection="{[{embed.collection}]}"
                            data-metadata="{[{embed.showMetadata}]}"
                            data-width="{[{embed.width}]}"
                            async >
                            </script>
                            </div>
                        
                    
IIIF logo Our image viewer uses the IIIF 2.0 standard. To load this item in other compatible viewers, use this url:
http://iiif.library.ubc.ca/presentation/dsp.831.1-0088775/manifest

Comment

Related Items